Query         033869
Match_columns 110
No_of_seqs    148 out of 941
Neff          7.6 
Searched_HMMs 46136
Date          Fri Mar 29 07:13:29 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033869.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033869hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2906 RNA polymerase III sub 100.0 1.5E-46 3.2E-51  236.9   5.4  104    1-110     1-105 (105)
  2 KOG2691 RNA polymerase II subu 100.0 2.9E-41 6.3E-46  216.0   6.1  108    1-110     4-113 (113)
  3 COG1594 RPB9 DNA-directed RNA  100.0 7.4E-39 1.6E-43  210.4   8.5  104    1-110     2-112 (113)
  4 TIGR01384 TFS_arch transcripti 100.0   1E-38 2.2E-43  206.8   8.9  101    2-110     1-102 (104)
  5 KOG2907 RNA polymerase I trans 100.0 3.5E-33 7.7E-38  180.3   3.1  104    1-110     7-114 (116)
  6 smart00440 ZnF_C2C2 C2C2 Zinc   99.9 9.2E-27   2E-31  127.1   4.9   40   69-110     1-40  (40)
  7 PF01096 TFIIS_C:  Transcriptio  99.9   2E-25 4.3E-30  121.2   4.5   39   69-109     1-39  (39)
  8 PHA02998 RNA polymerase subuni  99.8 1.8E-21 3.9E-26  135.1   4.9   44   64-109   138-182 (195)
  9 TIGR01385 TFSII transcription   99.7 7.3E-18 1.6E-22  126.7   4.6   41   67-109   257-297 (299)
 10 PF02150 RNA_POL_M_15KD:  RNA p  99.5 4.8E-15   1E-19   78.5   1.4   34    1-37      1-34  (35)
 11 smart00661 RPOL9 RNA polymeras  99.1 9.5E-11 2.1E-15   66.6   4.8   41    2-46      1-41  (52)
 12 KOG1105 Transcription elongati  99.0 4.6E-10   1E-14   84.1   3.8   40   68-109   255-294 (296)
 13 PF14803 Nudix_N_2:  Nudix N-te  98.5   1E-07 2.3E-12   49.9   2.0   33    2-34      1-33  (34)
 14 PRK00432 30S ribosomal protein  98.2 1.3E-06 2.8E-11   49.6   2.5   27    2-34     21-48  (50)
 15 PF04606 Ogr_Delta:  Ogr/Delta-  97.6 9.9E-05 2.1E-09   41.1   3.3   38   70-109     1-38  (47)
 16 COG1998 RPS31 Ribosomal protei  97.4 0.00018 3.8E-09   40.5   2.4   28    2-35     20-49  (51)
 17 PRK09678 DNA-binding transcrip  97.3 0.00024 5.2E-09   43.2   2.9   38   69-109     2-40  (72)
 18 PHA00626 hypothetical protein   96.9   0.001 2.2E-08   38.4   2.4   36    2-37      1-37  (59)
 19 PF13248 zf-ribbon_3:  zinc-rib  96.7 0.00075 1.6E-08   33.0   1.0   24    1-32      2-25  (26)
 20 PF09297 zf-NADH-PPase:  NADH p  96.6  0.0016 3.5E-08   33.3   2.0   28    2-33      4-31  (32)
 21 PF01396 zf-C4_Topoisom:  Topoi  96.6  0.0032   7E-08   33.7   3.0   34    2-37      2-38  (39)
 22 PF10571 UPF0547:  Uncharacteri  96.6  0.0011 2.4E-08   32.6   1.0   24    3-34      2-25  (26)
 23 PF13240 zinc_ribbon_2:  zinc-r  96.4  0.0015 3.1E-08   31.2   0.9   22    3-32      1-22  (23)
 24 PF01396 zf-C4_Topoisom:  Topoi  96.4  0.0042 9.1E-08   33.2   2.8   32   68-107     1-33  (39)
 25 PF07754 DUF1610:  Domain of un  96.2  0.0049 1.1E-07   29.7   2.2   24    4-31      1-24  (24)
 26 PRK03564 formate dehydrogenase  96.2   0.022 4.8E-07   43.5   6.8   72    2-109   188-263 (309)
 27 cd00350 rubredoxin_like Rubred  96.2  0.0042 9.1E-08   32.0   2.0   15   68-82     17-31  (33)
 28 PF08274 PhnA_Zn_Ribbon:  PhnA   95.9   0.002 4.4E-08   32.7  -0.0   27   70-109     4-30  (30)
 29 PF04216 FdhE:  Protein involve  95.9  0.0093   2E-07   44.7   3.4   72    2-109   173-249 (290)
 30 PRK00398 rpoP DNA-directed RNA  95.9   0.012 2.6E-07   32.3   3.0   31    3-37      5-35  (46)
 31 PHA00626 hypothetical protein   95.8  0.0095   2E-07   34.4   2.4   33   70-109     2-34  (59)
 32 TIGR01562 FdhE formate dehydro  95.8   0.046   1E-06   41.7   6.9   72    3-108   186-262 (305)
 33 PF09855 DUF2082:  Nucleic-acid  95.8   0.019 4.1E-07   34.1   3.7   11   70-80      2-12  (64)
 34 COG1773 Rubredoxin [Energy pro  95.7   0.014 3.1E-07   33.6   3.1   49   23-84      3-52  (55)
 35 cd00730 rubredoxin Rubredoxin;  95.7  0.0079 1.7E-07   34.0   1.7   47   23-82      1-48  (50)
 36 PF12760 Zn_Tnp_IS1595:  Transp  95.5   0.013 2.8E-07   32.2   2.3   28   69-107    19-46  (46)
 37 PF00301 Rubredoxin:  Rubredoxi  95.5   0.017 3.7E-07   32.2   2.7   46   23-81      1-47  (47)
 38 cd00729 rubredoxin_SM Rubredox  95.5   0.016 3.4E-07   30.1   2.4   12   23-34      2-13  (34)
 39 COG2888 Predicted Zn-ribbon RN  95.4  0.0091   2E-07   34.9   1.4   26    3-32     11-36  (61)
 40 PF12773 DZR:  Double zinc ribb  95.4   0.008 1.7E-07   33.4   1.1   27    2-33     13-39  (50)
 41 PF14353 CpXC:  CpXC protein     95.2   0.018 3.8E-07   38.1   2.5   45   24-78      2-48  (128)
 42 COG3478 Predicted nucleic-acid  95.1   0.018   4E-07   34.1   2.1   34   70-107     6-49  (68)
 43 PF08274 PhnA_Zn_Ribbon:  PhnA   95.0   0.015 3.3E-07   29.4   1.3   26    3-33      4-29  (30)
 44 PRK14973 DNA topoisomerase I;   94.8   0.057 1.2E-06   46.7   5.2   33   67-107   634-666 (936)
 45 PF09855 DUF2082:  Nucleic-acid  94.7   0.018 3.8E-07   34.2   1.3   15   67-81     35-49  (64)
 46 TIGR00244 transcriptional regu  94.6   0.044 9.5E-07   37.6   3.3   36   70-109     2-39  (147)
 47 KOG3084 NADH pyrophosphatase I  94.6   0.048   1E-06   41.8   3.8   40    2-41    151-191 (345)
 48 PF08271 TF_Zn_Ribbon:  TFIIB z  94.6   0.023 4.9E-07   30.8   1.5   30    3-35      2-31  (43)
 49 PRK06319 DNA topoisomerase I/S  94.5    0.11 2.3E-06   44.7   6.0   32    3-36    594-629 (860)
 50 TIGR02098 MJ0042_CXXC MJ0042 f  94.4   0.035 7.6E-07   29.0   2.0   33    3-35      4-37  (38)
 51 PRK14890 putative Zn-ribbon RN  94.3   0.031 6.6E-07   32.6   1.7   26    3-32      9-34  (59)
 52 PF13719 zinc_ribbon_5:  zinc-r  94.2   0.043 9.4E-07   28.9   2.1   32    3-34      4-36  (37)
 53 COG1198 PriA Primosomal protei  94.2   0.014   3E-07   49.2   0.1   25   67-91    474-498 (730)
 54 PF13453 zf-TFIIB:  Transcripti  94.1   0.033 7.2E-07   29.8   1.5   29    4-34      2-30  (41)
 55 COG2816 NPY1 NTP pyrophosphohy  94.1   0.066 1.4E-06   40.3   3.5   38    2-43    112-150 (279)
 56 PF13453 zf-TFIIB:  Transcripti  94.1   0.085 1.8E-06   28.2   3.1   30   70-109     1-30  (41)
 57 smart00661 RPOL9 RNA polymeras  94.1   0.059 1.3E-06   29.9   2.5   12   96-109    20-31  (52)
 58 PRK00464 nrdR transcriptional   94.0   0.077 1.7E-06   36.7   3.6   36   70-109     2-39  (154)
 59 TIGR00595 priA primosomal prot  94.0   0.075 1.6E-06   42.9   4.0   27    4-34    225-251 (505)
 60 smart00440 ZnF_C2C2 C2C2 Zinc   93.8   0.088 1.9E-06   28.2   2.8   30    4-33      3-38  (40)
 61 PRK00241 nudC NADH pyrophospha  93.8     0.1 2.2E-06   38.7   4.1   32    1-36     99-130 (256)
 62 PRK07220 DNA topoisomerase I;   93.6    0.25 5.5E-06   41.8   6.6   32   67-106   634-665 (740)
 63 PRK09678 DNA-binding transcrip  93.6    0.12 2.7E-06   31.3   3.5   37    1-37      1-43  (72)
 64 PF10058 DUF2296:  Predicted in  93.6   0.062 1.3E-06   30.8   2.1   33   65-106    19-52  (54)
 65 PF04606 Ogr_Delta:  Ogr/Delta-  93.6   0.081 1.8E-06   29.2   2.5   34    4-37      2-41  (47)
 66 TIGR00686 phnA alkylphosphonat  93.6   0.058 1.3E-06   35.1   2.1   30    2-36      3-32  (109)
 67 PF09151 DUF1936:  Domain of un  93.6    0.23 5.1E-06   25.3   3.9   32   69-107     2-35  (36)
 68 PRK07219 DNA topoisomerase I;   93.5    0.28 6.2E-06   41.9   6.8   33   67-107   732-765 (822)
 69 PF05876 Terminase_GpA:  Phage   93.5   0.068 1.5E-06   43.7   2.9   42   67-110   199-241 (557)
 70 TIGR01206 lysW lysine biosynth  93.4    0.12 2.6E-06   29.6   3.1   31    3-35      4-34  (54)
 71 COG1645 Uncharacterized Zn-fin  93.4   0.079 1.7E-06   35.7   2.7   27    3-35     30-56  (131)
 72 COG1779 C4-type Zn-finger prot  93.4    0.12 2.5E-06   37.2   3.6   42   66-110    12-55  (201)
 73 PRK10220 hypothetical protein;  93.4   0.073 1.6E-06   34.7   2.3   31    2-37      4-34  (111)
 74 COG4332 Uncharacterized protei  93.3   0.085 1.8E-06   37.5   2.8   44   64-109    13-60  (203)
 75 PF12760 Zn_Tnp_IS1595:  Transp  93.3   0.082 1.8E-06   29.0   2.2   27    3-32     20-46  (46)
 76 PRK07219 DNA topoisomerase I;   93.1    0.36 7.8E-06   41.3   6.8   31    4-36    605-639 (822)
 77 COG2023 RPR2 RNase P subunit R  93.0   0.079 1.7E-06   34.4   2.1   34    2-35     57-94  (105)
 78 PF07282 OrfB_Zn_ribbon:  Putat  92.9   0.092   2E-06   30.9   2.1   31    3-37     30-60  (69)
 79 TIGR00340 zpr1_rel ZPR1-relate  92.8    0.21 4.5E-06   34.8   4.1   38   71-110     1-40  (163)
 80 PF08271 TF_Zn_Ribbon:  TFIIB z  92.8   0.077 1.7E-06   28.6   1.6   28   70-108     2-29  (43)
 81 PRK14559 putative protein seri  92.7   0.092   2E-06   43.8   2.6   24    1-32      1-24  (645)
 82 PF14353 CpXC:  CpXC protein     92.6     0.2 4.4E-06   33.0   3.7   39   69-109     2-49  (128)
 83 PRK14892 putative transcriptio  92.5     0.1 2.3E-06   33.5   2.2   31    3-35     23-54  (99)
 84 PF10122 Mu-like_Com:  Mu-like   92.4   0.072 1.6E-06   30.2   1.2   33    3-37      6-38  (51)
 85 smart00647 IBR In Between Ring  92.4    0.19 4.1E-06   28.6   3.0   30    1-32     18-49  (64)
 86 PRK14714 DNA polymerase II lar  92.1    0.14   3E-06   45.6   3.0   12   68-79    709-720 (1337)
 87 PF01485 IBR:  IBR domain;  Int  91.8    0.11 2.4E-06   29.6   1.5   30    1-32     18-49  (64)
 88 PRK05580 primosome assembly pr  91.7    0.25 5.4E-06   41.4   4.0   10   69-78    422-431 (679)
 89 PF11781 RRN7:  RNA polymerase   91.6    0.14   3E-06   26.9   1.6   25    4-33     11-35  (36)
 90 PRK04023 DNA polymerase II lar  91.6    0.13 2.7E-06   44.9   2.2   21    2-32    627-647 (1121)
 91 COG1327 Predicted transcriptio  91.5    0.13 2.8E-06   35.5   1.8   36   70-109     2-39  (156)
 92 PF13717 zinc_ribbon_4:  zinc-r  91.5    0.17 3.6E-06   26.5   1.8   30    4-33      5-35  (36)
 93 PF12773 DZR:  Double zinc ribb  91.4    0.13 2.7E-06   28.4   1.4   21    2-30     30-50  (50)
 94 TIGR03655 anti_R_Lar restricti  91.2    0.47   1E-05   26.7   3.7   34   69-107     2-35  (53)
 95 PF03119 DNA_ligase_ZBD:  NAD-d  91.1    0.13 2.7E-06   25.5   1.1   21    3-27      1-21  (28)
 96 PRK12286 rpmF 50S ribosomal pr  91.1    0.17 3.7E-06   29.3   1.8   24    2-34     28-51  (57)
 97 COG1096 Predicted RNA-binding   91.1    0.22 4.7E-06   35.5   2.7   28    3-36    151-178 (188)
 98 PRK14873 primosome assembly pr  90.9    0.31 6.6E-06   40.9   3.8   14   69-82    423-436 (665)
 99 COG1592 Rubrerythrin [Energy p  90.9    0.14 2.9E-06   35.9   1.5   29   23-81    134-162 (166)
100 COG1997 RPL43A Ribosomal prote  90.8    0.24 5.2E-06   31.1   2.4   29    3-35     37-65  (89)
101 PF09526 DUF2387:  Probable met  90.6    0.21 4.6E-06   30.1   2.0   35    3-37     10-44  (71)
102 COG0551 TopA Zn-finger domain   90.5     1.2 2.7E-05   29.7   5.9   37   66-108    58-95  (140)
103 PF05129 Elf1:  Transcription e  90.5    0.16 3.4E-06   31.4   1.4   31    4-34     25-57  (81)
