Citrus Sinensis ID: 033833
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 110 | ||||||
| 18416872 | 535 | calmodulin-domain protein kinase 7 [Arab | 0.981 | 0.201 | 0.777 | 2e-45 | |
| 297811393 | 535 | calmodulin-domain protein kinase 7 [Arab | 0.981 | 0.201 | 0.777 | 3e-45 | |
| 373089193 | 532 | calcium-dependent protein kinase [Morus | 0.981 | 0.203 | 0.796 | 5e-45 | |
| 297812129 | 533 | calcium-dependent protein kinase 19 [Ara | 0.981 | 0.202 | 0.768 | 5e-45 | |
| 15239742 | 533 | calcium-dependent protein kinase 19 [Ara | 0.981 | 0.202 | 0.768 | 6e-45 | |
| 337729587 | 530 | calcium-dependent protein kinase [Hevea | 0.981 | 0.203 | 0.787 | 6e-45 | |
| 110742404 | 478 | calcium-dependent protein kinase [Arabid | 0.981 | 0.225 | 0.768 | 6e-45 | |
| 255577483 | 529 | calcium-dependent protein kinase, putati | 0.981 | 0.204 | 0.787 | 9e-45 | |
| 224104161 | 533 | predicted protein [Populus trichocarpa] | 0.981 | 0.202 | 0.777 | 9e-45 | |
| 255544870 | 536 | calcium-dependent protein kinase, putati | 0.981 | 0.201 | 0.787 | 1e-44 |
| >gi|18416872|ref|NP_568281.1| calmodulin-domain protein kinase 7 [Arabidopsis thaliana] gi|75319419|sp|Q38873.1|CDPK7_ARATH RecName: Full=Calcium-dependent protein kinase 7; AltName: Full=Calmodulin-domain protein kinase CDPK isoform 7 gi|13605617|gb|AAK32802.1|AF361634_1 AT5g19450/F7K24_200 [Arabidopsis thaliana] gi|1399277|gb|AAB03247.1| calmodulin-domain protein kinase CDPK isoform 7 [Arabidopsis thaliana] gi|14586378|emb|CAC42909.1| calcium-dependent protein kinase-like protein [Arabidopsis thaliana] gi|332004432|gb|AED91815.1| calmodulin-domain protein kinase 7 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 186 bits (472), Expect = 2e-45, Method: Compositional matrix adjust.
Identities = 84/108 (77%), Positives = 95/108 (87%)
Query: 1 MKLCEEGELVDRIVAKGHYTERVAAAVMKTIVEVVQVCHKHGVMHHDLNPKKILFVNKKK 60
M+LCE GEL DRIVA+GHYTER AAAVMKTIVEVVQ+CHK GVMH DL P+ LF NKK+
Sbjct: 137 MELCEGGELFDRIVARGHYTERAAAAVMKTIVEVVQICHKQGVMHRDLKPENFLFANKKE 196
Query: 61 SFSLKAIDFGLSVFFRPREQFNELVGSLYYMALEVLKRNYGPEVDVWS 108
+ +LKAIDFGLSVFF+P EQFNE+VGS YYMA EVL+RNYGPE+DVWS
Sbjct: 197 TSALKAIDFGLSVFFKPGEQFNEIVGSPYYMAPEVLRRNYGPEIDVWS 244
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|297811393|ref|XP_002873580.1| calmodulin-domain protein kinase 7 [Arabidopsis lyrata subsp. lyrata] gi|297319417|gb|EFH49839.1| calmodulin-domain protein kinase 7 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|373089193|gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] | Back alignment and taxonomy information |
|---|
| >gi|297812129|ref|XP_002873948.1| calcium-dependent protein kinase 19 [Arabidopsis lyrata subsp. lyrata] gi|297319785|gb|EFH50207.1| calcium-dependent protein kinase 19 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15239742|ref|NP_197446.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana] gi|30687323|ref|NP_850853.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana] gi|75319668|sp|Q42438.1|CDPK8_ARATH RecName: Full=Calcium-dependent protein kinase 8; AltName: Full=Calcium-dependent protein kinase isoform CDPK19; Short=AtCDPK19 gi|836942|gb|AAA67655.1| calcium-dependent protein kinase [Arabidopsis thaliana] gi|836948|gb|AAA67658.1| calcium-dependent protein kinase [Arabidopsis thaliana] gi|332005325|gb|AED92708.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana] gi|332005326|gb|AED92709.1| calcium-dependent protein kinase 19 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|337729587|gb|AEI70328.1| calcium-dependent protein kinase [Hevea brasiliensis] | Back alignment and taxonomy information |
|---|
| >gi|110742404|dbj|BAE99123.1| calcium-dependent protein kinase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|255577483|ref|XP_002529620.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223530905|gb|EEF32765.1| calcium-dependent protein kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224104161|ref|XP_002313342.1| predicted protein [Populus trichocarpa] gi|222849750|gb|EEE87297.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255544870|ref|XP_002513496.1| calcium-dependent protein kinase, putative [Ricinus communis] gi|223547404|gb|EEF48899.1| calcium-dependent protein kinase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 110 | ||||||
| TAIR|locus:505006616 | 535 | CPK7 "calmodulin-domain protei | 0.981 | 0.201 | 0.777 | 9.3e-43 | |
| TAIR|locus:2150230 | 533 | CDPK19 "calcium-dependent prot | 0.981 | 0.202 | 0.768 | 1.5e-42 | |
| TAIR|locus:2103498 | 538 | CPK32 "calcium-dependent prote | 0.981 | 0.200 | 0.777 | 4e-42 | |
| TAIR|locus:2054386 | 530 | CPK14 "calcium-dependent prote | 0.981 | 0.203 | 0.731 | 5.9e-41 | |
| TAIR|locus:2074338 | 528 | CPK13 "calcium-dependent prote | 0.981 | 0.204 | 0.731 | 7.5e-41 | |
| TAIR|locus:2027227 | 541 | CPK30 "calcium-dependent prote | 0.981 | 0.199 | 0.712 | 2.1e-38 | |
| TAIR|locus:2061290 | 582 | CPK24 "AT2G31500" [Arabidopsis | 0.981 | 0.185 | 0.675 | 3.4e-38 | |
| TAIR|locus:2011201 | 545 | CDPK1 "calcium-dependent prote | 0.981 | 0.198 | 0.703 | 8.9e-38 | |
| TAIR|locus:2177023 | 528 | CPK17 "calcium-dependent prote | 0.990 | 0.206 | 0.587 | 2e-33 | |
| TAIR|locus:2150225 | 523 | CPK34 "AT5G19360" [Arabidopsis | 0.990 | 0.208 | 0.559 | 2.2e-32 |
| TAIR|locus:505006616 CPK7 "calmodulin-domain protein kinase 7" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 452 (164.2 bits), Expect = 9.3e-43, P = 9.3e-43
Identities = 84/108 (77%), Positives = 95/108 (87%)
Query: 1 MKLCEEGELVDRIVAKGHYTERVAAAVMKTIVEVVQVCHKHGVMHHDLNPKKILFVNKKK 60
M+LCE GEL DRIVA+GHYTER AAAVMKTIVEVVQ+CHK GVMH DL P+ LF NKK+
Sbjct: 137 MELCEGGELFDRIVARGHYTERAAAAVMKTIVEVVQICHKQGVMHRDLKPENFLFANKKE 196
Query: 61 SFSLKAIDFGLSVFFRPREQFNELVGSLYYMALEVLKRNYGPEVDVWS 108
+ +LKAIDFGLSVFF+P EQFNE+VGS YYMA EVL+RNYGPE+DVWS
Sbjct: 197 TSALKAIDFGLSVFFKPGEQFNEIVGSPYYMAPEVLRRNYGPEIDVWS 244
|
|
| TAIR|locus:2150230 CDPK19 "calcium-dependent protein kinase 19" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2103498 CPK32 "calcium-dependent protein kinase 32" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2054386 CPK14 "calcium-dependent protein kinase 14" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074338 CPK13 "calcium-dependent protein kinase 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2027227 CPK30 "calcium-dependent protein kinase 30" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2061290 CPK24 "AT2G31500" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2011201 CDPK1 "calcium-dependent protein kinase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2177023 CPK17 "calcium-dependent protein kinase 17" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2150225 CPK34 "AT5G19360" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 110 | |||
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 7e-28 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 2e-27 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 2e-21 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 3e-20 | |
| cd07832 | 286 | cd07832, STKc_CCRK, Catalytic domain of the Serine | 1e-15 | |
| cd06626 | 264 | cd06626, STKc_MEKK4, Catalytic domain of the Prote | 1e-14 | |
| COG0515 | 384 | COG0515, SPS1, Serine/threonine protein kinase [Ge | 5e-14 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 3e-13 | |
| cd06606 | 260 | cd06606, STKc_MAPKKK, Catalytic domain of the Prot | 4e-13 | |
| cd07840 | 287 | cd07840, STKc_CDK9_like, Catalytic domain of Cycli | 2e-12 | |
| cd06648 | 285 | cd06648, STKc_PAK_II, Catalytic domain of the Prot | 2e-12 | |
| cd06614 | 286 | cd06614, STKc_PAK, Catalytic domain of the Protein | 3e-12 | |
| cd06657 | 292 | cd06657, STKc_PAK4, Catalytic domain of the Protei | 3e-12 | |
| cd07837 | 295 | cd07837, STKc_CdkB_plant, Catalytic domain of the | 4e-12 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 6e-12 | |
| cd06654 | 296 | cd06654, STKc_PAK1, Catalytic domain of the Protei | 3e-11 | |
| cd05118 | 283 | cd05118, STKc_CMGC, Catalytic domain of CMGC famil | 3e-11 | |
| cd06610 | 267 | cd06610, STKc_OSR1_SPAK, Catalytic domain of the P | 4e-11 | |
| cd06647 | 293 | cd06647, STKc_PAK_I, Catalytic domain of the Prote | 4e-11 | |
| cd07829 | 282 | cd07829, STKc_CDK_like, Catalytic domain of Cyclin | 5e-11 | |
| cd07864 | 302 | cd07864, STKc_CDK12, Catalytic domain of the Serin | 5e-11 | |
| cd05123 | 250 | cd05123, STKc_AGC, Catalytic domain of AGC family | 5e-11 | |
| cd07841 | 298 | cd07841, STKc_CDK7, Catalytic domain of the Serine | 6e-11 | |
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 6e-11 | |
| cd05578 | 258 | cd05578, STKc_Yank1, Catalytic domain of the Prote | 1e-10 | |
| cd07843 | 293 | cd07843, STKc_CDC2L1, Catalytic domain of the Seri | 1e-10 | |
| PLN00009 | 294 | PLN00009, PLN00009, cyclin-dependent kinase A; Pro | 1e-10 | |
| cd07836 | 284 | cd07836, STKc_Pho85, Catalytic domain of the Serin | 3e-10 | |
| cd06656 | 297 | cd06656, STKc_PAK3, Catalytic domain of the Protei | 3e-10 | |
| cd06658 | 292 | cd06658, STKc_PAK5, Catalytic domain of the Protei | 4e-10 | |
| cd06655 | 296 | cd06655, STKc_PAK2, Catalytic domain of the Protei | 5e-10 | |
| cd06659 | 297 | cd06659, STKc_PAK6, Catalytic domain of the Protei | 6e-10 | |
| cd07835 | 283 | cd07835, STKc_CDK1_like, Catalytic domain of Cycli | 2e-09 | |
| cd07833 | 288 | cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep | 2e-09 | |
| cd08215 | 258 | cd08215, STKc_Nek, Catalytic domain of the Protein | 4e-09 | |
| cd06608 | 275 | cd06608, STKc_myosinIII_like, Catalytic domain of | 7e-09 | |
| cd08221 | 256 | cd08221, STKc_Nek9, Catalytic domain of the Protei | 1e-08 | |
| cd06627 | 254 | cd06627, STKc_Cdc7_like, Catalytic domain of Cell | 2e-08 | |
| cd07856 | 328 | cd07856, STKc_Sty1_Hog1, Catalytic domain of the S | 3e-08 | |
| cd07847 | 286 | cd07847, STKc_CDKL1_4, Catalytic domain of the Ser | 4e-08 | |
| cd07860 | 284 | cd07860, STKc_CDK2_3, Catalytic domain of the Seri | 4e-08 | |
| cd05581 | 280 | cd05581, STKc_PDK1, Catalytic domain of the Protei | 6e-08 | |
| cd06917 | 277 | cd06917, STKc_NAK1_like, Catalytic domain of Funga | 7e-08 | |
| cd07838 | 287 | cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc | 7e-08 | |
| cd05572 | 262 | cd05572, STKc_cGK_PKG, Catalytic domain of the Pro | 8e-08 | |
| cd07839 | 284 | cd07839, STKc_CDK5, Catalytic domain of the Serine | 9e-08 | |
| cd05583 | 288 | cd05583, STKc_MSK_N, N-terminal catalytic domain o | 1e-07 | |
| cd06611 | 280 | cd06611, STKc_SLK_like, Catalytic domain of Ste20- | 1e-07 | |
| cd07862 | 290 | cd07862, STKc_CDK6, Catalytic domain of the Serine | 2e-07 | |
| cd07861 | 285 | cd07861, STKc_CDK1_euk, Catalytic domain of the Se | 2e-07 | |
| cd08217 | 265 | cd08217, STKc_Nek2, Catalytic domain of the Protei | 2e-07 | |
| cd07865 | 310 | cd07865, STKc_CDK9, Catalytic domain of the Serine | 3e-07 | |
| PTZ00024 | 335 | PTZ00024, PTZ00024, cyclin-dependent protein kinas | 3e-07 | |
| cd05586 | 330 | cd05586, STKc_Sck1_like, Catalytic domain of Suppr | 4e-07 | |
| cd08224 | 267 | cd08224, STKc_Nek6_Nek7, Catalytic domain of the P | 4e-07 | |
| cd06637 | 272 | cd06637, STKc_TNIK, Catalytic domain of the Protei | 6e-07 | |
| cd06632 | 258 | cd06632, STKc_MEKK1_plant, Catalytic domain of the | 6e-07 | |
| cd06628 | 267 | cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o | 7e-07 | |
| cd07863 | 288 | cd07863, STKc_CDK4, Catalytic domain of the Serine | 7e-07 | |
| cd06625 | 263 | cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ | 8e-07 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 9e-07 | |
| cd06652 | 265 | cd06652, STKc_MEKK2, Catalytic domain of the Prote | 1e-06 | |
| cd07846 | 286 | cd07846, STKc_CDKL2_3, Catalytic domain of the Ser | 1e-06 | |
| cd06612 | 256 | cd06612, STKc_MST1_2, Catalytic domain of the Prot | 2e-06 | |
| cd06653 | 264 | cd06653, STKc_MEKK3_like_1, Catalytic domain of MA | 2e-06 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 2e-06 | |
| cd06605 | 265 | cd06605, PKc_MAPKK, Catalytic domain of the dual-s | 3e-06 | |
| cd06651 | 266 | cd06651, STKc_MEKK3, Catalytic domain of the Prote | 4e-06 | |
| cd06636 | 282 | cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr | 5e-06 | |
| cd06650 | 333 | cd06650, PKc_MEK1, Catalytic domain of the dual-sp | 5e-06 | |
| cd06621 | 287 | cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of | 6e-06 | |
| cd08528 | 269 | cd08528, STKc_Nek10, Catalytic domain of the Prote | 8e-06 | |
| cd06649 | 331 | cd06649, PKc_MEK2, Catalytic domain of the dual-sp | 8e-06 | |
| cd05611 | 260 | cd05611, STKc_Rim15_like, Catalytic domain of fung | 9e-06 | |
| cd07853 | 372 | cd07853, STKc_NLK, Catalytic domain of the Serine/ | 1e-05 | |
| cd06618 | 296 | cd06618, PKc_MKK7, Catalytic domain of the dual-sp | 1e-05 | |
| cd07845 | 309 | cd07845, STKc_CDK10, Catalytic domain of the Serin | 2e-05 | |
| cd07834 | 330 | cd07834, STKc_MAPK, Catalytic domain of the Serine | 2e-05 | |
| cd07857 | 332 | cd07857, STKc_MPK1, Catalytic domain of the Serine | 2e-05 | |
| cd06635 | 317 | cd06635, STKc_TAO1, Catalytic domain of the Protei | 2e-05 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 2e-05 | |
| cd07876 | 359 | cd07876, STKc_JNK2, Catalytic domain of the Serine | 3e-05 | |
| cd06643 | 282 | cd06643, STKc_SLK, Catalytic domain of the Protein | 3e-05 | |
| cd07872 | 309 | cd07872, STKc_PCTAIRE2, Catalytic domain of the Se | 5e-05 | |
| PHA03212 | 391 | PHA03212, PHA03212, serine/threonine kinase US3; P | 5e-05 | |
| cd07874 | 355 | cd07874, STKc_JNK3, Catalytic domain of the Serine | 5e-05 | |
| cd08228 | 267 | cd08228, STKc_Nek6, Catalytic domain of the Protei | 7e-05 | |
| cd06634 | 308 | cd06634, STKc_TAO2, Catalytic domain of the Protei | 8e-05 | |
| cd06633 | 313 | cd06633, STKc_TAO3, Catalytic domain of the Protei | 8e-05 | |
| cd06609 | 274 | cd06609, STKc_MST3_like, Catalytic domain of Mamma | 8e-05 | |
| cd07831 | 282 | cd07831, STKc_MOK, Catalytic domain of the Serine/ | 8e-05 | |
| cd07875 | 364 | cd07875, STKc_JNK1, Catalytic domain of the Serine | 9e-05 | |
| cd07873 | 301 | cd07873, STKc_PCTAIRE1, Catalytic domain of the Se | 9e-05 | |
| cd05610 | 669 | cd05610, STKc_MASTL, Catalytic domain of the Prote | 1e-04 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 1e-04 | |
| cd07850 | 353 | cd07850, STKc_JNK, Catalytic domain of the Serine/ | 1e-04 | |
| cd07866 | 311 | cd07866, STKc_BUR1, Catalytic domain of the Serine | 1e-04 | |
| cd08229 | 267 | cd08229, STKc_Nek7, Catalytic domain of the Protei | 1e-04 | |
| cd06645 | 267 | cd06645, STKc_MAP4K3, Catalytic domain of the Prot | 1e-04 | |
| cd06615 | 308 | cd06615, PKc_MEK, Catalytic domain of the dual-spe | 1e-04 | |
| cd06624 | 268 | cd06624, STKc_ASK, Catalytic domain of the Protein | 2e-04 | |
| cd06613 | 262 | cd06613, STKc_MAP4K3_like, Catalytic domain of Mit | 2e-04 | |
| cd07871 | 288 | cd07871, STKc_PCTAIRE3, Catalytic domain of the Se | 2e-04 | |
| cd06607 | 307 | cd06607, STKc_TAO, Catalytic domain of the Protein | 2e-04 | |
| cd05609 | 305 | cd05609, STKc_MAST, Catalytic domain of the Protei | 2e-04 | |
| cd08220 | 256 | cd08220, STKc_Nek8, Catalytic domain of the Protei | 2e-04 | |
| cd07844 | 291 | cd07844, STKc_PCTAIRE_like, Catalytic domain of PC | 2e-04 | |
| cd06629 | 272 | cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o | 2e-04 | |
| cd07867 | 317 | cd07867, STKc_CDC2L6, Catalytic domain of Serine/T | 2e-04 | |
| PHA03209 | 357 | PHA03209, PHA03209, serine/threonine kinase US3; P | 2e-04 | |
| cd07868 | 317 | cd07868, STKc_CDK8, Catalytic domain of the Serine | 3e-04 | |
| cd05629 | 377 | cd05629, STKc_NDR_like_fungal, Catalytic domain of | 3e-04 | |
| cd07848 | 287 | cd07848, STKc_CDKL5, Catalytic domain of the Serin | 3e-04 | |
| cd06630 | 268 | cd06630, STKc_MEKK1, Catalytic domain of the Prote | 3e-04 | |
| cd07858 | 337 | cd07858, STKc_TEY_MAPK_plant, Catalytic domain of | 3e-04 | |
| cd07851 | 343 | cd07851, STKc_p38, Catalytic domain of the Serine/ | 3e-04 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 3e-04 | |
| PHA02882 | 294 | PHA02882, PHA02882, putative serine/threonine kina | 3e-04 | |
| cd08222 | 260 | cd08222, STKc_Nek11, Catalytic domain of the Prote | 3e-04 | |
| cd06620 | 284 | cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of | 3e-04 | |
| PHA03211 | 461 | PHA03211, PHA03211, serine/threonine kinase US3; P | 4e-04 | |
| cd07859 | 338 | cd07859, STKc_TDY_MAPK_plant, Catalytic domain of | 5e-04 | |
| cd06641 | 277 | cd06641, STKc_MST3, Catalytic domain of the Protei | 5e-04 | |
| PLN03225 | 566 | PLN03225, PLN03225, Serine/threonine-protein kinas | 7e-04 | |
| cd05570 | 318 | cd05570, STKc_PKC, Catalytic domain of the Protein | 7e-04 | |
| PRK01723 | 239 | PRK01723, PRK01723, 3-deoxy-D-manno-octulosonic-ac | 7e-04 | |
| cd05625 | 382 | cd05625, STKc_LATS1, Catalytic domain of the Prote | 8e-04 | |
| cd06642 | 277 | cd06642, STKc_STK25-YSK1, Catalytic domain of the | 9e-04 | |
| cd05613 | 290 | cd05613, STKc_MSK1_N, N-terminal catalytic domain | 0.001 | |
| cd06646 | 267 | cd06646, STKc_MAP4K5, Catalytic domain of the Prot | 0.001 | |
| cd08223 | 257 | cd08223, STKc_Nek4, Catalytic domain of the Protei | 0.001 | |
| cd05632 | 285 | cd05632, STKc_GRK5, Catalytic domain of the Protei | 0.001 | |
| cd07879 | 342 | cd07879, STKc_p38delta_MAPK13, Catalytic domain of | 0.002 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 0.002 | |
| cd07842 | 316 | cd07842, STKc_CDK8_like, Catalytic domain of Cycli | 0.002 | |
| cd07849 | 336 | cd07849, STKc_ERK1_2_like, Catalytic domain of Ext | 0.002 | |
| cd05598 | 376 | cd05598, STKc_LATS, Catalytic domain of the Protei | 0.002 | |
| COG3642 | 204 | COG3642, COG3642, Mn2+-dependent serine/threonine | 0.002 | |
| cd08219 | 255 | cd08219, STKc_Nek3, Catalytic domain of the Protei | 0.002 | |
| cd07877 | 345 | cd07877, STKc_p38alpha_MAPK14, Catalytic domain of | 0.002 | |
| cd08530 | 256 | cd08530, STKc_CNK2-like, Catalytic domain of the P | 0.003 | |
| PLN03224 | 507 | PLN03224, PLN03224, probable serine/threonine prot | 0.003 | |
| cd07880 | 343 | cd07880, STKc_p38gamma_MAPK12, Catalytic domain of | 0.004 | |
| cd05626 | 381 | cd05626, STKc_LATS2, Catalytic domain of the Prote | 0.004 | |
| cd05577 | 277 | cd05577, STKc_GRK, Catalytic domain of the Protein | 0.004 | |
| TIGR03724 | 199 | TIGR03724, arch_bud32, Kae1-associated kinase Bud3 | 0.004 | |
| PLN00034 | 353 | PLN00034, PLN00034, mitogen-activated protein kina | 0.004 |
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
Score = 101 bits (254), Expect = 7e-28
Identities = 39/110 (35%), Positives = 58/110 (52%), Gaps = 4/110 (3%)
Query: 1 MKLCEEGELVDRIVAKGHYTERVAAAVMKTIVEVVQVCHKHGVMHHDLNPKKILFVNKKK 60
M+ CE G+L D + +G +E A ++ I+ ++ H G++H DL P+ IL
Sbjct: 76 MEYCEGGDLFDLLKKRGRLSEDEARFYLRQILSALEYLHSKGIVHRDLKPENILLDED-- 133
Query: 61 SFSLKAIDFGLSVFFRPREQFNELVGSLYYMALEVLKRN-YGPEVDVWSM 109
+K DFGL+ P E+ VG+ YMA EVL YG VD+WS+
Sbjct: 134 -GHVKLADFGLARQLDPGEKLTTFVGTPEYMAPEVLLGKGYGKAVDIWSL 182
|
Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254 |
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|165211 PHA02882, PHA02882, putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173762 cd08222, STKc_Nek11, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|223009 PHA03211, PHA03211, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >gnl|CDD|132972 cd06641, STKc_MST3, Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|215638 PLN03225, PLN03225, Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|234975 PRK01723, PRK01723, 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132973 cd06642, STKc_STK25-YSK1, Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >gnl|CDD|226168 COG3642, COG3642, Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|178763 PLN03224, PLN03224, probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|234331 TIGR03724, arch_bud32, Kae1-associated kinase Bud32 | Back alignment and domain information |
|---|
| >gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 110 | |||
| KOG0595 | 429 | consensus Serine/threonine-protein kinase involved | 100.0 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 100.0 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 100.0 | |
| KOG0598 | 357 | consensus Ribosomal protein S6 kinase and related | 100.0 | |
| KOG0616 | 355 | consensus cAMP-dependent protein kinase catalytic | 100.0 | |
| KOG0583 | 370 | consensus Serine/threonine protein kinase [Signal | 100.0 | |
| KOG0578 | 550 | consensus p21-activated serine/threonine protein k | 99.97 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 99.97 | |
| KOG0592 | 604 | consensus 3-phosphoinositide-dependent protein kin | 99.97 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 99.97 | |
| KOG0588 | 786 | consensus Serine/threonine protein kinase [Cell cy | 99.97 | |
| KOG0604 | 400 | consensus MAP kinase-activated protein kinase 2 [S | 99.97 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 99.97 | |
| KOG0611 | 668 | consensus Predicted serine/threonine protein kinas | 99.96 | |
| KOG0599 | 411 | consensus Phosphorylase kinase gamma subunit [Carb | 99.96 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 99.96 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 99.96 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 99.96 | |
| KOG0033 | 355 | consensus Ca2+/calmodulin-dependent protein kinase | 99.95 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 99.95 | |
| KOG0661 | 538 | consensus MAPK related serine/threonine protein ki | 99.95 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 99.95 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 99.95 | |
| KOG0589 | 426 | consensus Serine/threonine protein kinase [General | 99.95 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 99.95 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 99.95 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 99.95 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 99.95 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 99.95 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 99.95 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 99.95 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 99.95 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 99.95 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 99.95 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 99.95 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 99.95 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 99.95 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 99.95 | |
