Query         033800
Match_columns 111
No_of_seqs    142 out of 357
Neff          3.9 
Searched_HMMs 46136
Date          Fri Mar 29 06:26:04 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033800.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033800hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06203 CCT:  CCT motif;  Inte  99.9 9.4E-23   2E-27  127.2   3.4   45   58-102     1-45  (45)
  2 KOG1601 GATA-4/5/6 transcripti  96.9 0.00029 6.3E-09   51.1   0.5   41   55-95    290-330 (340)
  3 PF09425 CCT_2:  Divergent CCT   95.9  0.0054 1.2E-07   34.9   1.7   25   56-81      2-26  (27)
  4 smart00521 CBF CCAAT-Binding t  52.7      22 0.00048   23.7   3.3   25   75-99     36-61  (62)
  5 PF02045 CBFB_NFYA:  CCAAT-bind  41.6      43 0.00094   22.0   3.3   22   76-97     36-58  (58)
  6 KOG4571 Activating transcripti  31.4      78  0.0017   26.8   4.1   19   54-72    231-249 (294)
  7 PF15321 ATAD4:  ATPase family   26.6      14  0.0003   25.9  -1.0   11   63-73     69-79  (84)
  8 PF09692 Arb1:  Argonaute siRNA  22.0      50  0.0011   28.6   1.3   15   56-70     46-61  (396)
  9 KOG1561 CCAAT-binding factor,   19.5   1E+02  0.0022   25.9   2.7   49   56-104   190-246 (307)
 10 PF02009 Rifin_STEVOR:  Rifin/s  19.4      60  0.0013   27.1   1.2   12   62-73    278-289 (299)

No 1  
>PF06203 CCT:  CCT motif;  InterPro: IPR010402 The CCT (CONSTANS, CO-like, and TOC1) domain is a highly conserved basic module of ~43 amino acids, which is found near the C terminus of plant proteins often involved in light signal transduction. The CCT domain is found in association with other domains, such as the B-box zinc finger, the GATA-type zinc finger, the ZIM motif or the response regulatory domain. The CCT domain contains a putative nuclear localisation signal within the second half of the CCT motif and has been shown to be involved in nuclear localization and probably also has a role in protein-protein interaction [].; GO: 0005515 protein binding
Probab=99.86  E-value=9.4e-23  Score=127.19  Aligned_cols=45  Identities=53%  Similarity=0.846  Sum_probs=43.0

Q ss_pred             HHHHHHHHHHHHhhhccCCcccccchhhhhhhccCCCcceecCCC
Q 033800           58 RENAMMRYKEKKKARRQDKQIQYPSRKARADARKRVQGRFLKTEG  102 (111)
Q Consensus        58 R~~~v~RYreKkk~R~f~KkIrY~~RK~~Ad~RpRvKGRFvk~~~  102 (111)
                      |+++|+||+|||++|+|+|+|+|++||++||.|||||||||+.++
T Consensus         1 R~~~l~Ry~~Kr~~R~f~kkirY~~Rk~~A~~R~RvkGRFvk~~e   45 (45)
T PF06203_consen    1 REEKLQRYREKRKRRNFEKKIRYESRKAVADKRPRVKGRFVKKSE   45 (45)
T ss_pred             CHHHHHHHHHHHHhhcccccCCcchHHHHHhhCCccCCcccCCCC
Confidence            689999999999999999999999999999999999999999853


No 2  
>KOG1601 consensus GATA-4/5/6 transcription factors [Transcription]
Probab=96.90  E-value=0.00029  Score=51.05  Aligned_cols=41  Identities=39%  Similarity=0.653  Sum_probs=39.9

Q ss_pred             HHHHHHHHHHHHHHHhhhccCCcccccchhhhhhhccCCCc
Q 033800           55 LEARENAMMRYKEKKKARRQDKQIQYPSRKARADARKRVQG   95 (111)
Q Consensus        55 ~~~R~~~v~RYreKkk~R~f~KkIrY~~RK~~Ad~RpRvKG   95 (111)
                      ...|+..+.||++++..+.|.++|+|..|+..|+.+++++|
T Consensus       290 ~~~~~~~~~r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  330 (340)
T KOG1601|consen  290 SHQRVAEVRRYRESRDGRYFDKGIRYASRKSNAESRPRLKG  330 (340)
T ss_pred             cchHHHHHhhccCccCCcccccccccccccccchhcccccc
Confidence            68999999999999999999999999999999999999999