104 PRK00420 hypothetical protein;  90.5     0.3 6.5E-06   32.1   2.7   30    3-37     25-54  (112)
105 KOG2907 RNA polymerase I trans  90.2    0.31 6.8E-06   32.0   2.6   32    3-34     76-113 (116)
106 TIGR02443 conserved hypothetic  90.1    0.24 5.2E-06   28.9   1.8   35    3-37     11-45  (59)
107 PRK03824 hypA hydrogenase nick  89.9    0.57 1.2E-05   31.5   3.8   16   21-36     68-83  (135)
108 PF07295 DUF1451:  Protein of u  89.9    0.32 6.9E-06   33.3   2.6   16   20-35    109-124 (146)
109 smart00709 Zpr1 Duplicated dom  89.8    0.57 1.2E-05   32.5   3.9   38   70-110     2-41  (160)
110 PF13408 Zn_ribbon_recom:  Reco  89.6    0.25 5.4E-06   27.7   1.7   31    1-32      5-35  (58)
111 TIGR01053 LSD1 zinc finger dom  89.5    0.46 9.9E-06   24.1   2.4   26    3-32      3-28  (31)
112 PF06827 zf-FPG_IleRS:  Zinc fi  89.4    0.16 3.5E-06   25.2   0.6   27    3-31      3-29  (30)
113 TIGR00515 accD acetyl-CoA carb  89.3   0.074 1.6E-06   40.2  -0.9   30    3-35     28-57  (285)
114 COG4640 Predicted membrane pro  89.3     0.2 4.4E-06   39.6   1.4   26    1-34      1-26  (465)
115 PRK05452 anaerobic nitric oxid  89.2    0.37 8.1E-06   38.7   2.9   52   20-84    422-474 (479)
116 CHL00174 accD acetyl-CoA carbo  89.1   0.072 1.6E-06   40.5  -1.1   31    3-36     40-70  (296)
117 smart00834 CxxC_CXXC_SSSS Puta  89.1    0.21 4.5E-06   26.2   1.0   28    3-31      7-34  (41)
118 COG2051 RPS27A Ribosomal prote  89.0     0.3 6.4E-06   29.1   1.7   30   67-107    18-47  (67)
119 PF03811 Zn_Tnp_IS1:  InsA N-te  88.9    0.51 1.1E-05   24.7   2.4   33   65-101     2-34  (36)
120 COG0777 AccD Acetyl-CoA carbox  88.8    0.13 2.7E-06   38.9   0.0   31    3-36     30-60  (294)
121 PF10058 DUF2296:  Predicted in  88.5    0.43 9.4E-06   27.2   2.1   27    4-32     25-53  (54)
122 TIGR01031 rpmF_bact ribosomal   88.5     0.3 6.5E-06   28.0   1.5   23    2-33     27-49  (55)
123 PF11792 Baculo_LEF5_C:  Baculo  88.3   0.019 4.1E-07   31.4  -3.4   30   74-106    13-42  (43)
124 PRK06319 DNA topoisomerase I/S  88.3     1.1 2.3E-05   38.8   5.2   33   67-106   692-727 (860)
125 PF12172 DUF35_N:  Rubredoxin-l  88.3    0.15 3.3E-06   26.5   0.1   21    3-31     13-33  (37)
126 PF04032 Rpr2:  RNAse P Rpr2/Rp  88.3     0.2 4.3E-06   30.5   0.6   29    2-30     47-84  (85)
127 PF08772 NOB1_Zn_bind:  Nin one  88.2    0.19 4.1E-06   30.6   0.5    9    2-10     25-33  (73)
128 PF06677 Auto_anti-p27:  Sjogre  87.9    0.48   1E-05   25.6   1.9   23    3-30     19-41  (41)
129 KOG3507 DNA-directed RNA polym  87.9    0.32 6.9E-06   28.4   1.3   25    3-32     22-46  (62)
130 PF07282 OrfB_Zn_ribbon:  Putat  87.8    0.53 1.2E-05   27.5   2.3   30   67-108    27-56  (69)
131 PRK05654 acetyl-CoA carboxylas  87.5    0.13 2.8E-06   39.0  -0.7   31    3-36     29-59  (292)
132 PF09862 DUF2089:  Protein of u  87.4    0.59 1.3E-05   30.7   2.5   23    4-34      1-23  (113)
133 smart00659 RPOLCX RNA polymera  87.3    0.57 1.2E-05   25.6   2.0   25    4-33      5-29  (44)
134 PRK11032 hypothetical protein;  87.1    0.59 1.3E-05   32.5   2.5   16   20-35    121-136 (160)
135 COG0675 Transposase and inacti  87.1    0.44 9.6E-06   35.2   2.0   26    3-37    311-336 (364)
136 PF08792 A2L_zn_ribbon:  A2L zi  86.8    0.87 1.9E-05   23.4   2.5   27    3-34      5-32  (33)
137 PF14205 Cys_rich_KTR:  Cystein  86.2    0.69 1.5E-05   26.5   2.0   34    3-36      6-41  (55)
138 COG1326 Uncharacterized archae  85.9    0.26 5.6E-06   35.3   0.2   37   67-109     5-41  (201)
139 PHA02942 putative transposase;  85.8     0.7 1.5E-05   36.2   2.6   31    2-37    326-356 (383)
140 PF01780 Ribosomal_L37ae:  Ribo  85.6    0.43 9.3E-06   30.2   1.1   29    2-34     36-64  (90)
141 COG2888 Predicted Zn-ribbon RN  85.2    0.85 1.8E-05   26.7   2.1   10   24-33     10-19  (61)
142 TIGR00310 ZPR1_znf ZPR1 zinc f  85.0     1.7 3.7E-05   31.0   4.1   39   70-110     2-42  (192)
143 TIGR01384 TFS_arch transcripti  84.9     1.1 2.3E-05   28.4   2.7   13   21-33     88-100 (104)
144 PF03604 DNA_RNApol_7kD:  DNA d  84.9    0.28   6E-06   25.1  -0.0   25    4-33      3-27  (32)
145 PF09082 DUF1922:  Domain of un  84.7    0.66 1.4E-05   27.8   1.5   28    4-37      6-33  (68)
146 PRK14890 putative Zn-ribbon RN  84.7     1.2 2.7E-05   25.9   2.6    8   24-31      8-15  (59)
147 PF06943 zf-LSD1:  LSD1 zinc fi  84.5     1.1 2.3E-05   21.7   1.9   25    4-32      1-25  (25)
148 PF09986 DUF2225:  Uncharacteri  84.5    0.88 1.9E-05   32.8   2.5   15   23-37      5-19  (214)
149 PRK11827 hypothetical protein;  84.4     1.3 2.8E-05   25.9   2.6   31    3-37     10-40  (60)
150 TIGR00311 aIF-2beta translatio  83.8    0.71 1.5E-05   31.1   1.6   33    3-36     99-131 (133)
151 COG3809 Uncharacterized protei  83.7       1 2.3E-05   27.8   2.1   35    1-37      1-35  (88)
152 PF09538 FYDLN_acid:  Protein o  83.6    0.79 1.7E-05   29.8   1.7   31    2-37     10-40  (108)
153 PF04810 zf-Sec23_Sec24:  Sec23  83.3     0.8 1.7E-05   24.3   1.4   35    2-36      3-37  (40)
154 PRK04136 rpl40e 50S ribosomal   82.9    0.78 1.7E-05   25.6   1.3   23    2-32     15-37  (48)
155 PRK03988 translation initiatio  82.8    0.85 1.8E-05   30.9   1.7   33    3-36    104-136 (138)
156 PRK09521 exosome complex RNA-b  82.4     1.4 3.1E-05   31.0   2.7   28    3-35    151-178 (189)
157 COG2176 PolC DNA polymerase II  82.3     1.6 3.5E-05   39.1   3.5   17   21-37    912-928 (1444)
158 PF06839 zf-GRF:  GRF zinc fing  82.1     3.9 8.4E-05   22.1   3.9   30   70-102     2-31  (45)
159 PRK05582 DNA topoisomerase I;   82.1     2.7 5.8E-05   35.2   4.6   32   68-106   611-643 (650)
160 PF03367 zf-ZPR1:  ZPR1 zinc-fi  81.8     1.2 2.6E-05   30.9   2.2   39   69-110     2-42  (161)
161 PF01783 Ribosomal_L32p:  Ribos  81.7    0.49 1.1E-05   27.1   0.1   21    3-32     28-48  (56)
162 PRK00423 tfb transcription ini  81.6       1 2.2E-05   34.2   1.9   30    2-34     12-41  (310)
163 PF01599 Ribosomal_S27:  Riboso  81.5    0.93   2E-05   25.2   1.2   27    2-32     19-47  (47)
164 PF09723 Zn-ribbon_8:  Zinc rib  81.2    0.75 1.6E-05   24.7   0.8   10   22-31     25-34  (42)
165 PRK00415 rps27e 30S ribosomal   81.2       1 2.2E-05   26.3   1.4   30   67-107    10-39  (59)
166 COG1571 Predicted DNA-binding   81.2    0.87 1.9E-05   36.3   1.4   30    3-37    352-381 (421)
167 COG1545 Predicted nucleic-acid  81.1    0.79 1.7E-05   31.0   1.0   22    3-32     31-52  (140)
168 PF06044 DRP:  Dam-replacing fa  81.1       1 2.2E-05   33.5   1.6   35    2-37     32-67  (254)
169 PF04216 FdhE:  Protein involve  80.8     1.8 3.9E-05   32.4   3.0   36   68-109   172-208 (290)
170 PHA02998 RNA polymerase subuni  80.6     1.5 3.2E-05   31.2   2.2   34    3-36    145-184 (195)
171 PRK03954 ribonuclease P protei  80.1     1.4 3.1E-05   29.3   2.0   33    2-34     65-104 (121)
172 PRK12380 hydrogenase nickel in  80.0    0.76 1.7E-05   30.0   0.7   23    3-31     72-94  (113)
173 COG2835 Uncharacterized conser  79.8     2.4 5.2E-05   24.8   2.6   32    2-37      9-40  (60)
174 TIGR00155 pqiA_fam integral me  79.6     1.8 3.9E-05   34.2   2.7   28    4-33     16-43  (403)
175 PF01667 Ribosomal_S27e:  Ribos  79.6    0.45 9.6E-06   27.4  -0.5   30   67-107     6-35  (55)
176 PF14446 Prok-RING_1:  Prokaryo  79.5     1.5 3.3E-05   25.1   1.7   27    3-35      7-33  (54)
177 TIGR00100 hypA hydrogenase nic  79.5    0.84 1.8E-05   29.8   0.7   23    3-31     72-94  (115)
178 smart00531 TFIIE Transcription  79.4    0.63 1.4E-05   31.6   0.1   30   67-107    98-132 (147)
179 PF14311 DUF4379:  Domain of un  79.4       2 4.4E-05   24.1   2.3    8   69-76     29-36  (55)
180 PRK00464 nrdR transcriptional   79.0     1.8 3.9E-05   29.9   2.3   33    3-35      2-40  (154)
181 TIGR00280 L37a ribosomal prote  78.9     1.7 3.6E-05   27.5   1.9   30    2-35     36-65  (91)
182 PF07191 zinc-ribbons_6:  zinc-  78.5     2.1 4.6E-05   25.8   2.2   24    3-32      3-26  (70)
183 COG5415 Predicted integral mem  78.4    0.99 2.1E-05   32.9   0.9   36   64-107   188-223 (251)
184 PRK14559 putative protein seri  78.0     1.3 2.8E-05   37.1   1.6   11    2-12     16-26  (645)
185 COG1996 RPC10 DNA-directed RNA  78.0     2.2 4.7E-05   24.0   2.0   30    4-37      9-38  (49)
186 PRK12336 translation initiatio  77.9     1.4 3.1E-05   31.5   1.6   34    3-37    100-133 (201)
187 COG0333 RpmF Ribosomal protein  77.9     1.8 3.9E-05   25.0   1.7   25    1-34     27-51  (57)
188 PTZ00255 60S ribosomal protein  77.6     2.2 4.8E-05   26.9   2.2   30    2-35     37-66  (90)
189 PF14354 Lar_restr_allev:  Rest  77.5     5.4 0.00012   22.6   3.7   34   69-106     4-37  (61)
190 PF01927 Mut7-C:  Mut7-C RNAse   76.5     2.4 5.2E-05   28.7   2.3   32    2-33     92-134 (147)
191 PRK15103 paraquat-inducible me  75.4     2.7 5.9E-05   33.4   2.7   27    4-32     13-39  (419)
192 PF13005 zf-IS66:  zinc-finger   75.1     2.7 5.9E-05   22.6   1.9   13    2-14      3-15  (47)
193 smart00778 Prim_Zn_Ribbon Zinc  75.0     3.9 8.4E-05   21.5   2.4   28    4-31      6-33  (37)
194 PRK00564 hypA hydrogenase nick  75.0     1.2 2.7E-05   29.1   0.6   25    3-32     73-97  (117)
195 COG2824 PhnA Uncharacterized Z  74.2     2.9 6.2E-05   27.3   2.1   29    1-34      3-31  (112)
196 PRK00750 lysK lysyl-tRNA synth  74.1     2.6 5.7E-05   34.2   2.3   34    2-36    176-212 (510)
197 PRK03976 rpl37ae 50S ribosomal  73.8     2.7 5.9E-05   26.5   1.8   30    2-35     37-66  (90)
198 PF12677 DUF3797:  Domain of un  73.7     1.9   4E-05   24.2   1.0   12   68-79     13-24  (49)
199 COG4888 Uncharacterized Zn rib  72.9     3.5 7.6E-05   26.6   2.2   33    4-36     25-59  (104)
200 COG1326 Uncharacterized archae  72.4     2.7 5.8E-05   30.2   1.8   33    3-35      8-42  (201)
201 PF05502 Dynactin_p62:  Dynacti  72.4      11 0.00024   30.5   5.5   35    1-36      5-39  (483)
202 PF06044 DRP:  Dam-replacing fa  72.0     2.3   5E-05   31.6   1.4   33   68-108    31-63  (254)
203 PRK03681 hypA hydrogenase nick  71.9     1.8 3.9E-05   28.3   0.8   24    3-31     72-95  (114)
204 PRK09710 lar restriction allev  71.7     8.7 0.00019   22.7   3.6   32   68-108     6-37  (64)
205 PLN00209 ribosomal protein S27  71.6     2.5 5.4E-05   26.5   1.3   30   67-107    35-64  (86)
206 PF01873 eIF-5_eIF-2B:  Domain   70.7     7.2 0.00016   25.9   3.5   30   69-107    94-123 (125)
207 TIGR02300 FYDLN_acid conserved  70.4     3.1 6.8E-05   27.9   1.6   31    2-37     10-40  (129)
208 PTZ00083 40S ribosomal protein  70.4     2.8 6.1E-05   26.2   1.3   30   67-107    34-63  (85)