| KOG4721 | 904 | consensus Serine/threonine protein kinase, contain | 99.95 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 99.95 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 99.95 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 99.95 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 99.95 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 99.95 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 99.95 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 99.95 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 99.94 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 99.94 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 99.94 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 99.94 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 99.94 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 99.94 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 99.94 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 99.94 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 99.94 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 99.94 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 99.94 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 99.94 | |
| KOG0594 | 323 | consensus Protein kinase PCTAIRE and related kinas | 99.94 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 99.94 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 99.94 | |
| KOG0610 | 459 | consensus Putative serine/threonine protein kinase | 99.94 | |
| KOG0593 | 396 | consensus Predicted protein kinase KKIAMRE [Genera | 99.94 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 99.94 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 99.94 | |
| KOG0582 | 516 | consensus Ste20-like serine/threonine protein kina | 99.94 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 99.94 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 99.94 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 99.94 | |
| KOG0586 | 596 | consensus Serine/threonine protein kinase [General | 99.94 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 99.94 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 99.94 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 99.94 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 99.94 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 99.94 | |
| KOG0597 | 808 | consensus Serine-threonine protein kinase FUSED [G | 99.94 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 99.94 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 99.94 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 99.94 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 99.94 | |
| KOG4279 | 1226 | consensus Serine/threonine protein kinase [Signal | 99.94 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 99.93 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 99.93 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 99.93 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 99.93 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 99.93 | |
| KOG0986 | 591 | consensus G protein-coupled receptor kinase [Signa | 99.93 | |
| KOG0585 | 576 | consensus Ca2+/calmodulin-dependent protein kinase | 99.93 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 99.93 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 99.93 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 99.93 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 99.93 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 99.93 | |
| KOG0608 | 1034 | consensus Warts/lats-like serine threonine kinases | 99.93 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 99.93 | |
| KOG0660 | 359 | consensus Mitogen-activated protein kinase [Signal | 99.92 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 99.92 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 99.92 | |
| KOG1989 | 738 | consensus ARK protein kinase family [Signal transd | 99.92 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 99.92 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 99.92 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 99.92 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 99.92 | |
| KOG0695 | 593 | consensus Serine/threonine protein kinase [Signal | 99.92 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 99.92 | |
| KOG0659 | 318 | consensus Cdk activating kinase (CAK)/RNA polymera | 99.92 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 99.92 | |
| KOG4645 | 1509 | consensus MAPKKK (MAP kinase kinase kinase) SSK2 a | 99.92 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 99.92 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 99.91 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 99.91 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 99.91 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 99.91 | |
| KOG0607 | 463 | consensus MAP kinase-interacting kinase and relate | 99.91 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 99.91 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 99.91 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 99.91 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 99.91 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 99.91 | |
| KOG0584 | 632 | consensus Serine/threonine protein kinase [General | 99.91 | |
| KOG0587 | 953 | consensus Traf2- and Nck-interacting kinase and re | 99.91 | |
| KOG4717 | 864 | consensus Serine/threonine protein kinase [Signal | 99.91 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 99.91 | |
| PTZ00284 | 467 | protein kinase; Provisional | 99.91 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 99.91 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 99.91 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 99.91 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 99.91 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 99.9 | |
| KOG0984 | 282 | consensus Mitogen-activated protein kinase (MAPK) | 99.9 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 99.9 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 99.9 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 99.9 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 99.9 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 99.9 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 99.9 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 99.9 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 99.9 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 99.9 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 99.9 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 99.9 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 99.9 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 99.9 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 99.9 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 99.9 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 99.9 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 99.9 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 99.9 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 99.9 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 99.9 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 99.9 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 99.9 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 99.9 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 99.9 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 99.9 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 99.9 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 99.9 | |
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 99.9 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 99.89 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 99.89 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 99.89 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 99.89 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 99.89 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 99.89 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 99.89 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 99.89 | |
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 99.89 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 99.89 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 99.89 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 99.89 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 99.89 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 99.89 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 99.89 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 99.89 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 99.89 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 99.89 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 99.89 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 99.89 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 99.89 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 99.89 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 99.89 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.89 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 99.89 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 99.89 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 99.89 | |
| KOG0983 | 391 | consensus Mitogen-activated protein kinase (MAPK) | 99.89 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 99.89 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 99.89 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 99.89 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 99.89 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 99.88 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 99.88 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 99.88 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 99.88 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 99.88 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 99.88 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 99.88 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 99.88 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 99.88 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 99.88 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 99.88 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 99.88 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 99.88 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 99.88 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 99.88 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 99.88 | |
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 99.88 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 99.88 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 99.88 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 99.88 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 99.88 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 99.88 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 99.88 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 99.88 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 99.88 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 99.88 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 99.88 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 99.88 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 99.88 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 99.88 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 99.88 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 99.88 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 99.88 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 99.88 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 99.88 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 99.88 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 99.88 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 99.88 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 99.88 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 99.88 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 99.88 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 99.87 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 99.87 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 99.87 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 99.87 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 99.87 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 99.87 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 99.87 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 99.87 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 99.87 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 99.87 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 99.87 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 99.87 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 99.87 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 99.87 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 99.87 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 99.87 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 99.87 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 99.87 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 99.87 | |
| KOG1152 | 772 | consensus Signal transduction serine/threonine kin | 99.87 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 99.87 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 99.87 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 99.87 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 99.87 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 99.87 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 99.87 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 99.87 | |
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 99.87 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 99.87 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 99.87 | |
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 99.87 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 99.87 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 99.87 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 99.87 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 99.87 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 99.87 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 99.87 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 99.87 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 99.87 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 99.87 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 99.87 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 99.87 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 99.87 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 99.87 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 99.87 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 99.87 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 99.87 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 99.87 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 99.87 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 99.87 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 99.87 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 99.86 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 99.86 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 99.86 | |
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 99.86 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 99.86 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 99.86 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 99.86 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 99.86 | |
| KOG0596 | 677 | consensus Dual specificity; serine/threonine and t | 99.86 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 99.86 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 99.86 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 99.86 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 99.86 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 99.86 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 99.86 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 99.86 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 99.86 | |
| KOG1151 | 775 | consensus Tousled-like protein kinase [Signal tran | 99.86 | |
| KOG0671 | 415 | consensus LAMMER dual specificity kinases [Signal | 99.86 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 99.86 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 99.86 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 99.86 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 99.86 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 99.86 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 99.86 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 99.86 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 99.85 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 99.85 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 99.85 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 99.85 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 99.85 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 99.85 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 99.85 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 99.85 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 99.85 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 99.85 | |
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 99.85 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 99.85 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 99.85 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 99.85 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 99.85 | |
| KOG0668 | 338 | consensus Casein kinase II, alpha subunit [Signal | 99.85 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 99.85 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 99.85 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 99.85 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 99.85 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 99.85 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 99.85 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 99.85 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 99.85 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 99.85 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 99.84 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 99.84 | |
| KOG0666 | 438 | consensus Cyclin C-dependent kinase CDK8 [Transcri | 99.84 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 99.84 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 99.84 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 99.84 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 99.84 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 99.84 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 99.84 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 99.84 | |
| KOG0664 | 449 | consensus Nemo-like MAPK-related serine/threonine | 99.84 | |
| KOG0665 | 369 | consensus Jun-N-terminal kinase (JNK) [Signal tran | 99.84 | |
| KOG2345 | 302 | consensus Serine/threonine protein kinase/TGF-beta | 99.83 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 99.83 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 99.83 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 99.83 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 99.83 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 99.83 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 99.83 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 99.83 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 99.83 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 99.83 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 99.83 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 99.83 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 99.83 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 99.83 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 99.83 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 99.82 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 99.82 | |
| smart00750 | 176 | KIND kinase non-catalytic C-lobe domain. It is an | 99.82 | |
| KOG0576 | 829 | consensus Mitogen-activated protein kinase kinase | 99.82 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 99.82 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 99.82 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 99.82 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 99.82 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 99.82 | |
| KOG0200 | 609 | consensus Fibroblast/platelet-derived growth facto | 99.82 | |
| KOG0662 | 292 | consensus Cyclin-dependent kinase CDK5 [Intracellu | 99.82 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 99.82 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 99.82 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 99.81 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 99.81 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 99.81 | |
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 99.81 | |
| KOG0669 | 376 | consensus Cyclin T-dependent kinase CDK9 [Cell cyc | 99.81 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 99.81 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 99.81 | |
| KOG0590 | 601 | consensus Checkpoint kinase and related serine/thr | 99.8 | |
| KOG1345 | 378 | consensus Serine/threonine kinase [Signal transduc | 99.8 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 99.79 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 99.79 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.78 | |
| smart00221 | 225 | STYKc Protein kinase; unclassified specificity. Ph | 99.77 | |
| KOG0670 | 752 | consensus U4/U6-associated splicing factor PRP4 [R | 99.77 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 99.77 | |