No 3  
>PF09425 CCT_2:  Divergent CCT motif;  InterPro: IPR018467 The short CCT (CO, COL, TOC1) motif is found in a number of plant proteins, including Constans (CO), Constans-like (COL) and TOC1. The CCT motif is about 45 amino acids long and contains a putative nuclear localisation signal within the second half of the CCT motif []. The CCT motif is found in the Arabidopsis circadian rhythm protein TOC1, an autoregulatory response regulator homologue the controls the photoperiodic flowering through its clock function []. ; GO: 0005515 protein binding; PDB: 3OGK_V 3OGL_S 3OGM_W.
Probab=95.89  E-value=0.0054  Score=34.87  Aligned_cols=25  Identities=32%  Similarity=0.500  Sum_probs=9.9

Q ss_pred             HHHHHHHHHHHHHHhhhccCCccccc
Q 033800           56 EARENAMMRYKEKKKARRQDKQIQYP   81 (111)
Q Consensus        56 ~~R~~~v~RYreKkk~R~f~KkIrY~   81 (111)
                      .+|.+.|+||.||||.|... +.-|.
T Consensus         2 ~aRK~SLqRFLeKRK~R~~~-~~PY~   26 (27)
T PF09425_consen    2 IARKASLQRFLEKRKDRLAA-KSPYQ   26 (27)
T ss_dssp             ----HHHHHHHHHH------------
T ss_pred             chHHHHHHHHHHHHHHhhcc-CCCCC
Confidence            57999999999999999977 55553


No 4  
>smart00521 CBF CCAAT-Binding transcription Factor.
Probab=52.68  E-value=22  Score=23.70  Aligned_cols=25  Identities=40%  Similarity=0.445  Sum_probs=21.9

Q ss_pred             CCcccccchhhhhhhccC-CCcceec
Q 033800           75 DKQIQYPSRKARADARKR-VQGRFLK   99 (111)
Q Consensus        75 ~KkIrY~~RK~~Ad~RpR-vKGRFvk   99 (111)
                      .|..-+++|-..|-.|+| --|||.+
T Consensus        36 rkpYlhESRH~HAm~R~Rg~gGRFl~   61 (62)
T smart00521       36 RKPYLHESRHLHAMRRPRGSGGRFLN   61 (62)
T ss_pred             cCCcccchhHHHHHccCcCCCCCCCC
Confidence            567889999999999999 6789975


No 5  
>PF02045 CBFB_NFYA:  CCAAT-binding transcription factor (CBF-B/NF-YA) subunit B;  InterPro: IPR001289 The CCAAT-binding factor (CBFB/NF-YA) is a mammalian transcription factor that binds to a CCAAT motif in the promoters of a wide variety of genes, including type I collagen and albumin []. The factor is a heteromeric complex of A and B subunits, both of which are required for DNA-binding []. The subunits can interact in the absence of DNA-binding, conserved regions in each being important in mediating this interaction. The B subunit contains a region of similarity with the yeast protein HAP2 []. For the B subunit it has been suggested that the N-terminal portion of the conserved region is involved in subunit interaction and the C-terminal region involved in DNA-binding [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=41.61  E-value=43  Score=22.03  Aligned_cols=22  Identities=41%  Similarity=0.437  Sum_probs=18.3

Q ss_pred             CcccccchhhhhhhccC-CCcce
Q 033800           76 KQIQYPSRKARADARKR-VQGRF   97 (111)
Q Consensus        76 KkIrY~~RK~~Ad~RpR-vKGRF   97 (111)
                      |+.-+++|-..|-.|+| --|||
T Consensus        36 k~YlheSRH~HA~~R~Rg~gGRF   58 (58)
T PF02045_consen   36 KPYLHESRHKHAMRRPRGPGGRF   58 (58)
T ss_pred             HHHHHHHHHHHHHcCccCCCCCC
Confidence            44578999999999999 66777


No 6  
>KOG4571 consensus Activating transcription factor 4 [Transcription]
Probab=31.45  E-value=78  Score=26.75  Aligned_cols=19  Identities=32%  Similarity=0.545  Sum_probs=13.9

Q ss_pred             CHHHHHHHHHHHHHHHhhh
Q 033800           54 HLEARENAMMRYKEKKKAR   72 (111)
Q Consensus        54 ~~~~R~~~v~RYreKkk~R   72 (111)
                      ..+.|..|-.|||+||+.-
T Consensus       231 kr~qnk~AAtRYRqKkRae  249 (294)
T KOG4571|consen  231 KRQQNKAAATRYRQKKRAE  249 (294)
T ss_pred             HHHHhHHHHHHHHHHHHHH
Confidence            3456666779999999764


No 7  
>PF15321 ATAD4:  ATPase family AAA domain containing 4
Probab=26.64  E-value=14  Score=25.87  Aligned_cols=11  Identities=55%  Similarity=0.800  Sum_probs=8.7

