Citrus Sinensis ID: 033797


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MRNSVNRPPTPDAVEDQEKEPTLQEIINIKMIESGEKEKLMELLRERLVECGWKDEMKALCRAYIKKKGTNNVTVDDLVHVITPKGRASIPDSIKTELLLRIRAFLASAAL
cccccccccccccHccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccc
*************************IINIKMIESGEKEKLMELLRERLVECGWKDEMKALCRAYIKKKGTNNVTVDDLVHVITPKGRASIPDSIKTELLLRIRAFLA****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRNSVNRPPTPDAVEDQEKEPTLQEIINIKMIESGEKEKLMELLRERLVECGWKDEMKALCRAYIKKKGTNNVTVDDLVHVITPKGRASIPDSIKTELLLRIRAFLASAAL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Enhancer of yellow 2 transcription factor homolog Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. May also participate in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery.probableQ9JIX0
Enhancer of yellow 2 transcription factor homolog Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as MYC, where it is required for transcription. Required for nuclear receptor-mediated transactivation. May also participate in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery.probableB5FZ63
Enhancer of yellow 2 transcription factor homolog Component of the transcription regulatory histone acetylation (HAT) complex SAGA, a multiprotein complex that activates transcription by remodeling chromatin and mediating histone acetylation and deubiquitination. Within the SAGA complex, participates in a subcomplex that specifically deubiquitinates both histones H2A and H2B. The SAGA complex is recruited to specific gene promoters by activators such as myc, where it is required for transcription. Required for nuclear receptor-mediated transactivation. May also participate in mRNA export and accurate chromatin positioning in the nucleus by tethering genes to the nuclear periphery.probableQ6DH42

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DHX, chain B
Confidence level:very confident
Coverage over the Query: 20-109
View the alignment between query and template
View the model in PyMOL