209 TIGR00311 aIF-2beta translatio  70.1     7.3 0.00016   26.2   3.4   30   69-107    98-127 (133)
210 PF08273 Prim_Zn_Ribbon:  Zinc-  69.6       4 8.7E-05   21.8   1.7   28    4-31      6-34  (40)
211 PF01921 tRNA-synt_1f:  tRNA sy  69.4     1.2 2.6E-05   34.9  -0.6   36    2-37    175-213 (360)
212 COG1656 Uncharacterized conser  68.8     2.6 5.6E-05   29.5   1.0   31    3-34     99-141 (165)
213 PHA02942 putative transposase;  68.7     4.3 9.3E-05   31.8   2.4   29   67-108   324-352 (383)
214 KOG0006 E3 ubiquitin-protein l  68.1      12 0.00026   29.2   4.5   24    5-32    321-345 (446)
215 PRK01110 rpmF 50S ribosomal pr  68.0     3.1 6.6E-05   24.2   1.1   22    2-33     28-49  (60)
216 TIGR02605 CxxC_CxxC_SSSS putat  67.3     2.8 6.1E-05   23.0   0.8   25    3-31      7-34  (52)
217 COG1405 SUA7 Transcription ini  67.0     5.1 0.00011   30.4   2.4   31    2-35      2-32  (285)
218 PRK03988 translation initiatio  66.0      10 0.00022   25.7   3.5   30   69-107   103-132 (138)
219 TIGR00467 lysS_arch lysyl-tRNA  65.8     5.5 0.00012   32.6   2.5   34    2-36    169-203 (515)
220 PF04828 GFA:  Glutathione-depe  65.3     1.6 3.5E-05   26.2  -0.5   13    2-14     49-61  (92)
221 COG3791 Uncharacterized conser  64.5       3 6.5E-05   27.8   0.7   13    2-14     70-82  (133)
222 COG0675 Transposase and inacti  64.3     5.7 0.00012   29.2   2.2   26   66-108   307-332 (364)
223 COG4416 Com Mu-like prophage p  64.3     1.8   4E-05   24.8  -0.3   32    3-36      6-37  (60)
224 KOG1842 FYVE finger-containing  63.7     1.6 3.5E-05   35.1  -0.8   25    2-32    181-205 (505)
225 PF01921 tRNA-synt_1f:  tRNA sy  63.3     6.9 0.00015   30.7   2.5   35   67-108   173-209 (360)
226 PRK06266 transcription initiat  62.9     1.6 3.4E-05   30.8  -1.0   30   67-107   116-145 (178)
227 PRK12495 hypothetical protein;  62.7     6.6 0.00014   28.8   2.2   27    2-34     43-69  (226)
228 TIGR03037 anthran_nbaC 3-hydro  62.6     7.2 0.00016   27.1   2.3   15   19-33    110-124 (159)
229 PF03966 Trm112p:  Trm112p-like  62.0     6.4 0.00014   23.0   1.7   17   21-37     51-67  (68)
230 PF08882 Acetone_carb_G:  Aceto  61.7     3.3 7.1E-05   27.2   0.4   12    3-14     76-87  (112)
231 PF05191 ADK_lid:  Adenylate ki  61.2     1.3 2.9E-05   23.1  -1.2    8   25-32      3-10  (36)
232 TIGR01562 FdhE formate dehydro  61.1     6.4 0.00014   30.1   2.0   38   68-109   184-221 (305)
233 COG1499 NMD3 NMD protein affec  61.1     7.2 0.00016   30.5   2.3   23   68-90    129-153 (355)
234 TIGR02820 formald_GSH S-(hydro  60.6     4.2 9.2E-05   28.8   0.9   13    2-14     90-102 (182)
235 cd00674 LysRS_core_class_I cat  60.1     7.4 0.00016   30.3   2.2   34   67-107   168-201 (353)
236 TIGR01405 polC_Gram_pos DNA po  59.9     6.5 0.00014   35.4   2.1   17   21-37    681-697 (1213)
237 PF02132 RecR:  RecR protein;    59.9     2.4 5.3E-05   22.5  -0.3   10    2-11     18-27  (41)
238 PF11672 DUF3268:  Protein of u  59.5     9.9 0.00022   24.5   2.4   33   69-105     3-38  (102)
239 PRK05417 glutathione-dependent  59.1     4.5 9.8E-05   28.9   0.8   14    2-15     94-107 (191)
240 PRK00448 polC DNA polymerase I  59.0     6.9 0.00015   35.9   2.1   17   21-37    906-922 (1437)
241 PF00628 PHD:  PHD-finger;  Int  58.4      16 0.00034   19.7   2.8   26    3-35      1-26  (51)
242 PRK13264 3-hydroxyanthranilate  58.1     8.8 0.00019   27.2   2.1   15   19-33    116-130 (177)
243 PF08063 PADR1:  PADR1 (NUC008)  58.1     3.6 7.8E-05   23.5   0.2   19    3-27     16-35  (55)
244 TIGR00467 lysS_arch lysyl-tRNA  58.0      11 0.00025   30.8   3.0   33   67-107   167-199 (515)
245 smart00531 TFIIE Transcription  57.3     3.9 8.4E-05   27.7   0.2   21   87-109    90-110 (147)
246 smart00653 eIF2B_5 domain pres  57.0      20 0.00042   23.3   3.5   30   69-107    81-110 (110)
247 PF01155 HypA:  Hydrogenase exp  56.2     1.4   3E-05   28.6  -2.0   23    3-31     72-94  (113)
248 PRK14973 DNA topoisomerase I;   55.6     6.8 0.00015   34.4   1.5   33    3-37    637-671 (936)
249 PRK12336 translation initiatio  55.5      18  0.0004   25.8   3.5   30   69-107    99-128 (201)
250 COG3877 Uncharacterized protei  55.5     9.7 0.00021   24.9   1.8   23    3-33      8-30  (122)
251 COG3364 Zn-ribbon containing p  55.4       7 0.00015   25.4   1.2   20   70-89     22-41  (112)
252 PF00130 C1_1:  Phorbol esters/  54.8      11 0.00024   20.5   1.8   28    2-34     12-39  (53)
253 PF10005 DUF2248:  Uncharacteri  54.3     6.5 0.00014   30.6   1.0   25    4-36      2-26  (343)
254 PRK00222 methionine sulfoxide   54.2      13 0.00029   25.3   2.5   18   64-81     88-106 (142)
255 COG4647 AcxC Acetone carboxyla  53.9     5.4 0.00012   27.1   0.5   12    3-14    122-133 (165)
256 cd02673 Peptidase_C19Q A subfa  53.7      13 0.00029   27.2   2.6   16   22-37     80-95  (245)
257 COG3677 Transposase and inacti  53.3      11 0.00024   25.1   2.0   39   64-109    26-64  (129)
258 PRK05978 hypothetical protein;  53.3     6.9 0.00015   26.9   0.9   31   67-108    32-62  (148)
259 TIGR00373 conserved hypothetic  53.1     7.4 0.00016   26.8   1.1   13   94-108   107-119 (158)
260 cd04476 RPA1_DBD_C RPA1_DBD_C:  53.0      10 0.00022   25.8   1.8   26    3-33     36-61  (166)
261 TIGR00357 methionine-R-sulfoxi  52.9      13 0.00028   25.2   2.2   18   64-81     85-103 (134)
262 KOG3362 Predicted BBOX Zn-fing  52.5     4.1 8.9E-05   28.0  -0.3   21    2-33    119-139 (156)
263 KOG1812 Predicted E3 ubiquitin  52.1     8.5 0.00018   30.3   1.4   25    3-32    308-332 (384)
264 COG1552 RPL40A Ribosomal prote  51.8     2.6 5.7E-05   23.6  -1.1   23    4-34     17-39  (50)
265 COG2995 PqiA Uncharacterized p  51.7      10 0.00022   30.2   1.7   31    3-35     20-50  (418)
266 TIGR01051 topA_bact DNA topois  51.1      12 0.00027   31.0   2.3   31   69-107   575-606 (610)
267 PRK13130 H/ACA RNA-protein com  50.9     8.3 0.00018   22.2   0.9   22    1-32      5-26  (56)
268 PF04438 zf-HIT:  HIT zinc fing  50.8       8 0.00017   19.2   0.7   18    3-31      4-21  (30)
269 PF13824 zf-Mss51:  Zinc-finger  50.7      11 0.00024   21.6   1.3   25    3-34      1-25  (55)
270 cd00029 C1 Protein kinase C co  50.1      13 0.00029   19.6   1.6   28    2-34     12-39  (50)
271 PRK05508 methionine sulfoxide   49.7      21 0.00046   23.6   2.8   18   64-81     75-93  (119)
272 COG0375 HybF Zn finger protein  49.0      11 0.00023   24.9   1.3   22    4-31     73-94  (115)
273 KOG3799 Rab3 effector RIM1 and  48.9     8.6 0.00019   26.3   0.8   31    1-35     89-119 (169)
274 PF11331 DUF3133:  Protein of u  48.8      15 0.00032   20.3   1.6   31    3-33      8-41  (46)
275 COG1545 Predicted nucleic-acid  48.7      16 0.00036   24.6   2.2   30   68-97     43-73  (140)
276 PF04194 PDCD2_C:  Programmed c  48.6      20 0.00042   24.7   2.6   35   69-104    98-145 (164)
277 PF14690 zf-ISL3:  zinc-finger   48.4       7 0.00015   20.8   0.3   12   69-80      3-14  (47)
278 TIGR03831 YgiT_finger YgiT-typ  48.0      21 0.00046   18.5   2.2    8   69-76     33-40  (46)
279 COG1571 Predicted DNA-binding   47.8      11 0.00023   30.3   1.3   29   68-109   350-378 (421)
280 TIGR03830 CxxCG_CxxCG_HTH puta  47.1      23  0.0005   22.6   2.7    6   70-75     33-38  (127)
281 PRK00762 hypA hydrogenase nick  47.0     9.3  0.0002   25.2   0.8   28    3-31     72-100 (124)
282 KOG1311 DHHC-type Zn-finger pr  47.0     8.3 0.00018   28.8   0.6   29    1-37    113-141 (299)
283 KOG2767 Translation initiation  46.9     8.4 0.00018   30.3   0.6   31   69-107    97-127 (400)
284 PF13909 zf-H2C2_5:  C2H2-type   45.9      13 0.00029   16.8   1.0   11   24-34      1-11  (24)
285 PRK06266 transcription initiat  45.8      11 0.00024   26.5   1.0   19   89-109   110-128 (178)
286 smart00109 C1 Protein kinase C  45.8      14  0.0003   19.3   1.2   26    2-33     12-37  (49)
287 PF15135 UPF0515:  Uncharacteri  44.9      12 0.00025   28.1   1.1   61   22-85    111-172 (278)
288 KOG2462 C2H2-type Zn-finger pr  44.8      14 0.00029   28.0   1.4   18   85-108   236-253 (279)
289 PRK08351 DNA-directed RNA poly  44.8      16 0.00034   21.4   1.4   25    3-37      5-29  (61)
290 PF14952 zf-tcix:  Putative tre  44.8      10 0.00022   20.7   0.6   27   69-109    12-38  (44)
291 PF02591 DUF164:  Putative zinc  44.8     7.4 0.00016   21.9   0.0   29    3-31     24-54  (56)
292 PRK12366 replication factor A;  44.1      13 0.00028   31.1   1.4   24    3-32    534-557 (637)
293 PF08646 Rep_fac-A_C:  Replicat  43.5      18 0.00039   24.1   1.8   25    4-33     21-47  (146)
294 COG1885 Uncharacterized protei  43.4      22 0.00048   23.2   2.1   16   68-83     49-65  (115)
295 COG2093 DNA-directed RNA polym  43.0      18 0.00039   21.4   1.4   27    3-37      6-32  (64)
296 smart00532 LIGANc Ligase N fam  42.6      18 0.00039   29.1   1.9   26    2-31    400-427 (441)
297 PF07649 C1_3:  C1-like domain;  42.1      20 0.00044   17.3   1.4   12   22-33     14-25  (30)
298 PRK03564 formate dehydrogenase  42.0      24 0.00052   27.1   2.4   36   68-109   187-223 (309)
299 PRK08402 replication factor A;  41.7      18 0.00038   28.3   1.7   26    3-32    214-239 (355)
300 PRK04023 DNA polymerase II lar  41.3      19 0.00042   32.1   2.0   14   24-37    664-677 (1121)
301 PRK07218 replication factor A;  41.1      14  0.0003   29.6   1.0   25    3-37    299-323 (423)
302 PRK07561 DNA topoisomerase I s  41.0      32 0.00068   29.9   3.2   23    3-27    589-611 (859)
303 TIGR01057 topA_arch DNA topois  40.9      21 0.00046   29.7   2.2   26   68-101   589-614 (618)
304 PF01641 SelR:  SelR domain;  I  40.7      12 0.00027   24.9   0.6   18   64-81     82-100 (124)
305 cd00974 DSRD Desulforedoxin (D  40.6      18 0.00039   18.1   1.1   11   95-107     3-13  (34)
306 smart00547 ZnF_RBZ Zinc finger  40.4      16 0.00034   16.9   0.8   11    4-14      5-15  (26)
307 PF09845 DUF2072:  Zn-ribbon co  40.2      20 0.00043   24.2   1.6   20   70-89     21-40  (131)
308 TIGR00319 desulf_FeS4 desulfof  40.1      19 0.00041   18.0   1.1   11   95-107     6-16  (34)
309 COG3880 Modulator of heat shoc  39.1      22 0.00047   25.1   1.7   33   70-106     2-34  (176)
310 cd02674 Peptidase_C19R A subfa  38.9      77  0.0017   22.0   4.6   17   21-37     49-65  (230)
311 PF05180 zf-DNL:  DNL zinc fing  38.9      12 0.00026   22.3   0.3   33   69-106     5-37  (66)
312 PRK14810 formamidopyrimidine-D  38.8      40 0.00087   25.1   3.2   30   66-105   242-271 (272)
313 PRK07220 DNA topoisomerase I;   38.4      28 0.00061   29.7   2.5   31    3-34    637-668 (740)