Q ss_pred             HHHHHHHhhhc
Q 033800           63 MRYKEKKKARR   73 (111)
Q Consensus        63 ~RYreKkk~R~   73 (111)
                      =||+||||-|-
T Consensus        69 GRFKEKrKvRa   79 (84)
T PF15321_consen   69 GRFKEKRKVRA   79 (84)
T ss_pred             ccccccccccc
Confidence            48999998764


No 8  
>PF09692 Arb1:  Argonaute siRNA chaperone (ARC) complex subunit Arb1;  InterPro: IPR018606  Arb1 is required for histone H3 Lys9 (H3-K9) methylation, heterochromatin, assembly and siRNA generation in fission yeast []. 
Probab=21.95  E-value=50  Score=28.60  Aligned_cols=15  Identities=27%  Similarity=0.724  Sum_probs=11.6

Q ss_pred             HHH-HHHHHHHHHHHh
Q 033800           56 EAR-ENAMMRYKEKKK   70 (111)
Q Consensus        56 ~~R-~~~v~RYreKkk   70 (111)
                      .+| +.+|+||+.||+
T Consensus        46 ~~RiE~~IQRyr~rRR   61 (396)
T PF09692_consen   46 VERIEECIQRYRARRR   61 (396)
T ss_pred             HHHHHHHHHHHHHhcC
Confidence            344 678999999885


No 9  
>KOG1561 consensus CCAAT-binding factor, subunit B (HAP2) [Transcription]
Probab=19.49  E-value=1e+02  Score=25.95  Aligned_cols=49  Identities=27%  Similarity=0.375  Sum_probs=32.6

Q ss_pred             HHHHHHHHHHHHHHhhhc-------cCCcccccchhhhhhhccC-CCcceecCCCCC
Q 033800           56 EARENAMMRYKEKKKARR-------QDKQIQYPSRKARADARKR-VQGRFLKTEGYD  104 (111)
Q Consensus        56 ~~R~~~v~RYreKkk~R~-------f~KkIrY~~RK~~Ad~RpR-vKGRFvk~~~~d  104 (111)
                      +.--.+|+|=|+-|.+--       =-|+---++|-..|-+|+| --|||....+++
T Consensus       190 aKQY~~IlrRRq~RaKlEa~~klik~RkpYLHESRH~HAmkR~RG~GGRFln~k~~~  246 (307)
T KOG1561|consen  190 AKQYHRILRRRQARAKLEATTKLIKARKPYLHESRHLHAMKRARGEGGRFLNTKEYH  246 (307)
T ss_pred             HHHHHHHHHHHHHHhhhhhcccchhhcCccccchhhHHHhhcccCCCCCCCchhhhh
Confidence            344555666555443221       1234456899999999999 999999996544


No 10 
>PF02009 Rifin_STEVOR:  Rifin/stevor family;  InterPro: IPR002858 Malaria is still a major cause of mortality in many areas of the world. Plasmodium falciparum causes the most severe human form of the disease and is responsible for most fatalities. Severe cases of malaria can occur when the parasite invades and then proliferates within red blood cell erythrocytes. The parasite produces many variant antigenic proteins, encoded by multigene families, which are present on the surface of the infected erythrocyte and play important roles in virulence. A crucial survival mechanism for the malaria parasite is its ability to evade the immune response by switching these variant surface antigens. The high virulence of P. falciparum relative to other malarial parasites is in large part due to the fact that in this organism many of these surface antigens mediate the binding of infected erythrocytes to the vascular endothelium (cytoadherence) and non-infected erythrocytes (rosetting). This can lead to the accumulation of infected cells in the vasculature of a variety of organs, blocking the blood flow and reducing the oxygen supply. Clinical symptoms of severe infection can include fever, progressive anaemia, multi-organ dysfunction and coma. For more information see []. Several multicopy gene families have been described in Plasmodium falciparum, including the stevor family of subtelomeric open reading frames and the rif interspersed repetitive elements. Both families contain three predicted transmembrane segments. It has been proposed that stevor and rif are members of a larger superfamily that code for variant surface antigens [].
Probab=19.44  E-value=60  Score=27.08  Aligned_cols=12  Identities=42%  Similarity=0.977  Sum_probs=9.2

Q ss_pred             HHHHHHHHhhhc
Q 033800           62 MMRYKEKKKARR   73 (111)
Q Consensus        62 v~RYreKkk~R~   73 (111)
                      |+|||-|||..+
T Consensus       278 ILRYRRKKKmkK  289 (299)
T PF02009_consen  278 ILRYRRKKKMKK  289 (299)
T ss_pred             HHHHHHHhhhhH
Confidence            489999887643


Done!