| KOG1027 | 903 | consensus Serine/threonine protein kinase and endo | 99.76 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 99.76 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 99.76 | |
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 99.74 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 99.68 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 99.67 | |
| cd05147 | 190 | RIO1_euk RIO kinase family; eukaryotic RIO1, catal | 99.67 | |
| COG0515 | 384 | SPS1 Serine/threonine protein kinase [General func | 99.66 | |
| KOG1164 | 322 | consensus Casein kinase (serine/threonine/tyrosine | 99.65 | |
| cd05145 | 190 | RIO1_like RIO kinase family; RIO1, RIO3 and simila | 99.64 | |
| KOG1024 | 563 | consensus Receptor-like protein tyrosine kinase RY | 99.62 | |
| KOG1166 | 974 | consensus Mitotic checkpoint serine/threonine prot | 99.6 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 99.6 | |
| KOG1033 | 516 | consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati | 99.57 | |
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 99.55 | |
| KOG1163 | 341 | consensus Casein kinase (serine/threonine/tyrosine | 99.51 | |
| smart00090 | 237 | RIO RIO-like kinase. | 99.49 | |
| PRK12274 | 218 | serine/threonine protein kinase; Provisional | 99.45 | |
| PRK10345 | 210 | hypothetical protein; Provisional | 99.45 | |
| KOG4158 | 598 | consensus BRPK/PTEN-induced protein kinase [Signal | 99.42 | |
| KOG1165 | 449 | consensus Casein kinase (serine/threonine/tyrosine | 99.41 | |
| KOG0606 | 1205 | consensus Microtubule-associated serine/threonine | 99.38 | |
| PRK14879 | 211 | serine/threonine protein kinase; Provisional | 99.35 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 99.32 | |
| PRK01723 | 239 | 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | 99.32 | |
| TIGR03724 | 199 | arch_bud32 Kae1-associated kinase Bud32. Members o | 99.3 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 99.29 | |
| KOG0590 | 601 | consensus Checkpoint kinase and related serine/thr | 99.19 | |
| KOG1023 | 484 | consensus Natriuretic peptide receptor, guanylate | 99.19 | |
| cd05119 | 187 | RIO RIO kinase family, catalytic domain. The RIO k | 99.18 | |
| PF14531 | 288 | Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ | 99.17 | |
| cd05146 | 197 | RIO3_euk RIO kinase family; eukaryotic RIO3, catal | 99.11 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 99.07 | |
| KOG1290 | 590 | consensus Serine/threonine protein kinase [Signal | 99.03 | |
| PF06293 | 206 | Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; | 98.98 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 98.96 | |
| KOG3087 | 229 | consensus Serine/threonine protein kinase [General | 98.96 | |
| PRK15123 | 268 | lipopolysaccharide core heptose(I) kinase RfaP; Pr | 98.94 | |
| COG3642 | 204 | Mn2+-dependent serine/threonine protein kinase [Si | 98.86 | |
| cd05120 | 155 | APH_ChoK_like Aminoglycoside 3'-phosphotransferase | 98.83 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 98.77 | |
| cd05151 | 170 | ChoK Choline Kinase (ChoK). The ChoK subfamily is | 98.67 | |
| KOG1266 | 458 | consensus Protein kinase [Signal transduction mech | 98.65 | |
| KOG0601 | 524 | consensus Cyclin-dependent kinase WEE1 [Cell cycle | 98.55 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 98.47 | |
| KOG0601 | 524 | consensus Cyclin-dependent kinase WEE1 [Cell cycle | 98.41 | |
| PF01163 | 188 | RIO1: RIO1 family; InterPro: IPR018934 Protein pho | 98.4 | |
| PRK09902 | 216 | hypothetical protein; Provisional | 98.36 | |
| KOG0606 | 1205 | consensus Microtubule-associated serine/threonine | 98.18 | |
| PF06176 | 229 | WaaY: Lipopolysaccharide core biosynthesis protein | 98.14 | |
| KOG2137 | 700 | consensus Protein kinase [Signal transduction mech | 98.0 | |
| KOG1290 | 590 | consensus Serine/threonine protein kinase [Signal | 97.97 | |
| cd05154 | 223 | ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an | 97.79 | |
| COG4248 | 637 | Uncharacterized protein with protein kinase and he | 97.72 | |
| COG0478 | 304 | RIO-like serine/threonine protein kinase fused to | 97.69 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 97.65 | |
| KOG1235 | 538 | consensus Predicted unusual protein kinase [Genera | 97.13 | |
| COG1718 | 268 | RIO1 Serine/threonine protein kinase involved in c | 96.98 | |
| KOG1243 | 690 | consensus Protein kinase [General function predict | 96.98 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 96.88 | |
| KOG3741 | 655 | consensus Poly(A) ribonuclease subunit [RNA proces | 96.87 | |
| COG0661 | 517 | AarF Predicted unusual protein kinase [General fun | 96.75 | |
| KOG0576 | 829 | consensus Mitogen-activated protein kinase kinase | 96.43 | |
| PF10707 | 199 | YrbL-PhoP_reg: PhoP regulatory network protein Yrb | 96.19 | |
| PHA03111 | 444 | Ser/Thr kinase; Provisional | 95.91 | |
| PF12260 | 188 | PIP49_C: Protein-kinase domain of FAM69; InterPro: | 95.88 | |
| PRK05231 | 319 | homoserine kinase; Provisional | 95.26 | |
| COG2334 | 331 | Putative homoserine kinase type II (protein kinase | 94.91 | |
| PF05445 | 434 | Pox_ser-thr_kin: Poxvirus serine/threonine protein | 94.88 | |
| TIGR00938 | 307 | thrB_alt homoserine kinase, Neisseria type. Homose | 94.86 | |
| cd05155 | 235 | APH_ChoK_like_1 Uncharacterized bacterial proteins | 94.82 | |
| KOG1826 | 2724 | consensus Ras GTPase activating protein RasGAP/neu | 94.75 | |
| TIGR02906 | 313 | spore_CotS spore coat protein, CotS family. Member | 94.66 | |
| cd05153 | 296 | HomoserineK_II Homoserine Kinase, type II. Homoser | 94.63 | |
| cd05156 | 302 | ChoK_euk Choline Kinase (ChoK) in eukaryotes. The | 94.21 | |
| COG5072 | 488 | ALK1 Serine/threonine kinase of the haspin family | 94.2 | |
| PRK06149 | 972 | hypothetical protein; Provisional | 94.2 | |
| cd05157 | 235 | ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. | 93.88 | |
| PF13095 | 207 | FTA2: Kinetochore Sim4 complex subunit FTA2 | 93.87 | |
| KOG2268 | 465 | consensus Serine/threonine protein kinase [Signal | 93.58 | |
| cd05150 | 244 | APH Aminoglycoside 3'-phosphotransferase (APH). Th | 93.35 | |
| COG0510 | 269 | ycfN Thiamine kinase and related kinases [Coenzyme | 93.27 | |
| PRK06148 | 1013 | hypothetical protein; Provisional | 93.09 | |
| PF01636 | 239 | APH: Phosphotransferase enzyme family This family | 92.89 | |
| PRK10271 | 188 | thiK thiamine kinase; Provisional | 92.03 | |
| TIGR02904 | 309 | spore_ysxE spore coat protein YsxE. Members of thi | 92.0 | |
| TIGR02721 | 256 | ycfN_thiK thiamine kinase. Members of this family | 91.89 | |
| TIGR02172 | 226 | Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou | 91.88 | |
| smart00587 | 196 | CHK ZnF_C4 abd HLH domain containing kinases domai | 91.09 | |
| cd05152 | 276 | MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH | 91.07 | |
| PLN02236 | 344 | choline kinase | 91.02 | |
| PF01633 | 211 | Choline_kinase: Choline/ethanolamine kinase; Inter | 90.14 | |
| COG3173 | 321 | Predicted aminoglycoside phosphotransferase [Gener | 90.05 | |
| PLN02421 | 330 | phosphotransferase, alcohol group as acceptor/kina | 89.95 | |
| COG2112 | 201 | Predicted Ser/Thr protein kinase [Signal transduct | 89.82 | |
| PF02958 | 294 | EcKinase: Ecdysteroid kinase; InterPro: IPR004119 | 89.79 | |
| PF07387 | 308 | Seadorna_VP7: Seadornavirus VP7; InterPro: IPR0099 | 89.39 | |
| PRK11768 | 325 | serine/threonine protein kinase; Provisional | 88.79 | |
| KOG2270 | 520 | consensus Serine/threonine protein kinase involved | 87.17 | |
| PRK09550 | 401 | mtnK methylthioribose kinase; Reviewed | 85.92 | |
| PLN02876 | 822 | acyl-CoA dehydrogenase | 84.09 |
| >KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.7e-38 Score=195.30 Aligned_cols=110 Identities=34% Similarity=0.642 Sum_probs=102.1
Q ss_pred CCCcCCCChHHHHHhCCCCCHHHHHHHHHHHHHHHHHHHHcCCeeCCCCCCceEEeeCCCC---ceEEEeecccccccCC
Q 033833 1 MKLCEEGELVDRIVAKGHYTERVAAAVMKTIVEVVQVCHKHGVMHHDLNPKKILFVNKKKS---FSLKAIDFGLSVFFRP 77 (110)
Q Consensus 1 ~e~~~~g~l~~~~~~~~~~~~~~~~~~~~~l~~~l~~lh~~~i~h~~l~~~~il~~~~~~~---~~~~l~d~g~~~~~~~ 77 (110)
||||.||||.+++.+.+.++|..++.++.|++.|+++||+++|||||+||+||++...... ..+|++|||+++.+.+
T Consensus 88 MEyC~gGDLs~yi~~~~~l~e~t~r~Fm~QLA~alq~L~~~~IiHRDLKPQNiLLs~~~~~~~~~~LKIADFGfAR~L~~ 167 (429)
T KOG0595|consen 88 MEYCNGGDLSDYIRRRGRLPEATARHFMQQLASALQFLHENNIIHRDLKPQNILLSTTARNDTSPVLKIADFGFARFLQP 167 (429)
T ss_pred EEeCCCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCeeeccCCcceEEeccCCCCCCCceEEecccchhhhCCc
Confidence 8999999999999999999999999999999999999999999999999999999765322 6799999999999987
Q ss_pred cccccccccCcccccccccc-ccCCCccceeecC
Q 033833 78 REQFNELVGSLYYMALEVLK-RNYGPEVDVWSML 110 (110)
Q Consensus 78 ~~~~~~~~~~~~~~~pe~~~-~~~~~~~D~wslg 110 (110)
.....+.||+|.|||||++. .+|+.|+|+||+|
T Consensus 168 ~~~a~tlcGSplYMAPEV~~~~~YdAKADLWSiG 201 (429)
T KOG0595|consen 168 GSMAETLCGSPLYMAPEVIMSQQYDAKADLWSIG 201 (429)
T ss_pred hhHHHHhhCCccccCHHHHHhccccchhhHHHHH
Confidence 77778899999999999996 6799999999987
|
|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0589 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0586 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >KOG0584 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >smart00750 KIND kinase non-catalytic C-lobe domain | Back alignment and domain information |
|---|
| >KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00221 STYKc Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain | Back alignment and domain information |
|---|
| >COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain | Back alignment and domain information |
|---|
| >KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >PRK12274 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK10345 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PRK14879 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03724 arch_bud32 Kae1-associated kinase Bud32 | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05119 RIO RIO kinase family, catalytic domain | Back alignment and domain information |
|---|
| >PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A | Back alignment and domain information |
|---|
| >cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3087 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional | Back alignment and domain information |
|---|
| >COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >cd05151 ChoK Choline Kinase (ChoK) | Back alignment and domain information |
|---|
| >KOG1266 consensus Protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >PRK09902 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) | Back alignment and domain information |
|---|
| >KOG2137 consensus Protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins | Back alignment and domain information |
|---|
| >COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >KOG1235 consensus Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1243 consensus Protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >COG0661 AarF Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP | Back alignment and domain information |
|---|
| >PHA03111 Ser/Thr kinase; Provisional | Back alignment and domain information |
|---|
| >PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) | Back alignment and domain information |
|---|
| >PRK05231 homoserine kinase; Provisional | Back alignment and domain information |
|---|
| >COG2334 Putative homoserine kinase type II (protein kinase fold) [General function prediction only] | Back alignment and domain information |
|---|
| >PF05445 Pox_ser-thr_kin: Poxvirus serine/threonine protein kinase; InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly | Back alignment and domain information |
|---|
| >TIGR00938 thrB_alt homoserine kinase, Neisseria type | Back alignment and domain information |
|---|
| >cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members | Back alignment and domain information |
|---|
| >KOG1826 consensus Ras GTPase activating protein RasGAP/neurofibromin [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02906 spore_CotS spore coat protein, CotS family | Back alignment and domain information |
|---|
| >cd05153 HomoserineK_II Homoserine Kinase, type II | Back alignment and domain information |
|---|
| >cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes | Back alignment and domain information |
|---|
| >COG5072 ALK1 Serine/threonine kinase of the haspin family [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK06149 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes | Back alignment and domain information |
|---|
| >PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 | Back alignment and domain information |
|---|
| >KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) | Back alignment and domain information |
|---|
| >COG0510 ycfN Thiamine kinase and related kinases [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily | Back alignment and domain information |
|---|
| >PRK10271 thiK thiamine kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02904 spore_ysxE spore coat protein YsxE | Back alignment and domain information |
|---|
| >TIGR02721 ycfN_thiK thiamine kinase | Back alignment and domain information |
|---|
| >TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 | Back alignment and domain information |
|---|
| >smart00587 CHK ZnF_C4 abd HLH domain containing kinases domain | Back alignment and domain information |
|---|
| >cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') | Back alignment and domain information |
|---|
| >PLN02236 choline kinase | Back alignment and domain information |
|---|
| >PF01633 Choline_kinase: Choline/ethanolamine kinase; InterPro: IPR002573 Choline kinase, (ATP:choline phosphotransferase, 2 | Back alignment and domain information |
|---|
| >COG3173 Predicted aminoglycoside phosphotransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02421 phosphotransferase, alcohol group as acceptor/kinase | Back alignment and domain information |
|---|
| >COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF02958 EcKinase: Ecdysteroid kinase; InterPro: IPR004119 This family includes proteins of unknown function | Back alignment and domain information |
|---|
| >PF07387 Seadorna_VP7: Seadornavirus VP7; InterPro: IPR009973 This family consists of several Seadornavirus specific VP7 proteins of around 305 residues in length | Back alignment and domain information |
|---|
| >PRK11768 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK09550 mtnK methylthioribose kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN02876 acyl-CoA dehydrogenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 110 | ||||
| 3f3z_A | 277 | Crystal Structure Of Cryptosporidium Parvum Calcium | 2e-21 | ||
| 2qg5_A | 294 | Cryptosporidium Parvum Calcium Dependent Protein Ki | 2e-21 | ||
| 2w4o_A | 349 | Crystal Structure Of Human Camk4 In Complex With 4- | 3e-19 | ||
| 2wei_A | 287 | Crystal Structure Of The Kinase Domain Of Cryptospo | 5e-19 | ||
| 3dfa_A | 286 | Crystal Structure Of Kinase Domain Of Calcium-depen | 5e-19 | ||
| 3igo_A | 486 | Crystal Structure Of Cryptosporidium Parvum Cdpk1, | 9e-19 | ||
| 3q5i_A | 504 | Crystal Structure Of Pbanka_031420 Length = 504 | 1e-18 | ||
| 3lij_A | 494 | Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) | 1e-18 | ||
| 3hzt_A | 467 | Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 | 6e-18 | ||
| 3dxn_A | 287 | Crystal Structure Of The Calcium-dependent Kinase F | 7e-18 | ||
| 3i79_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 4e-17 | ||
| 3ma6_A | 298 | Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr | 7e-17 | ||
| 3hx4_A | 508 | Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg | 7e-17 | ||
| 3ku2_A | 507 | Crystal Structure Of Inactivated Form Of Cdpk1 From | 7e-17 | ||
| 3i7c_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 1e-16 | ||
| 3is5_A | 285 | Crystal Structure Of Cdpk Kinase Domain From Toxopl | 2e-15 | ||
| 3kk9_A | 282 | Camkii Substrate Complex B Length = 282 | 2e-15 | ||
| 3kk8_A | 284 | Camkii Substrate Complex A Length = 284 | 2e-15 | ||
| 3kl8_A | 269 | Camkiintide Inhibitor Complex Length = 269 | 2e-15 | ||
| 2bdw_A | 362 | Crystal Structure Of The Auto-Inhibited Kinase Doma | 2e-15 | ||
| 4fg7_A | 293 | Crystal Structure Of Human Calcium/calmodulin-depen | 3e-15 | ||
| 4fg9_A | 320 | Crystal Structure Of Human Calcium/calmodulin-depen | 3e-15 | ||
| 4fg8_A | 315 | Crystal Structure Of Human Calcium/calmodulin-depen | 3e-15 | ||
| 2jc6_A | 334 | Crystal Structure Of Human Calmodulin-Dependent Pro | 4e-15 | ||
| 2wel_A | 327 | Crystal Structure Of Su6656-Bound CalciumCALMODULIN | 4e-15 | ||
| 2vn9_A | 301 | Crystal Structure Of Human Calcium Calmodulin Depen | 5e-15 | ||
| 1a06_A | 332 | Calmodulin-Dependent Protein Kinase From Rat Length | 6e-15 | ||
| 3bhh_A | 295 | Crystal Structure Of Human Calcium/calmodulin-depen | 8e-15 | ||
| 2vz6_A | 313 | Structure Of Human Calcium Calmodulin Dependent Pro | 8e-15 | ||
| 3kn5_A | 325 | Crystal Structure Of The C-Terminal Kinase Domain O | 9e-15 | ||
| 3soa_A | 444 | Full-Length Human Camkii Length = 444 | 5e-14 | ||
| 2jam_A | 304 | Crystal Structure Of Human Calmodulin-Dependent Pro | 6e-14 | ||
| 2v7o_A | 336 | Crystal Structure Of Human Calcium-Calmodulin-Depen | 8e-14 | ||
| 2y7j_A | 365 | Structure Of Human Phosphorylase Kinase, Gamma 2 Le | 3e-13 | ||
| 2wzj_A | 327 | Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 | 3e-13 | ||
| 3ka0_A | 320 | Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4 | 5e-13 | ||
| 2phk_A | 277 | The Crystal Structure Of A Phosphorylase Kinase Pep | 7e-13 | ||
| 1phk_A | 298 | Two Structures Of The Catalytic Domain Of Phosphory | 9e-13 | ||
| 2hak_A | 328 | Catalytic And Ubiqutin-Associated Domains Of Mark1P | 1e-12 | ||
| 1zmv_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 1e-12 | ||
| 2r0i_A | 327 | Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len | 1e-12 | ||
| 3mfr_A | 351 | Cask-4m Cam Kinase Domain, Native Length = 351 | 1e-12 | ||
| 1zmu_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 1e-12 | ||
| 3r1n_A | 317 | Mk3 Kinase Bound To Compound 5b Length = 317 | 2e-12 | ||
| 2pzy_A | 324 | Structure Of Mk2 Complexed With Compound 76 Length | 2e-12 | ||
| 2qr8_A | 342 | 2.0a X-ray Structure Of C-terminal Kinase Domain Of | 2e-12 | ||
| 3fpm_A | 325 | Crystal Structure Of A Squarate Inhibitor Bound To | 2e-12 | ||
| 3r2b_A | 318 | Mk2 Kinase Bound To Compound 5b Length = 318 | 2e-12 | ||
| 2jbo_A | 326 | Protein Kinase Mk2 In Complex With An Inhibitor (Cr | 2e-12 | ||
| 3r2y_A | 319 | Mk2 Kinase Bound To Compound 1 Length = 319 | 2e-12 | ||
| 3iec_A | 319 | Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K | 2e-12 | ||
| 2p3g_X | 327 | Crystal Structure Of A Pyrrolopyridine Inhibitor Bo | 2e-12 | ||
| 2qnj_A | 328 | Kinase And Ubiquitin-Associated Domains Of Mark3PAR | 3e-12 | ||
| 3fhr_A | 336 | High Resolution Crystal Structure Of Mitogen-Activa | 3e-12 | ||
| 2qr7_A | 342 | 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of | 3e-12 | ||
| 1zmw_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 3e-12 | ||
| 1ql6_A | 298 | The Catalytic Mechanism Of Phosphorylase Kinase Pro | 3e-12 | ||
| 2yza_A | 276 | Crystal Structure Of Kinase Domain Of Human 5'-Amp- | 6e-12 | ||
| 3fe3_A | 328 | Crystal Structure Of The Kinase Mark3PAR-1: T211a-S | 6e-12 | ||
| 3h4j_B | 336 | Crystal Structure Of Pombe Ampk Kdaid Fragment Leng | 7e-12 | ||
| 1y8g_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 8e-12 | ||
| 3zgw_A | 347 | Crystal Structure Of Maternal Embryonic Leucine Zip | 9e-12 | ||
| 2y94_A | 476 | Structure Of An Active Form Of Mammalian Ampk Lengt | 1e-11 | ||
| 3gok_A | 334 | Binding Site Mapping Of Protein Ligands Length = 33 | 1e-11 | ||
| 2h6d_A | 276 | Protein Kinase Domain Of The Human 5'-Amp-Activated | 1e-11 | ||
| 3dae_A | 283 | Crystal Structure Of Phosphorylated Snf1 Kinase Dom | 1e-11 | ||
| 3hyh_A | 275 | Crystal Structure Of The Protein Kinase Domain Of Y | 1e-11 | ||
| 1kwp_A | 400 | Crystal Structure Of Mapkap2 Length = 400 | 1e-11 | ||
| 3mn3_A | 271 | An Inhibited Conformation For The Protein Kinase Do | 2e-11 | ||
| 2fh9_A | 274 | Structure And Dimerization Of The Kinase Domain Fro | 2e-11 | ||
| 2onl_C | 406 | Crystal Structure Of The P38a-Mapkap Kinase 2 Heter | 2e-11 | ||
| 2oza_A | 356 | Structure Of P38alpha Complex Length = 356 | 2e-11 | ||
| 3rny_A | 346 | Crystal Structure Of Human Rsk1 C-Terminal Kinase D | 2e-11 | ||
| 2wnt_A | 330 | Crystal Structure Of The Human Ribosomal Protein S6 | 3e-11 | ||
| 2q0n_A | 301 | Structure Of Human P21 Activating Kinase 4 (Pak4) I | 3e-11 | ||
| 2cdz_A | 303 | Crystal Structure Of The Human P21-Activated Kinase | 3e-11 | ||
| 2x4z_A | 296 | Crystal Structure Of The Human P21-Activated Kinase | 3e-11 | ||
| 4fif_A | 346 | Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid | 3e-11 | ||
| 3tac_A | 361 | Crystal Structure Of The Liprin-AlphaCASK COMPLEX L | 3e-11 | ||
| 2bva_A | 292 | Crystal Structure Of The Human P21-Activated Kinase | 3e-11 | ||
| 3c0g_A | 351 | Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len | 3e-11 | ||
| 4fie_A | 423 | Full-Length Human Pak4 Length = 423 | 3e-11 | ||
| 2x4f_A | 373 | The Crystal Structure Of The Human Myosin Light Cha | 1e-10 | ||
| 1nxk_A | 400 | Crystal Structure Of Staurosporine Bound To Map Kap | 2e-10 | ||
| 1yhv_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Two Po | 3e-10 | ||
| 3i6w_A | 443 | Structure And Activation Mechanism Of The Chk2 Dna- | 3e-10 | ||
| 2w0j_A | 323 | Crystal Structure Of Chk2 In Complex With Nsc 10955 | 3e-10 | ||
| 2ycf_A | 322 | Crystal Structure Of Checkpoint Kinase 2 In Complex | 3e-10 | ||
| 2xk9_A | 322 | Structural Analysis Of Checkpoint Kinase 2 (Chk2) I | 3e-10 | ||
| 2ycr_A | 323 | Crystal Structure Of Checkpoint Kinase 2 In Complex | 3e-10 | ||
| 2cn5_A | 329 | Crystal Structure Of Human Chk2 In Complex With Adp | 3e-10 | ||
| 3i6u_A | 419 | Structure And Activation Mechanism Of The Chk2 Dna- | 3e-10 | ||
| 3hko_A | 345 | Crystal Structure Of A Cdpk Kinase Domain From Cryp | 7e-10 | ||