314 PRK00750 lysK lysyl-tRNA synth  38.3      39 0.00084   27.6   3.2   36   67-108   174-209 (510)
315 smart00401 ZnF_GATA zinc finge  37.7      21 0.00046   19.8   1.2   34   68-109     3-36  (52)
316 PRK08579 anaerobic ribonucleos  37.3      17 0.00037   30.6   1.0   22    2-31    569-590 (625)
317 PF06750 DiS_P_DiS:  Bacterial   36.9      16 0.00035   22.9   0.7   31    3-33     35-68  (92)
318 PF00096 zf-C2H2:  Zinc finger,  36.8      22 0.00048   15.6   1.0   11   97-109     1-11  (23)
319 PRK01103 formamidopyrimidine/5  36.8      55  0.0012   24.3   3.7   30   67-106   244-273 (274)
320 PF06573 Churchill:  Churchill   36.7      33 0.00072   22.4   2.1   10   68-77     58-67  (112)
321 PF10825 DUF2752:  Protein of u  36.0     2.4 5.1E-05   23.9  -2.9   19   67-85      8-26  (52)
322 PRK14811 formamidopyrimidine-D  35.7      51  0.0011   24.5   3.3   30   67-106   234-263 (269)
323 PF14369 zf-RING_3:  zinc-finge  35.6      30 0.00064   17.7   1.5   27    2-31      3-29  (35)
324 PHA02325 hypothetical protein   35.4      43 0.00093   19.9   2.3   23   68-90      3-28  (72)
325 COG1601 GCD7 Translation initi  35.0     8.3 0.00018   26.6  -0.9   33    3-36    107-139 (151)
326 PF07975 C1_4:  TFIIH C1-like d  34.9      16 0.00036   20.5   0.4   30    4-33      2-31  (51)
327 PF07503 zf-HYPF:  HypF finger;  34.5     5.7 0.00012   20.6  -1.4   28    4-31      2-29  (35)
328 PF13894 zf-C2H2_4:  C2H2-type   34.4      26 0.00057   15.0   1.1   11   97-109     1-11  (24)
329 COG0229 Conserved domain frequ  34.2      38 0.00082   23.1   2.2   18   64-81     87-105 (140)
330 PF09463 Opy2:  Opy2 protein;    34.1      42 0.00092   17.4   1.9   17   70-86     10-26  (35)
331 PF14169 YdjO:  Cold-inducible   33.6      36 0.00078   19.8   1.7   26   80-105     2-27  (59)
332 KOG2767 Translation initiation  33.5      13 0.00029   29.2  -0.1   32    3-37     98-132 (400)
333 PRK06260 threonine synthase; V  33.2      25 0.00054   27.5   1.4   23    3-31      5-27  (397)
334 KOG4537 Zn-ribbon-containing p  33.2      11 0.00023   26.4  -0.6   26    3-33     42-67  (178)
335 PF06397 Desulfoferrod_N:  Desu  33.1      26 0.00055   18.3   1.0   12   94-107     4-15  (36)
336 TIGR00375 conserved hypothetic  32.9      15 0.00032   28.9   0.1   27    2-32    241-267 (374)
337 PRK04351 hypothetical protein;  32.6      33 0.00072   23.4   1.7   13   21-33    110-122 (149)
338 PRK13945 formamidopyrimidine-D  32.5      64  0.0014   24.1   3.4   29   67-105   253-281 (282)
339 PF01020 Ribosomal_L40e:  Ribos  32.3      10 0.00022   21.5  -0.7   24    3-34     19-44  (52)
340 PRK08329 threonine synthase; V  32.3      36 0.00079   26.1   2.1   24    1-32      1-24  (347)
341 COG1655 Uncharacterized protei  32.1      23 0.00049   26.4   0.9   15   23-37     19-33  (267)
342 PRK10445 endonuclease VIII; Pr  31.9      77  0.0017   23.5   3.7   29   67-105   234-262 (263)
343 PF06200 tify:  tify domain;  I  31.7      35 0.00075   17.8   1.3    7   91-97      6-12  (36)
344 PF13913 zf-C2HC_2:  zinc-finge  31.4      25 0.00053   16.5   0.7    8   69-76      3-10  (25)
345 PF01529 zf-DHHC:  DHHC palmito  31.0      27 0.00058   23.5   1.1   26    2-35     49-74  (174)
346 COG1384 LysS Lysyl-tRNA synthe  30.8      78  0.0017   26.2   3.8   33   67-107   170-203 (521)
347 cd02249 ZZ Zinc finger, ZZ typ  30.8      59  0.0013   17.3   2.3   21    3-31      2-22  (46)
348 PRK08173 DNA topoisomerase III  30.8      36 0.00078   29.7   2.0   25    3-33    626-650 (862)
349 COG1675 TFA1 Transcription ini  30.7      21 0.00045   25.2   0.5   12    3-14    134-145 (176)
350 PF01363 FYVE:  FYVE zinc finge  30.6      54  0.0012   18.7   2.3   26    3-34     11-36  (69)
351 KOG2703 C4-type Zn-finger prot  30.5      42 0.00091   27.0   2.2   10   70-79     70-79  (460)
352 KOG3092 Casein kinase II, beta  30.2      22 0.00047   25.8   0.5   12    3-14    136-147 (216)
353 TIGR00354 polC DNA polymerase,  30.2      26 0.00057   31.1   1.1   22   68-107   625-646 (1095)
354 TIGR00577 fpg formamidopyrimid  29.8      82  0.0018   23.4   3.6   28   67-104   244-271 (272)
355 PF00320 GATA:  GATA zinc finge  29.4     8.4 0.00018   19.8  -1.3   31   71-109     1-31  (36)
356 COG5349 Uncharacterized protei  29.3      23 0.00049   23.7   0.5   12   68-79     21-32  (126)
357 PRK08271 anaerobic ribonucleos  28.6      30 0.00065   29.1   1.1   22    2-31    567-588 (623)
358 PRK06393 rpoE DNA-directed RNA  28.5      29 0.00062   20.5   0.7   21    3-33      7-27  (64)
359 KOG4323 Polycomb-like PHD Zn-f  28.4      23  0.0005   28.8   0.4   33    1-33    185-225 (464)
360 PF14255 Cys_rich_CPXG:  Cystei  28.0      46   0.001   18.7   1.5   29    3-31      2-32  (52)
361 PF11023 DUF2614:  Protein of u  27.9      26 0.00057   23.0   0.6   12   67-78     68-79  (114)
362 PF03107 C1_2:  C1 domain;  Int  27.9      75  0.0016   15.3   2.2   23    4-33      3-25  (30)
363 PF02148 zf-UBP:  Zn-finger in   27.7      40 0.00087   19.2   1.3   16   21-36      9-24  (63)
364 smart00064 FYVE Protein presen  27.6      41 0.00089   19.2   1.3   25    2-32     11-35  (68)
365 PRK06599 DNA topoisomerase I;   27.5      60  0.0013   27.4   2.7    7   25-31    639-645 (675)
366 PF05495 zf-CHY:  CHY zinc fing  27.5      33 0.00072   20.3   0.9   14   23-36     41-54  (71)
367 COG3024 Uncharacterized protei  27.4      36 0.00077   20.2   1.0   14   66-79      5-18  (65)
368 TIGR03829 YokU_near_AblA uncha  27.4      89  0.0019   19.6   2.9    8   69-76     36-43  (89)
369 smart00249 PHD PHD zinc finger  27.3      57  0.0012   16.3   1.8   25    3-34      1-25  (47)
370 KOG3214 Uncharacterized Zn rib  27.2      34 0.00073   22.1   1.0   30    4-33     26-57  (109)
371 PF06906 DUF1272:  Protein of u  26.9      35 0.00075   19.7   0.9   10   68-77     41-50  (57)
372 PRK11088 rrmA 23S rRNA methylt  26.6      60  0.0013   23.7   2.4   28    2-36      3-30  (272)
373 PRK14018 trifunctional thiored  26.5      67  0.0014   26.5   2.8   18   64-81    463-481 (521)
374 KOG0402 60S ribosomal protein   26.4      34 0.00074   21.4   0.9   29    3-35     38-66  (92)
375 COG1579 Zn-ribbon protein, pos  26.3      20 0.00042   26.6  -0.3    8   23-30    221-228 (239)
376 TIGR03826 YvyF flagellar opero  26.2      20 0.00044   24.3  -0.2   26    1-33      3-28  (137)
377 KOG0696 Serine/threonine prote  26.0      13 0.00027   30.5  -1.4   25    2-31    122-146 (683)
378 PF14787 zf-CCHC_5:  GAG-polypr  26.0      34 0.00073   17.9   0.7   10   70-79      4-13  (36)
379 PF06353 DUF1062:  Protein of u  25.8      38 0.00083   23.0   1.1   16   21-36     11-26  (142)
380 PF15499 Peptidase_C98:  Ubiqui  25.8      59  0.0013   24.6   2.2   12   23-34    134-145 (275)
381 COG2260 Predicted Zn-ribbon RN  25.5      35 0.00076   19.8   0.7   12   68-79     17-28  (59)
382 PHA02611 51 baseplate hub asse  25.1      54  0.0012   24.5   1.8   17   68-84     82-98  (249)
383 COG0272 Lig NAD-dependent DNA   25.0      50  0.0011   28.1   1.8   27    2-32    405-434 (667)
384 COG5273 Uncharacterized protei  24.8      29 0.00064   26.5   0.5   26    2-35    110-135 (309)
385 smart00154 ZnF_AN1 AN1-like Zi  24.4      71  0.0015   16.6   1.8   11   23-33     12-22  (39)
386 KOG2463 Predicted RNA-binding   24.2      91   0.002   24.5   2.9   17   68-84    257-273 (376)
387 COG1379 PHP family phosphoeste  24.2      20 0.00044   28.1  -0.6   26    4-32    249-274 (403)
388 COG3529 Predicted nucleic-acid  24.1      23  0.0005   20.8  -0.2   35    3-37     12-46  (66)
389 PF13465 zf-H2C2_2:  Zinc-finge  23.5      51  0.0011   15.3   1.0   11   97-109    15-25  (26)
390 PHA02540 61 DNA primase; Provi  23.4 1.1E+02  0.0023   23.8   3.3   33   67-106    26-63  (337)
391 cd00065 FYVE FYVE domain; Zinc  23.1      60  0.0013   17.6   1.4   25    2-32      3-27  (57)
392 smart00782 PhnA_Zn_Ribbon PhnA  22.8 1.1E+02  0.0025   16.7   2.5   40   65-106     4-44  (47)
393 cd01675 RNR_III Class III ribo  22.6      58  0.0013   26.9   1.8   14   69-82    533-546 (555)
394 smart00746 TRASH metallochaper  22.6      66  0.0014   14.5   1.4    9    4-12      1-9   (39)
395 COG4469 CoiA Competence protei  22.6      38 0.00082   26.4   0.6   13    2-14     26-38  (342)
396 PF08209 Sgf11:  Sgf11 (transcr  22.5      83  0.0018   16.0   1.7   14   22-35      3-16  (33)
397 PF13878 zf-C2H2_3:  zinc-finge  22.3      44 0.00095   17.6   0.7    8   68-75     13-20  (41)
398 cd02337 ZZ_CBP Zinc finger, ZZ  22.2      86  0.0019   16.5   1.8    9   22-30     12-20  (41)
399 COG3357 Predicted transcriptio  22.2      36 0.00079   21.6   0.4   12   24-35     59-70  (97)
400 PRK07111 anaerobic ribonucleos  22.0      47   0.001   28.5   1.2   21    2-31    681-701 (735)
401 COG1107 Archaea-specific RecJ-  21.7 2.8E+02   0.006   23.8   5.4   31    1-37      2-32  (715)
402 PF12387 Peptidase_C74:  Pestiv  21.6      47   0.001   23.6   0.9   11   68-78    175-185 (200)
403 PRK14714 DNA polymerase II lar  21.6      55  0.0012   30.0   1.5   22    3-33    681-702 (1337)
404 PF10601 zf-LITAF-like:  LITAF-  21.5      54  0.0012   19.2   1.1   17   65-81     55-71  (73)
405 PLN00162 transport protein sec  21.5      54  0.0012   28.2   1.4   35    3-37     55-89  (761)
406 PF02701 zf-Dof:  Dof domain, z  21.5      79  0.0017   18.6   1.7   35   68-109     5-41  (63)
407 PF15616 TerY-C:  TerY-C metal   21.5      77  0.0017   21.3   1.9   13   23-35    105-117 (131)
408 PF13597 NRDD:  Anaerobic ribon  21.4      52  0.0011   27.1   1.3   16   68-83    504-519 (546)
409 PF02012 BNR:  BNR/Asp-box repe  21.4      32 0.00069   13.6   0.0    8   87-94      2-9   (12)
410 KOG4080 Mitochondrial ribosoma  21.3      42  0.0009   23.7   0.6   10   69-78     94-103 (176)
411 PRK07591 threonine synthase; V  21.2      55  0.0012   25.9   1.3   22    3-31     20-41  (421)
412 PF06170 DUF983:  Protein of un  21.1      51  0.0011   20.4   0.9   13   67-79      7-19  (86)
413 smart00290 ZnF_UBP Ubiquitin C  20.9   1E+02  0.0022   16.3   2.0   13   23-35     11-23  (50)
414 PRK07225 DNA-directed RNA poly  20.7      49  0.0011   27.8   1.0   27    2-32    545-571 (605)
415 PRK09263 anaerobic ribonucleos  20.6      96  0.0021   26.6   2.7   28    2-33    642-669 (711)
416 PF14835 zf-RING_6:  zf-RING of  20.5      57  0.0012   19.3   1.0   12    3-14      9-20  (65)
417 PF10080 DUF2318:  Predicted me  20.4      79  0.0017   20.3   1.7   30    3-37     37-66  (102)
418 TIGR02827 RNR_anaer_Bdell anae  20.4      73  0.0016   26.7   1.9   14   69-82    547-560 (586)
419 PRK06599 DNA topoisomerase I;   20.2      82  0.0018   26.6   2.2   31   69-107   638-669 (675)

No 1  
>KOG2906 consensus RNA polymerase III subunit C11 [Transcription]
Probab=100.00  E-value=1.5e-46  Score=236.93  Aligned_cols=104  Identities=49%  Similarity=0.940  Sum_probs=97.8

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCCceEEEEecccCccccccccccccccC-CCCCcccCCCCCCCce
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMME-GPQTEVTCPACKHGKA   79 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~CpkCg~~~a   79 (110)
                      |.|||.|||||.++  ++....+|.|++|+|..++..  .|.++..+..|++++|++++.+|+ .+.+++.||+|||++|
T Consensus         1 m~FCP~Cgn~Live--~g~~~~rf~C~tCpY~~~I~~--ei~~r~~~~~Kevd~vlgg~~a~~nv~~t~~~Cp~Cgh~ra   76 (105)
T KOG2906|consen    1 MLFCPTCGNMLIVE--SGESCNRFSCRTCPYVFPISR--EISSRKYPKLKEVDDVLGGDEAWENVDQTEATCPTCGHERA   76 (105)
T ss_pred             CcccCCCCCEEEEe--cCCeEeeEEcCCCCceeeEee--eeeccccCchhhhhhhcCCcccccchhhccCcCCCCCCCce
Confidence            89999999999999  555578999999999999987  788888889999999999988898 8899999999999999