| 2r0u_A | 323 | Crystal Structure Of Chek1 In Complex With Inhibito | 8e-10 | ||
| 2hog_A | 322 | Crystal Structure Of Chek1 In Complex With Inhibito | 9e-10 | ||
| 2br1_A | 297 | Structure-Based Design Of Novel Chk1 Inhibitors: In | 9e-10 | ||
| 1ia8_A | 289 | The 1.7 A Crystal Structure Of Human Cell Cycle Che | 9e-10 | ||
| 4fsn_A | 278 | Crystal Structure Of The Chk1 Length = 278 | 9e-10 | ||
| 1zlt_A | 295 | Crystal Structure Of Chk1 Complexed With A Hymenald | 9e-10 | ||
| 4fsy_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 1e-09 | ||
| 2x8e_A | 276 | Discovery Of A Novel Class Of Triazolones As Checkp | 1e-09 | ||
| 2e9v_A | 268 | Structure Of H-Chk1 Complexed With A859017 Length = | 1e-09 | ||
| 2ydj_A | 276 | Discovery Of Checkpoint Kinase Inhibitor Azd7762 By | 1e-09 | ||
| 4fsu_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 1e-09 | ||
| 4fsm_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 1e-09 | ||
| 2ghg_A | 269 | H-Chk1 Complexed With A431994 Length = 269 | 1e-09 | ||
| 3jvr_A | 271 | Characterization Of The Chk1 Allosteric Inhibitor B | 1e-09 | ||
| 2ayp_A | 269 | Crystal Structure Of Chk1 With An Indol Inhibitor L | 1e-09 | ||
| 1zys_A | 273 | Co-Crystal Structure Of Checkpoint Kinase Chk1 With | 1e-09 | ||
| 3ot3_A | 273 | X-Ray Crystal Structure Of Compound 22k Bound To Hu | 1e-09 | ||
| 4fsw_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 1e-09 | ||
| 4ft3_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 1e-09 | ||
| 4fsz_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 1e-09 | ||
| 4fst_A | 269 | Crystal Structure Of The Chk1 Length = 269 | 1e-09 | ||
| 1yrp_A | 278 | Catalytic Domain Of Human Zip Kinase Phosphorylated | 1e-09 | ||
| 1f3m_C | 297 | Crystal Structure Of Human SerineTHREONINE KINASE P | 1e-09 | ||
| 3q52_A | 306 | Structure Of Phosphorylated Pak1 Kinase Domain Leng | 1e-09 | ||
| 3fxz_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Ruthen | 2e-09 | ||
| 2j90_A | 304 | Crystal Structure Of Human Zip Kinase In Complex Wi | 2e-09 | ||
| 3bhy_A | 283 | Crystal Structure Of Human Death Associated Protein | 2e-09 | ||
| 4a4x_A | 279 | Nek2-Ede Bound To Cct248662 Length = 279 | 2e-09 | ||
| 1zws_A | 288 | Crystal Structure Of The Catalytic Domain Of Human | 2e-09 | ||
| 2a2a_A | 321 | High-resolution Crystallographic Analysis Of The Au | 2e-09 | ||
| 1wmk_A | 321 | Human Death-Associated Kinase Drp-1, Mutant S308d D | 3e-09 | ||
| 2a27_A | 321 | Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal | 3e-09 | ||
| 1z9x_A | 321 | Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal | 3e-09 | ||
| 3kga_A | 299 | Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexe | 3e-09 | ||
| 3ofm_A | 350 | Structure Of A Human Ck2alpha Prime, The Paralog Is | 3e-09 | ||
| 2f57_A | 317 | Crystal Structure Of The Human P21-activated Kinase | 4e-09 | ||
| 3e3b_X | 339 | Crystal Structure Of Catalytic Subunit Of Human Pro | 4e-09 | ||
| 3q4z_A | 306 | Structure Of Unphosphorylated Pak1 Kinase Domain Le | 6e-09 | ||
| 2ya9_A | 361 | Crystal Structure Of The Autoinhibited Form Of Mous | 8e-09 | ||
| 4agu_A | 311 | Crystal Structure Of The Human Cdkl1 Kinase Domain | 8e-09 | ||
| 3juh_A | 335 | Crystal Structure Of A Mutant Of Human Protein Kina | 1e-08 | ||
| 3u87_A | 349 | Structure Of A Chimeric Construct Of Human Ck2alpha | 1e-08 | ||
| 2zjw_A | 340 | Crystal Structure Of Human Ck2 Alpha Complexed With | 1e-08 | ||
| 1pjk_A | 334 | Crystal Structure Of A C-terminal Deletion Mutant O | 1e-08 | ||
| 4dgl_C | 335 | Crystal Structure Of The Ck2 Tetrameric Holoenzyme | 1e-08 | ||
| 3q9w_A | 336 | Crystal Structure Of Human Ck2 Alpha In Complex Wit | 1e-08 | ||
| 1jwh_A | 337 | Crystal Structure Of Human Protein Kinase Ck2 Holoe | 1e-08 | ||
| 3bqc_A | 335 | High Ph-Value Crystal Structure Of Emodin In Comple | 1e-08 | ||
| 3nga_A | 333 | Human Ck2 Catalytic Domain In Complex With Cx-4945 | 1e-08 | ||
| 3mb6_A | 331 | Human Ck2 Catalytic Domain In Complex With A Difura | 1e-08 | ||
| 3h30_A | 334 | Crystal Structure Of The Catalytic Subunit Of Human | 1e-08 | ||
| 2r7i_A | 335 | Crystal Structure Of Catalytic Subunit Of Protein K | 1e-08 | ||
| 3nsz_A | 330 | Human Ck2 Catalytic Domain In Complex With Amppn Le | 2e-08 | ||
| 2c30_A | 321 | Crystal Structure Of The Human P21-Activated Kinase | 2e-08 | ||
| 3q04_A | 328 | Crystal Structure Of The Apo-Form Of Human Ck2 Alph | 2e-08 | ||
| 1na7_A | 329 | Crystal Structure Of The Catalytic Subunit Of Human | 2e-08 | ||
| 3cok_A | 278 | Crystal Structure Of Plk4 Kinase Length = 278 | 2e-08 | ||
| 1p4f_A | 293 | Death Associated Protein Kinase Catalytic Domain Wi | 3e-08 | ||
| 1ig1_A | 294 | 1.8a X-Ray Structure Of Ternary Complex Of A Cataly | 3e-08 | ||
| 3dfc_B | 295 | Crystal Structure Of A Glycine-Rich Loop Mutant Of | 3e-08 | ||
| 2yak_A | 285 | Structure Of Death-Associated Protein Kinase 1 (Dap | 3e-08 | ||
| 3gu4_A | 295 | Crystal Structure Of Dapkq23v-Amppnp Length = 295 | 3e-08 | ||
| 3f5u_A | 295 | Crystal Structure Of The Death Associated Protein K | 3e-08 | ||
| 2w4k_A | 302 | X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | 3e-08 | ||
| 2w4j_A | 277 | X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | 3e-08 | ||
| 1wvw_A | 278 | Crystal Structures Of Kinase Domain Of Dap Kinase I | 3e-08 | ||
| 2xzs_A | 312 | Death Associated Protein Kinase 1 Residues 1-312 Le | 3e-08 | ||
| 2y0a_A | 326 | Structure Of Dapk1 Construct Residues 1-304 Length | 3e-08 | ||
| 4anm_A | 335 | Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 | 3e-08 | ||
| 2qc6_A | 332 | Protein Kinase Ck2 In Complex With Dbc Length = 332 | 3e-08 | ||
| 3pvg_A | 331 | Crystal Structure Of Z. Mays Ck2 Alpha Subunit In C | 3e-08 | ||
| 2jav_A | 279 | Human Kinase With Pyrrole-Indolinone Ligand Length | 3e-08 | ||
| 2pvh_A | 352 | Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]tri | 3e-08 | ||
| 1ds5_A | 332 | Dimeric Crystal Structure Of The Alpha Subunit In C | 3e-08 | ||
| 2w5a_A | 279 | Human Nek2 Kinase Adp-Bound Length = 279 | 3e-08 | ||
| 1m2p_A | 325 | Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- Anthra | 4e-08 | ||
| 2vrx_A | 285 | Structure Of Aurora B Kinase In Complex With Zm4474 | 4e-08 | ||
| 2bfy_A | 284 | Complex Of Aurora-B With Incenp And Hesperidin. Len | 4e-08 | ||
| 1daw_A | 327 | Crystal Structure Of A Binary Complex Of Protein Ki | 4e-08 | ||
| 4dgm_A | 326 | Crystal Structure Of Maize Ck2 In Complex With The | 4e-08 | ||
| 4dgn_A | 326 | Crystal Structure Of Maize Ck2 In Complex With The | 4e-08 | ||
| 1kob_A | 387 | Twitchin Kinase Fragment (Aplysia), Autoregulated P | 4e-08 | ||
| 3kxg_A | 327 | Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subun | 4e-08 | ||
| 2bfx_B | 284 | Mechanism Of Aurora-B Activation By Incenp And Inhi | 4e-08 | ||
| 3gu8_A | 295 | Crystal Structure Of Dapkl93g With N6-Cyclopentylad | 5e-08 | ||
| 2xuu_A | 334 | Crystal Structure Of A Dap-Kinase 1 Mutant Length = | 5e-08 | ||
| 2x0g_A | 334 | X-ray Structure Of A Dap-kinase Calmodulin Complex | 6e-08 | ||
| 3gbz_A | 329 | Structure Of The Cmgc Cdk Kinase From Giardia Lambl | 8e-08 | ||
| 3uc4_A | 362 | The Crystal Structure Of Snf1-Related Kinase 2.6 Le | 1e-07 | ||
| 3ujg_A | 361 | Crystal Structure Of Snrk2.6 In Complex With Hab1 L | 2e-07 | ||
| 2pk9_A | 317 | Structure Of The Pho85-pho80 Cdk-cyclin Complex Of | 2e-07 | ||
| 3nup_A | 307 | Cdk6 (Monomeric) In Complex With Inhibitor Length = | 2e-07 | ||
| 1bi8_A | 326 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 2e-07 | ||
| 1jow_B | 308 | Crystal Structure Of A Complex Of Human Cdk6 And A | 2e-07 | ||
| 2vwi_A | 303 | Structure Of The Osr1 Kinase, A Hypertension Drug T | 2e-07 | ||
| 3uto_A | 573 | Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- | 2e-07 | ||
| 3dak_A | 290 | Crystal Structure Of Domain-Swapped Osr1 Kinase Dom | 3e-07 | ||
| 3niz_A | 311 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 5e-07 | ||
| 3uc3_A | 361 | The Crystal Structure Of Snf1-Related Kinase 2.3 Le | 5e-07 | ||
| 2qkr_A | 313 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 5e-07 | ||
| 4aaa_A | 331 | Crystal Structure Of The Human Cdkl2 Kinase Domain | 7e-07 | ||
| 2hw6_A | 307 | Crystal Structure Of Mnk1 Catalytic Domain Length = | 7e-07 | ||
| 1koa_A | 491 | Twitchin Kinase Fragment (C.Elegans), Autoregulated | 7e-07 | ||
| 2xru_A | 280 | Aurora-A T288e Complexed With Pha-828300 Length = 2 | 7e-07 | ||
| 1v0o_A | 288 | Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho | 8e-07 | ||
| 3uiu_A | 306 | Crystal Structure Of Apo-Pkr Kinase Domain Length = | 8e-07 | ||
| 3zuu_A | 362 | The Structure Of Ost1 (D160a, S175d) Kinase In Comp | 8e-07 | ||
| 1gz8_A | 299 | Human Cyclin Dependent Kinase 2 Complexed With The | 8e-07 | ||
| 1v0b_A | 288 | Crystal Structure Of The T198a Mutant Of Pfpk5 Leng | 8e-07 | ||
| 4erw_A | 306 | Cdk2 In Complex With Staurosporine Length = 306 | 9e-07 | ||
| 2wtw_A | 285 | Aurora-A Inhibitor Structure (2nd Crystal Form) Len | 9e-07 | ||
| 2bmc_A | 306 | Aurora-2 T287d T288d Complexed With Pha-680632 Leng | 9e-07 | ||
| 1ob3_A | 288 | Structure Of P. Falciparum Pfpk5 Length = 288 | 1e-06 | ||
| 1oit_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 1e-06 | ||
| 3udb_A | 317 | Crystal Structure Of Snrk2.6 Length = 317 | 1e-06 | ||
| 3r21_A | 271 | Design, Synthesis, And Biological Evaluation Of Pyr | 1e-06 | ||
| 1gii_A | 298 | Human Cyclin Dependent Kinase 2 Complexed With The | 1e-06 | ||
| 2wtv_A | 285 | Aurora-A Inhibitor Structure Length = 285 | 1e-06 | ||
| 3ezr_A | 300 | Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ | 1e-06 | ||
| 3zut_A | 362 | The Structure Of Ost1 (D160a) Kinase Length = 362 | 1e-06 | ||
| 1oir_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 1e-06 | ||
| 1h01_A | 298 | Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili | 1e-06 | ||
| 2w17_A | 299 | Cdk2 In Complex With The Imidazole Pyrimidine Amide | 1e-06 | ||
| 1fin_A | 298 | Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = | 1e-06 | ||
| 3pj8_A | 299 | Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] | 1e-06 | ||
| 1pf8_A | 298 | Crystal Structure Of Human Cyclin-dependent Kinase | 1e-06 | ||
| 3pxf_A | 306 | Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N | 1e-06 | ||
| 3fdn_A | 279 | Structure-Based Drug Design Of Novel Aurora Kinase | 1e-06 | ||
| 2c6d_A | 275 | Aurora A Kinase Activated Mutant (T287d) In Complex | 2e-06 | ||
| 2c6e_A | 283 | Aurora A Kinase Activated Mutant (T287d) In Complex | 2e-06 | ||
| 1vyw_A | 309 | Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = | 2e-06 | ||
| 3lau_A | 287 | Crystal Structure Of Aurora2 Kinase In Complex With | 2e-06 | ||
| 3daj_A | 272 | Crystal Structure Of Aurora A Complexed With An Inh | 2e-06 | ||
| 3dls_A | 335 | Crystal Structure Of Human Pas Kinase Bound To Adp | 2e-06 | ||
| 1tki_A | 321 | Autoinhibited Serine Kinase Domain Of The Giant Mus | 2e-06 | ||
| 1yhs_A | 273 | Crystal Structure Of Pim-1 Bound To Staurosporine L | 2e-06 | ||
| 3unz_A | 279 | Aurora A In Complex With Rpm1679 Length = 279 | 2e-06 | ||
| 4eok_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 2e-06 | ||
| 2jgz_A | 289 | Crystal Structure Of Phospho-Cdk2 In Complex With C | 2e-06 | ||
| 4eoj_A | 302 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 2e-06 | ||
| 3bht_A | 300 | Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN | 2e-06 | ||
| 2iw6_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com | 2e-06 | ||
| 4eoq_A | 301 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 2e-06 | ||
| 4bcq_A | 301 | Structure Of Cdk2 In Complex With Cyclin A And A 2- | 2e-06 | ||
| 4i3z_A | 296 | Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES | 2e-06 | ||
| 1ogu_A | 302 | Structure Of Human Thr160-phospho Cdk2/cyclin A Com | 2e-06 | ||
| 1qmz_A | 299 | Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com | 2e-06 | ||
| 4eos_A | 300 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 2e-06 | ||
| 1jst_A | 298 | Phosphorylated Cyclin-Dependent Kinase-2 Bound To C | 2e-06 | ||
| 1w98_A | 298 | The Structural Basis Of Cdk2 Activation By Cyclin E | 2e-06 | ||
| 3qhr_A | 298 | Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic | 2e-06 | ||
| 1e9h_A | 297 | Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex | 2e-06 | ||
| 1h1p_A | 303 | Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP | 2e-06 | ||
| 2iw8_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 | 2e-06 | ||
| 2x7f_A | 326 | Crystal Structure Of The Kinase Domain Of Human Tra | 2e-06 | ||
| 4an2_A | 301 | Crystal Structures Of Human Mek1 With Carboxamide-B | 3e-06 | ||
| 4eon_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 3e-06 | ||
| 3d14_A | 272 | Crystal Structure Of Mouse Aurora A (Asn186->gly, L | 3e-06 | ||
| 4eom_A | 301 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 3e-06 | ||
| 4azf_A | 417 | Human Dyrk2 In Complex With Leucettine L41 Length = | 3e-06 | ||
| 4eoi_A | 299 | Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc | 3e-06 | ||
| 3a99_A | 320 | Structure Of Pim-1 Kinase Crystallized In The Prese | 3e-06 | ||
| 3ma3_A | 313 | Crystal Structure Of Human Proto-Oncogene Serine Th | 3e-06 | ||
| 3jpv_A | 313 | Crystal Structure Of Human Proto-Oncogene Serine Th | 3e-06 | ||
| 2dwb_A | 285 | Aurora-A Kinase Complexed With Amppnp Length = 285 | 3e-06 | ||
| 2j2i_B | 312 | Crystal Structure Of The Humab Pim1 In Complex With | 3e-06 | ||
| 4eop_A | 300 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 3e-06 | ||
| 3lm0_A | 327 | Crystal Structure Of Human SerineTHREONINE KINASE 1 | 3e-06 | ||
| 4eoo_A | 299 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 3e-06 | ||
| 4alv_A | 328 | Benzofuropyrimidinone Inhibitors Of Pim-1 Length = | 3e-06 | ||
| 4as0_A | 273 | Cyclometalated Phthalimides As Protein Kinase Inhib | 3e-06 | ||
| 2xj0_A | 301 | Protein Kinase Pim-1 In Complex With Fragment-4 Fro | 3e-06 | ||
| 3cxw_A | 314 | Crystal Structure Of Human Proto-Oncogene Serine Th | 3e-06 | ||
| 1xws_A | 313 | Crystal Structure Of The Human Pim1 Kinase Domain L | 3e-06 | ||
| 2bil_B | 313 | The Human Protein Kinase Pim1 In Complex With Its C | 3e-06 | ||
| 1xqz_A | 300 | Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolut | 3e-06 | ||
| 3cy3_A | 314 | Crystal Structure Of Human Proto-Oncogene Serine Th | 3e-06 | ||
| 4a7c_A | 308 | Crystal Structure Of Pim1 Kinase With Etp46546 Leng | 3e-06 | ||
| 3jxw_A | 294 | Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4- | 3e-06 | ||
| 2ac5_A | 316 | Structure Of Human Mnk2 Kinase Domain Mutant D228g | 3e-06 | ||
| 2bik_B | 313 | Human Pim1 Phosphorylated On Ser261 Length = 313 | 3e-06 | ||
| 3uix_A | 298 | Crystal Structure Of Pim1 Kinase In Complex With Sm | 3e-06 | ||
| 2xiy_A | 301 | Protein Kinase Pim-1 In Complex With Fragment-2 Fro | 3e-06 | ||
| 3dcv_A | 328 | Crystal Structure Of Human Pim1 Kinase Complexed Wi | 3e-06 | ||
| 1ywv_A | 293 | Crystal Structures Of Proto-Oncogene Kinase Pim1: A | 3e-06 | ||
| 3r00_A | 299 | The Discovery Of Novel Benzofuran-2-Carboxylic Acid | 3e-06 | ||
| 3kvw_A | 429 | Crystal Structure Of Dual-Specificity Tyrosine Phos | 3e-06 | ||
| 3f2a_A | 300 | Crystal Structure Of Human Pim-1 In Complex With Da | 3e-06 | ||
| 2x6d_A | 285 | Aurora-A Bound To An Inhibitor Length = 285 | 3e-06 | ||
| 3k2l_A | 429 | Crystal Structure Of Dual-Specificity Tyrosine Phos | 3e-06 | ||
| 2xix_A | 301 | Protein Kinase Pim-1 In Complex With Fragment-1 Fro | 3e-06 | ||
| 3c4e_A | 273 | Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7 | 3e-06 | ||
| 1muo_A | 297 | Crystal Structure Of Aurora-2, An Oncogenic Serine- | 3e-06 | ||
| 4dtk_A | 276 | Novel And Selective Pan-Pim Kinase Inhibitor Length | 3e-06 | ||
| 2xng_A | 283 | Structure Of Aurora-A Bound To A Selective Imidazop | 3e-06 | ||
| 4alu_A | 328 | Benzofuropyrimidinone Inhibitors Of Pim-1 Length = | 3e-06 | ||
| 1yxs_A | 293 | Crystal Structure Of Kinase Pim1 With P123m Mutatio | 3e-06 | ||
| 2j4z_A | 306 | Structure Of Aurora-2 In Complex With Pha-680626 Le | 3e-06 | ||
| 2j50_A | 280 | Structure Of Aurora-2 In Complex With Pha-739358 Le | 3e-06 | ||
| 3o50_A | 267 | Crystal Structure Of Benzamide 9 Bound To Auroraa L | 3e-06 | ||
| 2w1d_A | 275 | Structure Determination Of Aurora Kinase In Complex | 3e-06 | ||
| 1mq4_A | 272 | Crystal Structure Of Aurora-A Protein Kinase Length | 4e-06 | ||
| 2wqe_A | 262 | Structure Of S155r Aurora-A Somatic Mutant Length = | 4e-06 | ||
| 3e5a_A | 268 | Crystal Structure Of Aurora A In Complex With Vx-68 | 4e-06 | ||
| 1ol5_A | 282 | Structure Of Aurora-A 122-403, Phosphorylated On Th | 5e-06 | ||
| 3nrm_A | 283 | Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito | 5e-06 | ||
| 3coh_A | 268 | Crystal Structure Of Aurora-A In Complex With A Pen | 5e-06 | ||
| 3ha6_A | 268 | Crystal Structure Of Aurora A In Complex With Tpx2 | 6e-06 | ||
| 3h0y_A | 268 | Aurora A In Complex With A Bisanilinopyrimidine Len | 6e-06 | ||
| 2w1c_A | 275 | Structure Determination Of Aurora Kinase In Complex | 6e-06 | ||
| 4a07_A | 311 | Human Pdk1 Kinase Domain In Complex With Allosteric | 6e-06 | ||
| 2r7b_A | 312 | Crystal Structure Of The Phosphoinositide-Dependent | 6e-06 | ||
| 3nax_A | 311 | Pdk1 In Complex With Inhibitor Mp7 Length = 311 | 7e-06 | ||
| 2obj_A | 333 | Crystal Structure Of Human Pim-1 Kinase In Complex | 7e-06 | ||
| 3d5v_A | 317 | Crystal Structure Of An Activated (Thr->asp) Polo-L | 7e-06 | ||
| 3db6_A | 301 | Crystal Structure Of An Activated (Thr->asp) Polo-L | 7e-06 | ||
| 3rwp_A | 311 | Discovery Of A Novel, Potent And Selective Inhibito | 8e-06 | ||
| 3hrc_A | 311 | Crystal Structure Of A Mutant Of Human Pdk1 Kinase | 8e-06 | ||
| 3sc1_A | 311 | Novel Isoquinolone Pdk1 Inhibitors Discovered Throu | 8e-06 | ||
| 2xck_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 8e-06 | ||
| 3qc4_A | 314 | Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = | 8e-06 | ||
| 2biy_A | 310 | Structure Of Pdk1-S241a Mutant Kinase Domain Length | 8e-06 | ||
| 3h9o_A | 311 | Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) | 8e-06 | ||
| 1uu3_A | 310 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 8e-06 | ||
| 3nun_A | 292 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea | 8e-06 | ||
| 2xch_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 8e-06 | ||
| 3iop_A | 312 | Pdk-1 In Complex With The Inhibitor Compound-8i Len | 8e-06 | ||
| 3orx_A | 316 | Pdk1 Mutant Bound To Allosteric Disulfide Fragment | 9e-06 | ||
| 1ua2_A | 346 | Crystal Structure Of Human Cdk7 Length = 346 | 9e-06 | ||
| 3nay_A | 311 | Pdk1 In Complex With Inhibitor Mp6 Length = 311 | 9e-06 | ||
| 1z5m_A | 286 | Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr | 9e-06 | ||
| 3rzf_A | 677 | Crystal Structure Of Inhibitor Of Kappab Kinase Bet | 9e-06 | ||
| 3qa8_A | 676 | Crystal Structure Of Inhibitor Of Kappa B Kinase Be | 9e-06 | ||
| 3h9f_A | 313 | Crystal Structure Of Human Dual Specificity Protein | 9e-06 | ||
| 1h1w_A | 289 | High Resolution Crystal Structure Of The Human Pdk1 | 9e-06 | ||
| 3nus_A | 286 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra | 9e-06 | ||
| 3cek_A | 313 | Crystal Structure Of Human Dual Specificity Protein | 9e-06 | ||
| 2x9e_A | 317 | Human Mps1 In Complex With Nms-P715 Length = 317 | 1e-05 | ||
| 3vqu_A | 320 | Crystal Structure Of Human Mps1 Catalytic Domain In | 1e-05 | ||
| 1uu9_A | 286 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 1e-05 | ||
| 2w96_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 1e-05 | ||
| 1ol6_A | 282 | Structure Of Unphosphorylated D274n Mutant Of Auror | 1e-05 | ||
| 3qbn_A | 281 | Structure Of Human Aurora A In Complex With A Diami | 1e-05 | ||
| 2xne_A | 272 | Structure Of Aurora-A Bound To An Imidazopyrazine I | 1e-05 | ||
| 3hmn_A | 342 | Crystal Structure Of Human Mps1 Catalytic Domain In | 1e-05 | ||
| 3d5u_A | 317 | Crystal Structure Of A Wildtype Polo-Like Kinase 1 | 1e-05 | ||
| 3g33_A | 308 | Crystal Structure Of Cdk4CYCLIN D3 Length = 308 | 1e-05 | ||
| 3d5w_A | 317 | Crystal Structure Of A Phosphorylated Polo-Like Kin | 1e-05 | ||
| 2iwi_A | 312 | Crystal Structure Of The Human Pim2 In Complex With | 2e-05 | ||
| 2zmc_A | 390 | Crystal Structure Of Human Mitotic Checkpoint Kinas | 2e-05 | ||
| 2zmd_A | 390 | Crystal Structure Of Human Mps1 Catalytic Domain T6 | 2e-05 | ||
| 2ac3_A | 316 | Structure Of Human Mnk2 Kinase Domain Length = 316 | 2e-05 | ||
| 3dbq_A | 343 | Crystal Structure Of Ttk Kinase Domain Length = 343 | 2e-05 | ||
| 2yac_A | 311 | Crystal Structure Of Polo-Like Kinase 1 In Complex | 2e-05 | ||
| 3kb7_A | 311 | Crystal Structure Of Polo-Like Kinase 1 In Complex | 2e-05 | ||
| 2v5q_A | 315 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 3e-05 | ||
| 2w99_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 3e-05 | ||
| 2p55_A | 333 | X-Ray Structure Of The Human Mitogen-Activated Prot | 3e-05 | ||
| 2y4i_C | 395 | Ksr2-Mek1 Heterodimer Length = 395 | 3e-05 | ||
| 2j51_A | 325 | Crystal Structure Of Human Ste20-Like Kinase Bound | 3e-05 | ||
| 3eqc_A | 360 | X-Ray Structure Of The Human Mitogen-Activated Prot | 3e-05 | ||
| 4ec8_A | 373 | Structure Of Full Length Cdk9 In Complex With Cycli | 3e-05 | ||
| 3mbl_A | 328 | Crystal Structure Of The Human Mitogen-Activated Pr | 3e-05 | ||
| 3dv3_A | 322 | Mek1 With Pf-04622664 Bound Length = 322 | 3e-05 | ||
| 4bcf_A | 331 | Structure Of Cdk9 In Complex With Cyclin T And A 2- | 3e-05 | ||
| 1s9j_A | 341 | X-Ray Structure Of The Human Mitogen-Activated Prot | 3e-05 | ||
| 3sls_A | 304 | Crystal Structure Of Human Mek-1 Kinase In Complex | 3e-05 | ||
| 3orn_A | 307 | Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In | 3e-05 | ||
| 3blh_A | 331 | Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 | 3e-05 | ||
| 3pwy_A | 311 | Crystal Structure Of An Extender (Spd28345)-Modifie | 3e-05 | ||
| 3mi9_A | 351 | Crystal Structure Of Hiv-1 Tat Complexed With Human | 3e-05 | ||
| 3nr9_A | 368 | Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length | 4e-05 | ||
| 2jfm_A | 325 | Crystal Structure Of Human Ste20-Like Kinase (Unlig | 4e-05 | ||
| 2rku_A | 294 | Structure Of Plk1 In Complex With Bi2536 Length = 2 | 4e-05 | ||