Q ss_pred             EEEEeccCCCCCCceEEEEecCCCCCccccC
Q 033869           80 VYHELQTRSADEPMSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        80 ~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wre  110 (110)
                      +|+|+|+||||||||+||.|++  |+|+|||
T Consensus        77 yF~qlQtRSADEPmT~FYkC~~--C~~~Wre  105 (105)
T KOG2906|consen   77 YFMQLQTRSADEPMTTFYKCCK--CKHRWRE  105 (105)
T ss_pred             EEEEeeeccCCCcHhHhhhhhc--ccccccC
Confidence            9999999999999999999999  9999997


No 2  
>KOG2691 consensus RNA polymerase II subunit 9 [Transcription]
Probab=100.00  E-value=2.9e-41  Score=216.02  Aligned_cols=108  Identities=34%  Similarity=0.682  Sum_probs=94.0

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCCceEEEEecccCccccccccccccccC-CCC-CcccCCCCCCCc
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMME-GPQ-TEVTCPACKHGK   78 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~-~~~~CpkCg~~~   78 (110)
                      ++||++|||||||+||+.++.+.|+||+|.|++.++++...+.....+.++.+.++.+...+| +|+ .++.||+|||++
T Consensus         4 ~rfC~eCNNmLYPkEDked~~L~laCrnCd~ve~A~s~~vY~~~~~~e~dE~t~ii~Dl~~DPTLPrts~~~C~~C~~~e   83 (113)
T KOG2691|consen    4 IRFCRECNNMLYPKEDKEDRILLLACRNCDYVEEADSSRVYVNELSHEHDELTQIIMDLASDPTLPRTSDKHCPKCGHRE   83 (113)
T ss_pred             cchhhhhhccccccccccccEEEEEecCCcceEecCCcceEcCCcccchhhHHHHHHhhccCCCcCccccccCCccCCcc
Confidence            589999999999999999999999999999999999943333334445567666665556678 998 589999999999


Q ss_pred             eEEEEeccCCCCCCceEEEEecCCCCCccccC
Q 033869           79 AVYHELQTRSADEPMSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        79 a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wre  110 (110)
                      |+|||.|+|.||++|++||+|++  |+|+|+|
T Consensus        84 avffQ~~~~r~d~~m~l~yvC~~--C~h~wte  113 (113)
T KOG2691|consen   84 AVFFQAQTRRADEAMRLFYVCCS--CGHRWTE  113 (113)
T ss_pred             eEEEecccccccceEEEEEEecc--ccccccC
Confidence            99999999999999999999999  9999986


No 3  
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=100.00  E-value=7.4e-39  Score=210.38  Aligned_cols=104  Identities=35%  Similarity=0.726  Sum_probs=78.1

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCCceEEEEeccc----C-ccccccccc-cccccC-CCCCcccCCC
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMESRVKIKRKQPL----S-KKEIQPIFT-QDAMME-GPQTEVTCPA   73 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~~~~~~~~~~~----~-~~~~~~~~~-~~~~~~-~~~~~~~Cpk   73 (110)
                      |+|||+|||||+|+  ++..+..++|++|||..++...  .+++...    . .+.+..+.. .....+ +++..+.||+
T Consensus         2 m~FCp~Cgsll~p~--~~~~~~~l~C~kCgye~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Cpk   77 (113)
T COG1594           2 MRFCPKCGSLLYPK--KDDEGGKLVCRKCGYEEEASNK--KVYRYSVKEAVEKKKEVVLVVEDETQGAKTLPTAKEKCPK   77 (113)
T ss_pred             ccccCCccCeeEEe--EcCCCcEEECCCCCcchhcccc--ceeEEEEeeccCCcceeeeeecccccCccccccccccCCC
Confidence            89999999999999  4333559999999999999872  2222221    1 111111111 111223 5566889999


Q ss_pred             CCCCceEEEEeccCCCCCCceEEEEecCCCCCccccC
Q 033869           74 CKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        74 Cg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wre  110 (110)
                      ||+++|+|||+|+||||||||+||+|++  |||+||+
T Consensus        78 Cg~~ea~y~~~QtRsaDEp~T~Fy~C~~--Cg~~wre  112 (113)
T COG1594          78 CGNKEAYYWQLQTRSADEPETRFYKCTR--CGYRWRE  112 (113)
T ss_pred             CCCceeEEEeeehhccCCCceEEEEecc--cCCEeec
Confidence            9999999999999999999999999999  9999996


No 4  
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=100.00  E-value=1e-38  Score=206.81  Aligned_cols=101  Identities=36%  Similarity=0.755  Sum_probs=80.1

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCCceEEEEecccCccccccccccccccC-CCCCcccCCCCCCCceE
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMME-GPQTEVTCPACKHGKAV   80 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~CpkCg~~~a~   80 (110)
                      .|||+||+||++.  .    ..+.|+.|+|.+.......++++..++.+..++++..++..+ +|++++.||+|||++|+
T Consensus         1 ~fC~~Cg~~l~~~--~----~~~~C~~C~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Cp~Cg~~~a~   74 (104)
T TIGR01384         1 KFCPKCGSLMTPK--N----GVYVCPSCGYEKEKKPEDDYKVTEKVKHKIKETIIIREEDSETLPTTRVECPKCGHKEAY   74 (104)
T ss_pred             CCCcccCcccccC--C----CeEECcCCCCccccccccccEEEEEeccccccceeeccccccCCCcccCCCCCCCCCeeE
Confidence            5999999999887  2    389999999998875222455555554443333322333336 89999999999999999