| 2w9f_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 5e-05 | ||
| 2jfl_A | 325 | Crystal Structure Of Human Ste20-Like Kinase ( Diph | 5e-05 | ||
| 3thb_A | 333 | Structure Of Plk1 Kinase Domain In Complex With A B | 5e-05 | ||
| 2dyl_A | 318 | Crystal Structure Of Human Mitogen-Activated Protei | 5e-05 | ||
| 1h4l_A | 292 | Structure And Regulation Of The Cdk5-P25(Nck5a) Com | 5e-05 | ||
| 2ou7_A | 335 | Structure Of The Catalytic Domain Of Human Polo-Lik | 5e-05 | ||
| 3npc_A | 364 | Crystal Structure Of Jnk2 Complexed With Birb796 Le | 6e-05 | ||
| 3eb0_A | 383 | Crystal Structure Of Cgd4_240 From Cryptosporidium | 6e-05 | ||
| 3e7o_A | 360 | Crystal Structure Of Jnk2 Length = 360 | 7e-05 | ||
| 1s9i_A | 354 | X-Ray Structure Of The Human Mitogen-Activated Prot | 8e-05 | ||
| 3mtl_A | 324 | Crystal Structure Of The Pctaire1 Kinase In Complex | 9e-05 | ||
| 1zy4_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 1e-04 | ||
| 2uv2_A | 287 | Crystal Structure Of Human Ste20-Like Kinase Bound | 1e-04 | ||
| 3ttj_A | 464 | Crystal Structure Of Jnk3 Complexed With Cc-359, A | 1e-04 | ||
| 3fi2_A | 353 | Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib | 1e-04 | ||
| 2clq_A | 295 | Structure Of Mitogen-Activated Protein Kinase Kinas | 1e-04 | ||
| 4g31_A | 299 | Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 | 1e-04 | ||
| 2xrw_A | 371 | Linear Binding Motifs For Jnk And For Calcineurin A | 1e-04 | ||
| 1ukh_A | 369 | Structural Basis For The Selective Inhibition Of Jn | 1e-04 | ||
| 3fv8_A | 355 | Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le | 1e-04 | ||
| 3vud_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M1 | 1e-04 | ||
| 3vw6_A | 269 | Crystal Structure Of Human Apoptosis Signal-Regulat | 1e-04 | ||
| 3kvx_A | 364 | Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le | 1e-04 | ||
| 2r9s_A | 356 | C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu | 1e-04 | ||
| 3ptg_A | 363 | Design And Synthesis Of A Novel, Orally Efficacious | 1e-04 | ||
| 1jnk_A | 423 | The C-Jun N-Terminal Kinase (Jnk3s) Complexed With | 1e-04 | ||
| 4h36_A | 356 | Crystal Structure Of Jnk3 In Complex With Atf2 Pept | 1e-04 | ||
| 1pmn_A | 364 | Crystal Structure Of Jnk3 In Complex With An Imidaz | 1e-04 | ||
| 3vuk_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M5 | 2e-04 | ||
| 4af3_A | 292 | Human Aurora B Kinase In Complex With Incenp And Vx | 2e-04 | ||
| 3oxi_A | 362 | Design And Synthesis Of Disubstituted Thiophene And | 2e-04 | ||
| 2ok1_A | 365 | Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 | 2e-04 | ||
| 2exc_X | 356 | Inhibitor Complex Of Jnk3 Length = 356 | 2e-04 | ||
| 2b1p_A | 355 | Inhibitor Complex Of Jnk3 Length = 355 | 2e-04 | ||
| 3vui_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M2 | 2e-04 | ||
| 3fi3_A | 364 | Crystal Structure Of Jnk3 With Indazole Inhibitor, | 2e-04 | ||
| 3vuh_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M3 | 2e-04 | ||
| 2o0u_A | 364 | Crystal Structure Of Human Jnk3 Complexed With N-{3 | 2e-04 | ||
| 3vug_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M2 | 2e-04 | ||
| 3vul_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M1 | 2e-04 | ||
| 3vum_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M7 | 2e-04 | ||
| 1ung_A | 292 | Structural Mechanism For The Inhibition Of Cdk5-P25 | 2e-04 | ||
| 1u5q_A | 348 | Crystal Structure Of The Tao2 Kinase Domain: Activa | 2e-04 | ||
| 3v3v_A | 379 | Structural And Functional Analysis Of Quercetagetin | 2e-04 | ||
| 3elj_A | 369 | Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine | 2e-04 | ||
| 3pze_A | 358 | Jnk1 In Complex With Inhibitor Length = 358 | 2e-04 | ||
| 3qd2_B | 332 | Crsytal Structure Of Mouse Perk Kinase Domain Lengt | 2e-04 | ||
| 2gcd_A | 309 | Tao2 Kinase Domain-Staurosporine Structure Length = | 2e-04 | ||
| 2xs0_A | 386 | Linear Binding Motifs For Jnk And For Calcineurin A | 3e-04 | ||
| 3o17_A | 370 | Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 | 3e-04 | ||
| 2zoq_A | 382 | Structural Dissection Of Human Mitogen-Activated Ki | 3e-04 | ||
| 3zhp_C | 294 | Human Mst3 (stk24) In Complex With Mo25beta Length | 4e-04 | ||
| 3ckw_A | 304 | Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 | 4e-04 | ||
| 3a7f_A | 303 | Human Mst3 Kinase Length = 303 | 4e-04 | ||
| 3ckx_A | 304 | Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3 | 4e-04 | ||
| 3qyw_A | 364 | Crystal Structure Of Erk2 In Complex With An Inhibi | 5e-04 | ||
| 2g01_A | 370 | Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit | 5e-04 | ||
| 4gsb_A | 364 | Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 | 5e-04 | ||
| 4fux_A | 360 | Crystal Structure Of The Erk2 Complexed With E75 Le | 5e-04 | ||
| 4fv7_A | 360 | Crystal Structure Of The Erk2 Complexed With E94 Le | 5e-04 | ||
| 3sa0_A | 360 | Complex Of Erk2 With Norathyriol Length = 360 | 5e-04 | ||
| 1pme_A | 380 | Structure Of Penta Mutant Human Erk2 Map Kinase Com | 5e-04 | ||
| 4h3q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 6e-04 | ||
| 3zu7_A | 365 | Crystal Structure Of A Designed Selected Ankyrin Re | 6e-04 | ||
| 2z7l_A | 366 | Unphosphorylated Mitogen Activated Protein Kinase E | 6e-04 | ||
| 3c9w_A | 357 | Crystal Structure Of Erk-2 With Hypothemycin Covale | 6e-04 | ||
| 2gph_A | 364 | Docking Motif Interactions In The Map Kinase Erk2 L | 6e-04 | ||
| 2fys_B | 364 | Crystal Structure Of Erk2 Complex With Kim Peptide | 6e-04 | ||
| 1wzy_A | 368 | Crystal Structure Of Human Erk2 Complexed With A Py | 6e-04 | ||
| 1tvo_A | 368 | The Structure Of Erk2 In Complex With A Small Molec | 6e-04 | ||
| 1gol_A | 364 | Coordinates Of Rat Map Kinase Erk2 With An Arginine | 6e-04 | ||
| 3tei_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 6e-04 | ||
| 2y9q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 6e-04 | ||
| 3o71_A | 358 | Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length | 6e-04 | ||
| 2xik_A | 294 | Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related K | 6e-04 | ||
| 4e7w_A | 394 | Structure Of Gsk3 From Ustilago Maydis Length = 394 | 6e-04 | ||
| 3rgf_A | 405 | Crystal Structure Of Human Cdk8CYCC Length = 405 | 6e-04 | ||
| 2ojg_A | 380 | Crystal Structure Of Erk2 In Complex With N,n-dimet | 6e-04 | ||
| 2wu6_A | 381 | Crystal Structure Of The Human Clk3 In Complex With | 7e-04 | ||
| 3r63_A | 358 | Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | 7e-04 | ||
| 2exe_A | 357 | Crystal Structure Of The Phosphorylated Clk3 Length | 7e-04 | ||
| 4fv6_A | 360 | Crystal Structure Of The Erk2 Complexed With E57 Le | 7e-04 | ||
| 2eu9_A | 355 | Crystal Structure Of Clk3 Length = 355 | 7e-04 | ||
| 3zuv_A | 364 | Crystal Structure Of A Designed Selected Ankyrin Re | 8e-04 | ||
| 2erk_A | 365 | Phosphorylated Map Kinase Erk2 Length = 365 | 8e-04 | ||
| 2nry_A | 307 | Crystal Structure Of Irak-4 Length = 307 | 9e-04 |
| >pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 | Back alignment and structure |
|
| >pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 | Back alignment and structure |
| >pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 | Back alignment and structure |
| >pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 | Back alignment and structure |
| >pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 | Back alignment and structure |
| >pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 | Back alignment and structure |
| >pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 | Back alignment and structure |
| >pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 | Back alignment and structure |
| >pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 | Back alignment and structure |
| >pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 | Back alignment and structure |
| >pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 | Back alignment and structure |
| >pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 | Back alignment and structure |
| >pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 | Back alignment and structure |
| >pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 | Back alignment and structure |
| >pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 | Back alignment and structure |
| >pdb|3KK9|A Chain A, Camkii Substrate Complex B Length = 282 | Back alignment and structure |
| >pdb|3KK8|A Chain A, Camkii Substrate Complex A Length = 284 | Back alignment and structure |
| >pdb|3KL8|A Chain A, Camkiintide Inhibitor Complex Length = 269 | Back alignment and structure |
| >pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 | Back alignment and structure |
| >pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 | Back alignment and structure |
| >pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 | Back alignment and structure |
| >pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 | Back alignment and structure |
| >pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 | Back alignment and structure |
| >pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 | Back alignment and structure |
| >pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 | Back alignment and structure |
| >pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 | Back alignment and structure |
| >pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 | Back alignment and structure |
| >pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 | Back alignment and structure |
| >pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 | Back alignment and structure |
| >pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 | Back alignment and structure |
| >pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 | Back alignment and structure |
| >pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 | Back alignment and structure |
| >pdb|2Y7J|A Chain A, Structure Of Human Phosphorylase Kinase, Gamma 2 Length = 365 | Back alignment and structure |
| >pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 | Back alignment and structure |
| >pdb|3KA0|A Chain A, Mk2 Complex With Inhibitor 6-(5-(2-Aminopyrimidin-4-Ylamino)-2- Hydroxyphenyl)-N-Methylbenzo[b]thiophene-2-Carboxamide Length = 320 | Back alignment and structure |
| >pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 | Back alignment and structure |
| >pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 | Back alignment and structure |
| >pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 | Back alignment and structure |
| >pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 | Back alignment and structure |
| >pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 | Back alignment and structure |
| >pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 | Back alignment and structure |
| >pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 | Back alignment and structure |
| >pdb|3R1N|A Chain A, Mk3 Kinase Bound To Compound 5b Length = 317 | Back alignment and structure |
| >pdb|2PZY|A Chain A, Structure Of Mk2 Complexed With Compound 76 Length = 324 | Back alignment and structure |
| >pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 | Back alignment and structure |
| >pdb|3FPM|A Chain A, Crystal Structure Of A Squarate Inhibitor Bound To Mapkap Kinase-2 Length = 325 | Back alignment and structure |
| >pdb|3R2B|A Chain A, Mk2 Kinase Bound To Compound 5b Length = 318 | Back alignment and structure |
| >pdb|2JBO|A Chain A, Protein Kinase Mk2 In Complex With An Inhibitor (Crystal Form-1, Soaking) Length = 326 | Back alignment and structure |
| >pdb|3R2Y|A Chain A, Mk2 Kinase Bound To Compound 1 Length = 319 | Back alignment and structure |
| >pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 | Back alignment and structure |
| >pdb|2P3G|X Chain X, Crystal Structure Of A Pyrrolopyridine Inhibitor Bound To Mapkap Kinase-2 Length = 327 | Back alignment and structure |
| >pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 | Back alignment and structure |
| >pdb|3FHR|A Chain A, High Resolution Crystal Structure Of Mitogen-Activated Protein Kinase-Activated Protein Kinase 3 (Mk3)-Inhibitor Complex Length = 336 | Back alignment and structure |
| >pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 | Back alignment and structure |
| >pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 | Back alignment and structure |
| >pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 | Back alignment and structure |
| >pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 | Back alignment and structure |
| >pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 | Back alignment and structure |
| >pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 | Back alignment and structure |
| >pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 | Back alignment and structure |
| >pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 | Back alignment and structure |
| >pdb|3GOK|A Chain A, Binding Site Mapping Of Protein Ligands Length = 334 | Back alignment and structure |
| >pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 | Back alignment and structure |
| >pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 | Back alignment and structure |
| >pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 | Back alignment and structure |
| >pdb|1KWP|A Chain A, Crystal Structure Of Mapkap2 Length = 400 | Back alignment and structure |
| >pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 | Back alignment and structure |
| >pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 | Back alignment and structure |
| >pdb|2ONL|C Chain C, Crystal Structure Of The P38a-Mapkap Kinase 2 Heterodimer Length = 406 | Back alignment and structure |
| >pdb|2OZA|A Chain A, Structure Of P38alpha Complex Length = 356 | Back alignment and structure |
| >pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 | Back alignment and structure |
| >pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 | Back alignment and structure |
| >pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 | Back alignment and structure |
| >pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 | Back alignment and structure |
| >pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 | Back alignment and structure |
| >pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 | Back alignment and structure |
| >pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 | Back alignment and structure |
| >pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 | Back alignment and structure |
| >pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 | Back alignment and structure |
| >pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 | Back alignment and structure |
| >pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 | Back alignment and structure |
| >pdb|1NXK|A Chain A, Crystal Structure Of Staurosporine Bound To Map Kap Kinase 2 Length = 400 | Back alignment and structure |
| >pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 | Back alignment and structure |
| >pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 | Back alignment and structure |
| >pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 | Back alignment and structure |
| >pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 | Back alignment and structure |
| >pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 | Back alignment and structure |
| >pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 | Back alignment and structure |
| >pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 | Back alignment and structure |
| >pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 | Back alignment and structure |
| >pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 | Back alignment and structure |
| >pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 | Back alignment and structure |
| >pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 | Back alignment and structure |
| >pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 | Back alignment and structure |
| >pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 | Back alignment and structure |
| >pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 | Back alignment and structure |
| >pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 | Back alignment and structure |
| >pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 | Back alignment and structure |
| >pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 | Back alignment and structure |
| >pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 | Back alignment and structure |
| >pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 | Back alignment and structure |
| >pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 | Back alignment and structure |
| >pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 | Back alignment and structure |
| >pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 | Back alignment and structure |
| >pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 | Back alignment and structure |
| >pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 | Back alignment and structure |
| >pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 | Back alignment and structure |
| >pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 | Back alignment and structure |
| >pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 | Back alignment and structure |
| >pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 | Back alignment and structure |
| >pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 | Back alignment and structure |
| >pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 | Back alignment and structure |
| >pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 | Back alignment and structure |
| >pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 | Back alignment and structure |
| >pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 | Back alignment and structure |
| >pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 | Back alignment and structure |
| >pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 | Back alignment and structure |
| >pdb|3KGA|A Chain A, Crystal Structure Of Mapkap Kinase 2 (Mk2) Complexed With A Potent 3-Aminopyrazole Atp Site Inhibitor Length = 299 | Back alignment and structure |
| >pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 | Back alignment and structure |
| >pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 | Back alignment and structure |
| >pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 | Back alignment and structure |
| >pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 | Back alignment and structure |
| >pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 | Back alignment and structure |
| >pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 | Back alignment and structure |
| >pdb|3U87|A Chain A, Structure Of A Chimeric Construct Of Human Ck2alpha And Human Ck2alpha' In Complex With A Non-hydrolysable Atp-analogue Length = 349 | Back alignment and structure |
| >pdb|2ZJW|A Chain A, Crystal Structure Of Human Ck2 Alpha Complexed With Ellagic Acid Length = 340 | Back alignment and structure |
| >pdb|1PJK|A Chain A, Crystal Structure Of A C-terminal Deletion Mutant Of Human Protein Kinase Ck2 Catalytic Subunit Length = 334 | Back alignment and structure |
| >pdb|4DGL|C Chain C, Crystal Structure Of The Ck2 Tetrameric Holoenzyme Length = 335 | Back alignment and structure |
| >pdb|3Q9W|A Chain A, Crystal Structure Of Human Ck2 Alpha In Complex With Emodin At Ph 8.5 Length = 336 | Back alignment and structure |
| >pdb|1JWH|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme Length = 337 | Back alignment and structure |
| >pdb|3BQC|A Chain A, High Ph-Value Crystal Structure Of Emodin In Complex With The Catalytic Subunit Of Protein Kinase Ck2 Length = 335 | Back alignment and structure |
| >pdb|3NGA|A Chain A, Human Ck2 Catalytic Domain In Complex With Cx-4945 Length = 333 | Back alignment and structure |
| >pdb|3MB6|A Chain A, Human Ck2 Catalytic Domain In Complex With A Difurane Derivative Inhibitor (Cpa) Length = 331 | Back alignment and structure |
| >pdb|3H30|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 With 5,6-Dichloro-1-Beta-D- Ribofuranosylbenzimidazole Length = 334 | Back alignment and structure |
| >pdb|2R7I|A Chain A, Crystal Structure Of Catalytic Subunit Of Protein Kinase Ck2 Length = 335 | Back alignment and structure |
| >pdb|3NSZ|A Chain A, Human Ck2 Catalytic Domain In Complex With Amppn Length = 330 | Back alignment and structure |
| >pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 | Back alignment and structure |
| >pdb|3Q04|A Chain A, Crystal Structure Of The Apo-Form Of Human Ck2 Alpha At Ph 8.5 Length = 328 | Back alignment and structure |
| >pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 | Back alignment and structure |
| >pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 | Back alignment and structure |
| >pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 | Back alignment and structure |
| >pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 | Back alignment and structure |
| >pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 | Back alignment and structure |
| >pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 | Back alignment and structure |
| >pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 | Back alignment and structure |
| >pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 | Back alignment and structure |
| >pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | Back alignment and structure |
| >pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | Back alignment and structure |
| >pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 | Back alignment and structure |
| >pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 | Back alignment and structure |
| >pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 | Back alignment and structure |
| >pdb|4ANM|A Chain A, Complex Of Ck2 With A Cdc7 Inhibitor Length = 335 | Back alignment and structure |
| >pdb|2QC6|A Chain A, Protein Kinase Ck2 In Complex With Dbc Length = 332 | Back alignment and structure |
| >pdb|3PVG|A Chain A, Crystal Structure Of Z. Mays Ck2 Alpha Subunit In Complex With The Inhibitor 4,5,6,7-Tetrabromo-1-Carboxymethylbenzimidazole (K68) Length = 331 | Back alignment and structure |
| >pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 | Back alignment and structure |
| >pdb|2PVH|A Chain A, Structure-Based Design Of Pyrazolo[1,5-A][1,3,5]triazine Derivatives As Potent Inhibitors Of Protein Kinase Ck2 Length = 352 | Back alignment and structure |
| >pdb|1DS5|A Chain A, Dimeric Crystal Structure Of The Alpha Subunit In Complex With Two Beta Peptides Mimicking The Architecture Of The Tetrameric Protein Kinase Ck2 Holoenzyme. Length = 332 | Back alignment and structure |
| >pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 | Back alignment and structure |
| >pdb|1M2P|A Chain A, Crystal Structure Of 1,8-Di-Hydroxy-4-Nitro- AnthraquinoneCK2 KINASE COMPLEX Length = 325 | Back alignment and structure |
| >pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 | Back alignment and structure |
| >pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 | Back alignment and structure |
| >pdb|1DAW|A Chain A, Crystal Structure Of A Binary Complex Of Protein Kinase Ck2 (Alpha-Subunit) And Mg-Amppnp Length = 327 | Back alignment and structure |
| >pdb|4DGM|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Apigenin Length = 326 | Back alignment and structure |
| >pdb|4DGN|A Chain A, Crystal Structure Of Maize Ck2 In Complex With The Inhibitor Luteolin Length = 326 | Back alignment and structure |
| >pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 | Back alignment and structure |
| >pdb|3KXG|A Chain A, Crystal Structure Of Z. Mays Ck2 Kinase Alpha Subunit In Complex With The Inhibitor 3,4,5,6,7-Pentabromo-1h-Indazole (K64) Length = 327 | Back alignment and structure |
| >pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 | Back alignment and structure |
| >pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 | Back alignment and structure |
| >pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 | Back alignment and structure |
| >pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 | Back alignment and structure |
| >pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 | Back alignment and structure |
| >pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 | Back alignment and structure |
| >pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 | Back alignment and structure |
| >pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 | Back alignment and structure |
| >pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 | Back alignment and structure |
| >pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 | Back alignment and structure |
| >pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 | Back alignment and structure |
| >pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 | Back alignment and structure |
| >pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 | Back alignment and structure |
| >pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 | Back alignment and structure |
| >pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 | Back alignment and structure |
| >pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 | Back alignment and structure |
| >pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 | Back alignment and structure |
| >pdb|2HW6|A Chain A, Crystal Structure Of Mnk1 Catalytic Domain Length = 307 | Back alignment and structure |
| >pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 | Back alignment and structure |
| >pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 | Back alignment and structure |
| >pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 | Back alignment and structure |
| >pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 | Back alignment and structure |
| >pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 | Back alignment and structure |
| >pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 | Back alignment and structure |
| >pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 | Back alignment and structure |
| >pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 | Back alignment and structure |
| >pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 | Back alignment and structure |
| >pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 | Back alignment and structure |
| >pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 | Back alignment and structure |
| >pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 | Back alignment and structure |
| >pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 | Back alignment and structure |
| >pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 | Back alignment and structure |
| >pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 | Back alignment and structure |
| >pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 | Back alignment and structure |
| >pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 | Back alignment and structure |
| >pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 | Back alignment and structure |
| >pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 | Back alignment and structure |
| >pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 | Back alignment and structure |
| >pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 | Back alignment and structure |
| >pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 | Back alignment and structure |
| >pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 | Back alignment and structure |
| >pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 | Back alignment and structure |
| >pdb|3DLS|A Chain A, Crystal Structure Of Human Pas Kinase Bound To Adp Length = 335 | Back alignment and structure |
| >pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 | Back alignment and structure |
| >pdb|1YHS|A Chain A, Crystal Structure Of Pim-1 Bound To Staurosporine Length = 273 | Back alignment and structure |
| >pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 | Back alignment and structure |
| >pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 | Back alignment and structure |
| >pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 | Back alignment and structure |
| >pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 | Back alignment and structure |
| >pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 | Back alignment and structure |
| >pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 | Back alignment and structure |
| >pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 | Back alignment and structure |
| >pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 | Back alignment and structure |
| >pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 | Back alignment and structure |
| >pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 | Back alignment and structure |
| >pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 | Back alignment and structure |
| >pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 | Back alignment and structure |
| >pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|2X7F|A Chain A, Crystal Structure Of The Kinase Domain Of Human Traf2- And Nck-Interacting Kinase With Wee1chk1 Inhibitor Length = 326 | Back alignment and structure |
| >pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 | Back alignment and structure |
| >pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 | Back alignment and structure |
| >pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 | Back alignment and structure |
| >pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 | Back alignment and structure |
| >pdb|3A99|A Chain A, Structure Of Pim-1 Kinase Crystallized In The Presence Of P27kip1 Carboxy-Terminal Peptide Length = 320 | Back alignment and structure |
| >pdb|3MA3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Naphtho-Difuran Ligand Length = 313 | Back alignment and structure |
| >pdb|3JPV|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Pyrrolo[2,3- A]carbazole Ligand Length = 313 | Back alignment and structure |
| >pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 | Back alignment and structure |
| >pdb|2J2I|B Chain B, Crystal Structure Of The Humab Pim1 In Complex With Ly333531 Length = 312 | Back alignment and structure |
| >pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|3LM0|A Chain A, Crystal Structure Of Human SerineTHREONINE KINASE 17B (STK17B) Length = 327 | Back alignment and structure |
| >pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 | Back alignment and structure |
| >pdb|4ALV|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 | Back alignment and structure |
| >pdb|4AS0|A Chain A, Cyclometalated Phthalimides As Protein Kinase Inhibitors Length = 273 | Back alignment and structure |
| >pdb|2XJ0|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-4 From Crystallographic Fragment Screen Length = 301 | Back alignment and structure |
| >pdb|3CXW|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And A Beta Carboline Ligand I Length = 314 | Back alignment and structure |
| >pdb|1XWS|A Chain A, Crystal Structure Of The Human Pim1 Kinase Domain Length = 313 | Back alignment and structure |
| >pdb|2BIL|B Chain B, The Human Protein Kinase Pim1 In Complex With Its Consensus Peptide Pimtide Length = 313 | Back alignment and structure |
| >pdb|1XQZ|A Chain A, Crystal Structure Of Hpim-1 Kinase At 2.1 A Resolution Length = 300 | Back alignment and structure |
| >pdb|3CY3|A Chain A, Crystal Structure Of Human Proto-Oncogene Serine Threonine Kinase (Pim1) In Complex With A Consensus Peptide And The Jnk Inhibitor V Length = 314 | Back alignment and structure |
| >pdb|4A7C|A Chain A, Crystal Structure Of Pim1 Kinase With Etp46546 Length = 308 | Back alignment and structure |
| >pdb|3JXW|A Chain A, Discovery Of 3h-Benzo[4,5]thieno[3,2-D]pyrimidin-4-Ones As Potent, Highly Selective And Orally Bioavailable Pim Kinases Inhibitors Length = 294 | Back alignment and structure |
| >pdb|2AC5|A Chain A, Structure Of Human Mnk2 Kinase Domain Mutant D228g Length = 316 | Back alignment and structure |
| >pdb|2BIK|B Chain B, Human Pim1 Phosphorylated On Ser261 Length = 313 | Back alignment and structure |
| >pdb|3UIX|A Chain A, Crystal Structure Of Pim1 Kinase In Complex With Small Molecule Inhibitor Length = 298 | Back alignment and structure |
| >pdb|2XIY|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-2 From Crystallographic Fragment Screen Length = 301 | Back alignment and structure |
| >pdb|3DCV|A Chain A, Crystal Structure Of Human Pim1 Kinase Complexed With 4-(4- Hydroxy-3-Methyl-Phenyl)-6-Phenylpyrimidin-2(1h)-One Length = 328 | Back alignment and structure |
| >pdb|1YWV|A Chain A, Crystal Structures Of Proto-Oncogene Kinase Pim1: A Target Of Aberrant Somatic Hypermutations In Diffuse Large Cell Lymphoma Length = 293 | Back alignment and structure |
| >pdb|3R00|A Chain A, The Discovery Of Novel Benzofuran-2-Carboxylic Acids As Potent Pim-1 Inhibitors Length = 299 | Back alignment and structure |
| >pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 | Back alignment and structure |
| >pdb|3F2A|A Chain A, Crystal Structure Of Human Pim-1 In Complex With Dappa Length = 300 | Back alignment and structure |
| >pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 | Back alignment and structure |
| >pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 | Back alignment and structure |
| >pdb|2XIX|A Chain A, Protein Kinase Pim-1 In Complex With Fragment-1 From Crystallographic Fragment Screen Length = 301 | Back alignment and structure |
| >pdb|3C4E|A Chain A, Pim-1 Kinase Domain In Complex With 3-Aminophenyl-7- Azaindole Length = 273 | Back alignment and structure |
| >pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 | Back alignment and structure |
| >pdb|4DTK|A Chain A, Novel And Selective Pan-Pim Kinase Inhibitor Length = 276 | Back alignment and structure |
| >pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 | Back alignment and structure |
| >pdb|4ALU|A Chain A, Benzofuropyrimidinone Inhibitors Of Pim-1 Length = 328 | Back alignment and structure |
| >pdb|1YXS|A Chain A, Crystal Structure Of Kinase Pim1 With P123m Mutation Length = 293 | Back alignment and structure |
| >pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 | Back alignment and structure |
| >pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 | Back alignment and structure |
| >pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 | Back alignment and structure |
| >pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 | Back alignment and structure |
| >pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 | Back alignment and structure |
| >pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 | Back alignment and structure |
| >pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 | Back alignment and structure |
| >pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 | Back alignment and structure |
| >pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 | Back alignment and structure |
| >pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 | Back alignment and structure |
| >pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 | Back alignment and structure |
| >pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 | Back alignment and structure |
| >pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 | Back alignment and structure |
| >pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 | Back alignment and structure |
| >pdb|2OBJ|A Chain A, Crystal Structure Of Human Pim-1 Kinase In Complex With Inhibitor Length = 333 | Back alignment and structure |
| >pdb|3D5V|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain. Length = 317 | Back alignment and structure |
| >pdb|3DB6|A Chain A, Crystal Structure Of An Activated (Thr->asp) Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Compound 902 Length = 301 | Back alignment and structure |
| >pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 | Back alignment and structure |
| >pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 | Back alignment and structure |
| >pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 | Back alignment and structure |
| >pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 | Back alignment and structure |
| >pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 | Back alignment and structure |
| >pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 | Back alignment and structure |
| >pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 | Back alignment and structure |
| >pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 | Back alignment and structure |
| >pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 | Back alignment and structure |
| >pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 | Back alignment and structure |
| >pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 | Back alignment and structure |
| >pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 | Back alignment and structure |
| >pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 | Back alignment and structure |
| >pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 | Back alignment and structure |
| >pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 | Back alignment and structure |
| >pdb|3H9F|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (Ttk) In Complex With A Pyrimido-Diazepin Ligand Length = 313 | Back alignment and structure |
| >pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 | Back alignment and structure |
| >pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 | Back alignment and structure |
| >pdb|3CEK|A Chain A, Crystal Structure Of Human Dual Specificity Protein Kinase (ttk) Length = 313 | Back alignment and structure |
| >pdb|2X9E|A Chain A, Human Mps1 In Complex With Nms-P715 Length = 317 | Back alignment and structure |
| >pdb|3VQU|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With 4- [(4-Amino-5-Cyano-6-Ethoxypyridin-2- Yl)amino]benzamide Length = 320 | Back alignment and structure |
| >pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 | Back alignment and structure |
| >pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 | Back alignment and structure |
| >pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 | Back alignment and structure |
| >pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 | Back alignment and structure |
| >pdb|3HMN|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain In Complex With Atp Length = 342 | Back alignment and structure |
| >pdb|3D5U|A Chain A, Crystal Structure Of A Wildtype Polo-Like Kinase 1 (Plk1) Catalytic Domain Length = 317 | Back alignment and structure |
| >pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 | Back alignment and structure |
| >pdb|3D5W|A Chain A, Crystal Structure Of A Phosphorylated Polo-Like Kinase 1 (Plk1) Catalytic Domain In Complex With Adp Length = 317 | Back alignment and structure |
| >pdb|2IWI|A Chain A, Crystal Structure Of The Human Pim2 In Complex With A Ruthenium Organometallic Ligand Ru1 Length = 312 | Back alignment and structure |
| >pdb|2ZMC|A Chain A, Crystal Structure Of Human Mitotic Checkpoint Kinase Mps1 Catalytic Domain Apo Form Length = 390 | Back alignment and structure |
| >pdb|2ZMD|A Chain A, Crystal Structure Of Human Mps1 Catalytic Domain T686a Mutant In Complex With Sp600125 Inhibitor Length = 390 | Back alignment and structure |
| >pdb|2AC3|A Chain A, Structure Of Human Mnk2 Kinase Domain Length = 316 | Back alignment and structure |
| >pdb|3DBQ|A Chain A, Crystal Structure Of Ttk Kinase Domain Length = 343 | Back alignment and structure |
| >pdb|2YAC|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With Nms-P937 Length = 311 | Back alignment and structure |
| >pdb|3KB7|A Chain A, Crystal Structure Of Polo-Like Kinase 1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 311 | Back alignment and structure |
| >pdb|2V5Q|A Chain A, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 315 | Back alignment and structure |
| >pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 | Back alignment and structure |
| >pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 | Back alignment and structure |
| >pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 | Back alignment and structure |
| >pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 | Back alignment and structure |
| >pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 | Back alignment and structure |
| >pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 | Back alignment and structure |
| >pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 | Back alignment and structure |
| >pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 | Back alignment and structure |
| >pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 | Back alignment and structure |
| >pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 | Back alignment and structure |
| >pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 | Back alignment and structure |
| >pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 | Back alignment and structure |
| >pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 | Back alignment and structure |
| >pdb|3NR9|A Chain A, Structure Of Human Cdc2-Like Kinase 2 (Clk2) Length = 368 | Back alignment and structure |
| >pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 | Back alignment and structure |
| >pdb|2RKU|A Chain A, Structure Of Plk1 In Complex With Bi2536 Length = 294 | Back alignment and structure |
| >pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|3THB|A Chain A, Structure Of Plk1 Kinase Domain In Complex With A Benzolactam-Derived Inhibitor Length = 333 | Back alignment and structure |
| >pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 | Back alignment and structure |
| >pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 | Back alignment and structure |
| >pdb|2OU7|A Chain A, Structure Of The Catalytic Domain Of Human Polo-Like Kinase 1 Length = 335 | Back alignment and structure |
| >pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 | Back alignment and structure |
| >pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 | Back alignment and structure |
| >pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 | Back alignment and structure |
| >pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 | Back alignment and structure |
| >pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 | Back alignment and structure |
| >pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 | Back alignment and structure |
| >pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 | Back alignment and structure |
| >pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 | Back alignment and structure |
| >pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 | Back alignment and structure |
| >pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 | Back alignment and structure |
| >pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 | Back alignment and structure |
| >pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 | Back alignment and structure |
| >pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 | Back alignment and structure |
| >pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 | Back alignment and structure |
| >pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 | Back alignment and structure |
| >pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 | Back alignment and structure |
| >pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 | Back alignment and structure |
| >pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 | Back alignment and structure |
| >pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 | Back alignment and structure |
| >pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 | Back alignment and structure |
| >pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 | Back alignment and structure |
| >pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 | Back alignment and structure |
| >pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 | Back alignment and structure |
| >pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 | Back alignment and structure |
| >pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 | Back alignment and structure |
| >pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 | Back alignment and structure |
| >pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 | Back alignment and structure |
| >pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 | Back alignment and structure |
| >pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 | Back alignment and structure |
| >pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 | Back alignment and structure |
| >pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 | Back alignment and structure |
| >pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 | Back alignment and structure |
| >pdb|3QD2|B Chain B, Crsytal Structure Of Mouse Perk Kinase Domain Length = 332 | Back alignment and structure |
| >pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 | Back alignment and structure |
| >pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 | Back alignment and structure |
| >pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 | Back alignment and structure |
| >pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 | Back alignment and structure |
| >pdb|3ZHP|C Chain C, Human Mst3 (stk24) In Complex With Mo25beta Length = 294 | Back alignment and structure |
| >pdb|3CKW|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) Length = 304 | Back alignment and structure |
| >pdb|3A7F|A Chain A, Human Mst3 Kinase Length = 303 | Back alignment and structure |
| >pdb|3CKX|A Chain A, Crystal Structure Of Sterile 20-Like Kinase 3 (Mst3, Stk24) In Complex With Staurosporine Length = 304 | Back alignment and structure |
| >pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 | Back alignment and structure |
| >pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 | Back alignment and structure |
| >pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 | Back alignment and structure |
| >pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 | Back alignment and structure |
| >pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 | Back alignment and structure |
| >pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 | Back alignment and structure |
| >pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 | Back alignment and structure |
| >pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 | Back alignment and structure |
| >pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 | Back alignment and structure |
| >pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 | Back alignment and structure |
| >pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 | Back alignment and structure |
| >pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 | Back alignment and structure |
| >pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 | Back alignment and structure |
| >pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 | Back alignment and structure |
| >pdb|2XIK|A Chain A, Structure Of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1) Length = 294 | Back alignment and structure |
| >pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 | Back alignment and structure |
| >pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 | Back alignment and structure |
| >pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 | Back alignment and structure |
| >pdb|2WU6|A Chain A, Crystal Structure Of The Human Clk3 In Complex With Dki Length = 381 | Back alignment and structure |
| >pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | Back alignment and structure |
| >pdb|2EXE|A Chain A, Crystal Structure Of The Phosphorylated Clk3 Length = 357 | Back alignment and structure |
| >pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 | Back alignment and structure |
| >pdb|2EU9|A Chain A, Crystal Structure Of Clk3 Length = 355 | Back alignment and structure |
| >pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|2NRY|A Chain A, Crystal Structure Of Irak-4 Length = 307 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 110 | |||
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 9e-55 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 9e-55 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 4e-53 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 9e-53 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-52 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 4e-52 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 4e-52 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-51 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 5e-51 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 5e-51 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 1e-50 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 2e-49 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 3e-49 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 4e-49 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 4e-49 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 2e-48 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 2e-48 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 2e-48 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 2e-48 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 5e-48 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 1e-47 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 2e-47 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 3e-47 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 4e-47 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 4e-47 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 5e-47 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 1e-46 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 2e-46 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 3e-45 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 2e-44 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 3e-44 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 9e-38 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 6e-36 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 1e-31 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 5e-30 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 6e-30 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 3e-29 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 4e-28 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 1e-26 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 3e-26 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 4e-26 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 1e-25 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 1e-23 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 2e-23 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 2e-23 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 3e-23 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 4e-23 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 9e-23 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 2e-22 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 2e-22 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 1e-21 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 2e-21 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 3e-21 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 3e-21 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 4e-21 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 7e-21 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 9e-20 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 1e-19 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 1e-19 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 2e-19 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 3e-19 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 4e-19 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 2e-18 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 4e-17 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 7e-16 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 8e-16 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 1e-15 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 2e-15 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 3e-15 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 3e-15 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 7e-15 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 7e-15 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 1e-13 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 3e-13 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 4e-13 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 5e-13 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 9e-13 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 1e-12 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 2e-12 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 2e-12 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 2e-12 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 3e-12 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 8e-12 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 1e-11 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 1e-11 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 1e-11 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 1e-11 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 2e-11 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 2e-11 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 3e-11 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 3e-11 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 3e-11 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 4e-11 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 1e-10 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 1e-10 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 1e-10 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 1e-10 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 2e-10 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 2e-10 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 4e-10 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 8e-10 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 3e-09 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 3e-09 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 3e-09 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 4e-09 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 9e-09 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 1e-08 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 1e-08 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 1e-08 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 2e-08 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 2e-08 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 2e-08 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 2e-08 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 2e-08 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 2e-08 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 3e-08 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 3e-08 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 4e-08 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 5e-08 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 6e-08 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 6e-08 | |
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 6e-08 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 9e-08 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 9e-08 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 1e-07 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 1e-07 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 3e-07 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 4e-07 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 4e-07 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 4e-07 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 6e-07 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 7e-07 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 8e-07 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 1e-06 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 1e-06 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 1e-06 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 2e-06 | |
| 1uu3_A | 310 | HPDK1, 3-phosphoinositide dependent protein kinase | 2e-06 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 3e-06 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 3e-06 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 3e-06 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 6e-06 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 6e-06 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 8e-06 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 1e-05 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 1e-05 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 2e-05 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 2e-05 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 3e-05 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 4e-05 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 6e-05 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 8e-05 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 1e-04 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 1e-04 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 1e-04 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 1e-04 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 2e-04 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 2e-04 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 2e-04 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 3e-04 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 3e-04 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 4e-04 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 4e-04 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 4e-04 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 6e-04 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 9e-04 |
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
Score = 170 bits (434), Expect = 9e-55
Identities = 47/109 (43%), Positives = 64/109 (58%)
Query: 1 MKLCEEGELVDRIVAKGHYTERVAAAVMKTIVEVVQVCHKHGVMHHDLNPKKILFVNKKK 60
M+LC GEL +R+V K + E AA +MK ++ V CHK V H DL P+ LF+
Sbjct: 85 MELCTGGELFERVVHKRVFRESDAARIMKDVLSAVAYCHKLNVAHRDLKPENFLFLTDSP 144
Query: 61 SFSLKAIDFGLSVFFRPREQFNELVGSLYYMALEVLKRNYGPEVDVWSM 109
LK IDFGL+ F+P + VG+ YY++ +VL+ YGPE D WS
Sbjct: 145 DSPLKLIDFGLAARFKPGKMMRTKVGTPYYVSPQVLEGLYGPECDEWSA 193
|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 110 | |||
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 100.0 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 100.0 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 100.0 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 100.0 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 100.0 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 100.0 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 100.0 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 100.0 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 100.0 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 100.0 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 100.0 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 100.0 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 99.98 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 99.98 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 99.98 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.97 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.97 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.97 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.97 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.96 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.96 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.96 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 99.96 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.96 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 99.96 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.96 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 99.96 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.96 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.96 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.96 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.96 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 99.96 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 99.95 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.95 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.95 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.95 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.95 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.95 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.95 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.95 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.95 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.95 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.95 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 99.95 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.95 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 99.95 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 99.95 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 99.95 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 99.95 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.95 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 99.95 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.95 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.95 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 99.95 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.94 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 99.94 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.94 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 99.94 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 99.94 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 99.94 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 99.94 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 99.94 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 99.94 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.94 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 99.94 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.94 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 99.94 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 99.94 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 99.94 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 99.94 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 99.94 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 99.94 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 99.94 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 99.94 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 99.94 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 99.94 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 99.94 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 99.94 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 99.94 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 99.94 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 99.94 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 99.94 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 99.94 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 99.93 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 99.93 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 99.93 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 99.93 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.93 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 99.93 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 99.93 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 99.93 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 99.93 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 99.93 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 99.93 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.93 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 99.93 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 99.93 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 99.93 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 99.93 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 99.93 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 99.93 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 99.93 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 99.93 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 99.93 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 99.93 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 99.93 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 99.93 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 99.93 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 99.93 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.93 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 99.93 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 99.93 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 99.93 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 99.93 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 99.93 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 99.93 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 99.93 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 99.93 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 99.93 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 99.93 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 99.93 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 99.93 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 99.93 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 99.93 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.92 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 99.92 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 99.92 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.92 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 99.92 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.92 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 99.92 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 99.92 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 99.92 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 99.92 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 99.92 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 99.92 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 99.92 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 99.92 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 99.92 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 99.92 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 99.92 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.92 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.92 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 99.92 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 99.92 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 99.92 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 99.92 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 99.92 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 99.92 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 99.92 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 99.92 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.92 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 99.92 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 99.92 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 99.92 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 99.92 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 99.92 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 99.92 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 99.92 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 99.92 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.92 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 99.92 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 99.92 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.92 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.92 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 99.92 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 99.92 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 99.92 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 99.92 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 99.92 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.92 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 99.92 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 99.92 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 99.92 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.92 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.92 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 99.92 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 99.92 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 99.92 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 99.91 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 99.91 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 99.91 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 99.91 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 99.91 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 99.91 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 99.91 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 99.91 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 99.91 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 99.91 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 99.91 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 99.91 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 99.91 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 99.91 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 99.91 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 99.91 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 99.91 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 99.91 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 99.91 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 99.91 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 99.91 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.91 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 99.91 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.91 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 99.91 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 99.91 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 99.91 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 99.91 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 99.91 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 99.91 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 99.91 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 99.91 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 99.91 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 99.91 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 99.91 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 99.91 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 99.91 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 99.91 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 99.9 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 99.9 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 99.9 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 99.9 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.9 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 99.9 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 99.9 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 99.9 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 99.9 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 99.9 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 99.9 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 99.9 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 99.9 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 99.9 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 99.9 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 99.9 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 99.9 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 99.9 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 99.89 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 99.89 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 99.89 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 99.89 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 99.89 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 99.89 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 99.89 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 99.89 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 99.89 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 99.89 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 99.88 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 99.88 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 99.88 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 99.88 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 99.86 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 99.84 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 99.75 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 99.68 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 99.42 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 99.18 | |
| 3tm0_A | 263 | Aminoglycoside 3'-phosphotransferase; protein kina | 98.28 | |
| 3dxp_A | 359 | Putative acyl-COA dehydrogenase; protein kinase-li | 98.24 | |
| 1nd4_A | 264 | Aminoglycoside 3'-phosphotransferase; protein kina | 97.97 | |
| 3sg8_A | 304 | APH(2'')-ID; antibiotic resistance enzyme, transfe | 97.65 | |
| 3r70_A | 320 | Aminoglycoside phosphotransferase; structural geno | 97.62 | |
| 3tdw_A | 306 | Gentamicin resistance protein; kinase, phosphoryl | 97.02 | |
| 2q83_A | 346 | YTAA protein; 2635576, structural genomics, joint | 96.29 | |
| 2pyw_A | 420 | Uncharacterized protein; 5-methylthioribose kinase | 94.68 | |
| 4gkh_A | 272 | Aminoglycoside 3'-phosphotransferase APHA1-IAB; py | 93.43 | |
| 2ppq_A | 322 | HSK, HK, homoserine kinase; structural genomics, M | 92.97 | |
| 3ats_A | 357 | Putative uncharacterized protein; hypothetical pro | 91.81 | |
| 1zyl_A | 328 | Hypothetical protein YIHE; putative protein kinase | 91.14 | |
| 3ovc_A | 362 | Hygromycin-B 4-O-kinase; aminoglycoside phosphotra | 91.08 | |
| 3csv_A | 333 | Aminoglycoside phosphotransferase; YP_614837.1, ph | 90.97 | |
| 3i1a_A | 339 | Spectinomycin phosphotransferase; protein kinase, | 89.82 | |
| 3c5i_A | 369 | Choline kinase; choline, kinase, malaria, transfer | 89.22 | |
| 2olc_A | 397 | MTR kinase, methylthioribose kinase; kinase ADP-2H | 87.55 | |
| 3g15_A | 401 | CK, chetk-alpha, choline kinase alpha; non-protein | 86.53 | |
| 3feg_A | 379 | Choline/ethanolamine kinase; non-protein kinase, c | 86.03 | |
| 2qg7_A | 458 | Ethanolamine kinase PV091845; malaria, SGC, struct | 85.64 | |
| 3dxq_A | 301 | Choline/ethanolamine kinase family protein; NP_106 | 84.82 | |
| 1nw1_A | 429 | Choline kinase (49.2 KD); phospholipid synthesis, | 84.05 | |
| 3f2s_A | 401 | CK, chetk-alpha, choline kinase alpha; non-protein | 82.34 |
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=8.6e-38 Score=192.73 Aligned_cols=107 Identities=26% Similarity=0.530 Sum_probs=95.4
Q ss_pred CCCcCCCChHHHHHhCCCCCHHHHHHHHHHHHHHHHHHHHcCCeeCCCCCCceEEeeCCCCceEEEeecccccccCCcc-
Q 033833 1 MKLCEEGELVDRIVAKGHYTERVAAAVMKTIVEVVQVCHKHGVMHHDLNPKKILFVNKKKSFSLKAIDFGLSVFFRPRE- 79 (110)
Q Consensus 1 ~e~~~~g~l~~~~~~~~~~~~~~~~~~~~~l~~~l~~lh~~~i~h~~l~~~~il~~~~~~~~~~~l~d~g~~~~~~~~~- 79 (110)
||||+||+|.+++.+.+.+++.+++.++.|++.||.|||+++|+|||+||+||+++ ....+||+|||+++.+....
T Consensus 111 mEy~~gG~L~~~i~~~~~l~e~~~~~~~~qi~~al~ylH~~~IiHRDlKPeNILl~---~~g~vKl~DFGla~~~~~~~~ 187 (311)
T 4aw0_A 111 LSYAKNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLN---EDMHIQITDFGTAKVLSPESK 187 (311)
T ss_dssp ECCCTTEEHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHTTEECSCCSGGGEEEC---TTSCEEECCCTTCEECCTTTT
T ss_pred EecCCCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCCccCCCCHHHeEEc---CCCCEEEEEcCCceecCCCCC
Confidence 79999999999999889999999999999999999999999999999999999994 44579999999998764322
Q ss_pred --cccccccCccccccccccc-cCCCccceeecC
Q 033833 80 --QFNELVGSLYYMALEVLKR-NYGPEVDVWSML 110 (110)
Q Consensus 80 --~~~~~~~~~~~~~pe~~~~-~~~~~~D~wslg 110 (110)
...+.+||+.|+|||++.+ .|+.++|+||+|
T Consensus 188 ~~~~~~~~GTp~YmAPEvl~~~~y~~~~DiWSlG 221 (311)
T 4aw0_A 188 QARANSFVGTAQYVSPELLTEKSACKSSDLWALG 221 (311)
T ss_dssp CCCBCCCCSCGGGCCHHHHHHSCBCHHHHHHHHH
T ss_pred cccccCcccCcccCCHHHHcCCCCCcHHHHHHHH
Confidence 2345789999999999985 589999999997
|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* | Back alignment and structure |
|---|
| >3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A | Back alignment and structure |
|---|
| >3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* | Back alignment and structure |
|---|
| >2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* | Back alignment and structure |
|---|
| >2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* | Back alignment and structure |
|---|
| >1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* | Back alignment and structure |
|---|
| >3c5i_A Choline kinase; choline, kinase, malaria, transferase, structural genomics, structural genomics consortium; 2.20A {Plasmodium knowlesi} PDB: 3fi8_A* | Back alignment and structure |
|---|
| >2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* | Back alignment and structure |
|---|
| >3g15_A CK, chetk-alpha, choline kinase alpha; non-protein kinase, structural genomics CONS SGC, hemicholinium-3, transferase; HET: ADP HC6; 1.70A {Homo sapiens} PDB: 3f2r_A* 2i7q_A 2cko_A 2ckp_A* 2ckq_A* | Back alignment and structure |
|---|
| >3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* | Back alignment and structure |
|---|
| >2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 110 | ||||
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 8e-21 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 9e-21 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 1e-20 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 2e-20 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 5e-20 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 5e-20 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 2e-19 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 7e-19 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 1e-18 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 2e-18 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 2e-18 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 9e-18 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 2e-17 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 2e-17 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 6e-17 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 9e-17 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 2e-16 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 2e-16 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 7e-16 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 1e-15 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 4e-15 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 4e-15 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 4e-15 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 2e-14 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 8e-14 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 4e-13 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 4e-13 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 5e-13 | |
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 6e-13 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 1e-12 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 2e-12 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 5e-12 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 7e-12 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 1e-11 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 1e-11 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 1e-11 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 2e-11 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 3e-11 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 7e-11 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 8e-11 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 9e-11 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 1e-10 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 2e-10 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 2e-10 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 3e-10 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 3e-10 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 4e-10 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 4e-10 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 6e-10 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 9e-10 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 3e-09 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 4e-09 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 8e-09 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 2e-08 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 3e-08 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 5e-08 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 1e-07 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 1e-07 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 2e-07 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 4e-06 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 1e-05 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 5e-05 |
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Twitchin, kinase domain species: Caenorhabditis elegans, pjk4 [TaxId: 6239]
Score = 82.8 bits (204), Expect = 8e-21
Identities = 31/111 (27%), Positives = 56/111 (50%), Gaps = 3/111 (2%)
Query: 1 MKLCEEGELVDRIVAK-GHYTERVAAAVMKTIVEVVQVCHKHGVMHHDLNPKKILFVNKK 59
+ GEL +++ + +E A M+ + + + H++ +H DL P+ I+F K
Sbjct: 102 YEFMSGGELFEKVADEHNKMSEDEAVEYMRQVCKGLCHMHENNYVHLDLKPENIMFTT-K 160
Query: 60 KSFSLKAIDFGLSVFFRPREQFNELVGSLYYMALEVLK-RNYGPEVDVWSM 109
+S LK IDFGL+ P++ G+ + A EV + + G D+WS+
Sbjct: 161 RSNELKLIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYTDMWSV 211
|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 110 | |||
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 100.0 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 100.0 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 100.0 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 100.0 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 100.0 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 100.0 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.98 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.97 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.97 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.97 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.97 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.97 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.97 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 99.97 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.97 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 99.97 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.97 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.97 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 99.97 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 99.97 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 99.97 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.97 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 99.97 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 99.97 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 99.97 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 99.97 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 99.96 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 99.96 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.96 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 99.96 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 99.96 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 99.96 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 99.95 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.95 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 99.95 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 99.95 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 99.95 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 99.95 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 99.95 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.95 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.95 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 99.95 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 99.95 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 99.94 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.94 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.94 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 99.94 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 99.94 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 99.94 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.94 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.94 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.94 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.93 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 99.93 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.93 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.92 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.92 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 99.85 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 99.69 | |
| d2ppqa1 | 316 | Homoserine kinase ThrB {Agrobacterium tumefaciens | 95.77 | |
| d1j7la_ | 263 | Type IIIa 3',5"-aminoglycoside phosphotransferase | 92.92 | |
| d1zyla1 | 325 | RdoA {Escherichia coli [TaxId: 562]} | 92.59 | |
| d1nd4a_ | 255 | Aminoglycoside 3'-phosphotransferase IIa (Kanamyci | 92.02 | |
| d2pula1 | 392 | Methylthioribose kinase MtnK {Bacillus subtilis [T | 89.41 | |
| d1nw1a_ | 395 | Choline kinase {Caenorhabditis elegans [TaxId: 623 | 80.73 |
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Calmodulin-dependent protein kinase species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00 E-value=2.8e-35 Score=180.39 Aligned_cols=110 Identities=37% Similarity=0.633 Sum_probs=85.5
Q ss_pred CCCcCCCChHHHHHhCCCCCHHHHHHHHHHHHHHHHHHHHcCCeeCCCCCCceEEeeCCCCceEEEeecccccccCCccc
Q 033833 1 MKLCEEGELVDRIVAKGHYTERVAAAVMKTIVEVVQVCHKHGVMHHDLNPKKILFVNKKKSFSLKAIDFGLSVFFRPREQ 80 (110)
Q Consensus 1 ~e~~~~g~l~~~~~~~~~~~~~~~~~~~~~l~~~l~~lh~~~i~h~~l~~~~il~~~~~~~~~~~l~d~g~~~~~~~~~~ 80 (110)
||||+||+|.+++.+.+.+++.++..++.|++.|+.|||+++++|||++|+||++...+....+|++|||++........
T Consensus 86 mE~~~gg~L~~~l~~~~~l~e~~~~~~~~qi~~al~ylH~~~iiHrDiKp~Nil~~~~~~~~~vkl~DFG~a~~~~~~~~ 165 (307)
T d1a06a_ 86 MQLVSGGELFDRIVEKGFYTERDASRLIFQVLDAVKYLHDLGIVHRDLKPENLLYYSLDEDSKIMISDFGLSKMEDPGSV 165 (307)
T ss_dssp ECCCCSCBHHHHHHTCSCCCHHHHHHHHHHHHHHHHHHHHTTCCCSCCCGGGEEESSSSTTCCEEECCC-----------
T ss_pred EeccCCCcHHHhhhcccCCCHHHHHHHHHHHHHHHHhhhhceeeeEEecccceeecccCCCceEEEeccceeEEccCCCe
Confidence 79999999999999888999999999999999999999999999999999999996544556799999999987655544
Q ss_pred ccccccCccccccccccc-cCCCccceeecC
Q 033833 81 FNELVGSLYYMALEVLKR-NYGPEVDVWSML 110 (110)
Q Consensus 81 ~~~~~~~~~~~~pe~~~~-~~~~~~D~wslg 110 (110)
....+||+.|+|||++.+ .|+.++|+||+|
T Consensus 166 ~~~~~GT~~y~APE~~~~~~~~~~~DiwSlG 196 (307)
T d1a06a_ 166 LSTACGTPGYVAPEVLAQKPYSKAVDCWSIG 196 (307)
T ss_dssp -------CTTSCHHHHTTCCCCTHHHHHHHH
T ss_pred eeeeeeCccccCcHHHcCCCCCcHHHhhhhh
Confidence 456789999999999975 589999999997
|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2ppqa1 d.144.1.6 (A:5-320) Homoserine kinase ThrB {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|