Q ss_pred             EEEeccCCCCCCceEEEEecCCCCCccccC
Q 033869           81 YHELQTRSADEPMSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        81 ~~~~Q~RsaDE~~T~fY~C~~~~C~~~wre  110 (110)
                      |||+|+||||||||+||+|++  |+|+||+
T Consensus        75 f~~~Q~RsadE~~T~fy~C~~--C~~~w~~  102 (104)
T TIGR01384        75 YWLLQTRRADEPETRFYKCTK--CGYVWRE  102 (104)
T ss_pred             EEEeccCCCCCCcEEEEEeCC--CCCeeEe
Confidence            999999999999999999999  9999996


No 5  
>KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12 [Transcription]
Probab=99.97  E-value=3.5e-33  Score=180.26  Aligned_cols=104  Identities=28%  Similarity=0.578  Sum_probs=76.2

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCCce-EEE-EecccCccccccccc-cccccC-CCCCcccCCCCCC
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMESRV-KIK-RKQPLSKKEIQPIFT-QDAMME-GPQTEVTCPACKH   76 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~~~-~~~-~~~~~~~~~~~~~~~-~~~~~~-~~~~~~~CpkCg~   76 (110)
                      +.||+.||+||+.+  .  ......|..|+..++.+... ..+ .+..+.......... ...... +|+++++||||||
T Consensus         7 ~~FC~~CG~ll~~~--~--~~~~~~C~~Ck~~~~v~~~~~~~v~~~~~~~~~~~A~~~~ve~~~~~~ga~I~~kCpkCgh   82 (116)
T KOG2907|consen    7 LDFCSDCGSLLEEP--S--AQSTVLCIRCKIEYPVSQFSGLVVETKSLFDEFTSALAEKVENESSADGAVIKHKCPKCGH   82 (116)
T ss_pred             cchhhhhhhhcccc--c--ccCceEeccccccCCHHHhCCeeEEEEEeecccchhhhhhhcccccccccchhccCcccCC
Confidence            46999999999998  3  35577899999988876521 222 222222211111111 111223 8999999999999


Q ss_pred             CceEEEEeccCCCCCCceEEEEecCCCCCccccC
Q 033869           77 GKAVYHELQTRSADEPMSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        77 ~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wre  110 (110)
                      ++|.|.++|+||||||+|+||+|++  |+|++++
T Consensus        83 e~m~Y~T~QlRSADEGQTVFYTC~k--C~~k~~e  114 (116)
T KOG2907|consen   83 EEMSYHTLQLRSADEGQTVFYTCPK--CKYKFTE  114 (116)
T ss_pred             chhhhhhhhcccccCCceEEEEcCc--cceeeec
Confidence            9999999999999999999999999  9999875


No 6  
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=99.93  E-value=9.2e-27  Score=127.11  Aligned_cols=40  Identities=55%  Similarity=1.262  Sum_probs=38.5

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCccccC
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wre  110 (110)
                      .+||+|||++|+|||+|+||||||||+||+|++  |+|+|++
T Consensus         1 ~~Cp~C~~~~a~~~q~Q~RsaDE~mT~fy~C~~--C~~~w~~   40 (40)
T smart00440        1 APCPKCGNREATFFQLQTRSADEPMTVFYVCTK--CGHRWRE   40 (40)
T ss_pred             CcCCCCCCCeEEEEEEcccCCCCCCeEEEEeCC--CCCEeCC
Confidence            379999999999999999999999999999999  9999986


No 7  
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=99.92  E-value=2e-25  Score=121.22  Aligned_cols=39  Identities=59%  Similarity=1.382  Sum_probs=35.0

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      .+||+|||++|+|+|+|+||||||||+||+|.+  |+|+||
T Consensus         1 ~~Cp~Cg~~~a~~~~~Q~rsaDE~~T~fy~C~~--C~~~wr   39 (39)
T PF01096_consen    1 IKCPKCGHNEAVFFQIQTRSADEPMTLFYVCCN--CGHRWR   39 (39)
T ss_dssp             S--SSS-SSEEEEEEESSSSSSSSSEEEEEESS--STEEEE
T ss_pred             CCCcCCCCCeEEEEEeeccCCCCCCeEEEEeCC--CCCeeC
Confidence            479999999999999999999999999999999  999997


No 8  
>PHA02998 RNA polymerase subunit; Provisional
Probab=99.84  E-value=1.8e-21  Score=135.08  Aligned_cols=44  Identities=32%  Similarity=0.613  Sum_probs=42.6

Q ss_pred             CCC-CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           64 GPQ-TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        64 ~~~-~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      +|+ +++.||+|||++|+|||+|+||||||||+||.|.+  |||+|+
T Consensus       138 lpkkt~v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~--CG~~wk  182 (195)
T PHA02998        138 LDEKYNTPCPNCKSKNTTPMMIQTRAADEPPLVRHACRD--CKKHFK  182 (195)
T ss_pred             cCcccCCCCCCCCCCceEEEEEeeccCCCCceEEEEcCC--CCCccC
Confidence            777 89999999999999999999999999999999999  999997


No 9  
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=99.71  E-value=7.3e-18  Score=126.68  Aligned_cols=41  Identities=51%  Similarity=1.005  Sum_probs=39.3

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      ....||+||+++++|||+|+||||||||+||+|++  |||+|+
T Consensus       257 ~~~~C~~C~~~~~~~~q~QtrsaDEpmT~f~~C~~--Cg~~w~  297 (299)
T TIGR01385       257 DLFTCGKCKQKKCTYYQLQTRSADEPMTTFVTCEE--CGNRWK  297 (299)
T ss_pred             ccccCCCCCCccceEEEecccCCCCCCeEEEEcCC--CCCeee
Confidence            35799999999999999999999999999999999  999997


No 10 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=99.51  E-value=4.8e-15  Score=78.49  Aligned_cols=34  Identities=32%  Similarity=0.764  Sum_probs=25.7

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      |+|||+|||||+|++++...  . +|++|||++++++
T Consensus         1 m~FCp~C~nlL~p~~~~~~~--~-~C~~C~Y~~~~~~   34 (35)
T PF02150_consen    1 MRFCPECGNLLYPKEDKEKR--V-ACRTCGYEEPISQ   34 (35)
T ss_dssp             --BETTTTSBEEEEEETTTT--E-EESSSS-EEE-SS
T ss_pred             CeeCCCCCccceEcCCCccC--c-CCCCCCCccCCCC
Confidence            89999999999999666543  4 9999999999875


No 11 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=99.14  E-value=9.5e-11  Score=66.59  Aligned_cols=41  Identities=37%  Similarity=0.721  Sum_probs=32.1

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCCceEEEEecc
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMESRVKIKRKQP   46 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~~~~~~~~~~   46 (110)
                      .|||+||+||+++++.  ...+++|+.|||...+..  .++++..
T Consensus         1 ~FCp~Cg~~l~~~~~~--~~~~~vC~~Cg~~~~~~~--~~~~~~~   41 (52)
T smart00661        1 KFCPKCGNMLIPKEGK--EKRRFVCRKCGYEEPIEQ--KYVYKEK   41 (52)
T ss_pred             CCCCCCCCccccccCC--CCCEEECCcCCCeEECCC--cEEEEEE
Confidence            5999999999999433  235999999999999887  5555433


No 12 
>KOG1105 consensus Transcription elongation factor TFIIS/Cofactor of enhancer-binding protein Sp1 [Transcription]
Probab=98.97  E-value=4.6e-10  Score=84.15  Aligned_cols=40  Identities=48%  Similarity=0.998  Sum_probs=38.5

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      ..+|.+|+.....|+|+|+||||||||.|-.|..  ||++|+
T Consensus       255 ~fkcgkckk~~cty~q~Qtrs~DePmtTfv~C~e--cgnrWk  294 (296)
T KOG1105|consen  255 LFKCGKCKKKNCTYTQLQTRSADEPMTTFVTCNE--CGNRWK  294 (296)
T ss_pred             ceeeccccccceeEEeeccCCCCCCcceeeeecc--cCCccc
Confidence            4799999999999999999999999999999999  999996


No 13 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=98.46  E-value=1e-07  Score=49.89  Aligned_cols=33  Identities=39%  Similarity=1.007  Sum_probs=21.4

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      +|||.||..|..+++.++...+++|+.||++..
T Consensus         1 kfC~~CG~~l~~~ip~gd~r~R~vC~~Cg~IhY   33 (34)
T PF14803_consen    1 KFCPQCGGPLERRIPEGDDRERLVCPACGFIHY   33 (34)
T ss_dssp             -B-TTT--B-EEE--TT-SS-EEEETTTTEEE-
T ss_pred             CccccccChhhhhcCCCCCccceECCCCCCEEe
Confidence            599999999999988888899999999998753


No 14 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=98.18  E-value=1.3e-06  Score=49.57  Aligned_cols=27  Identities=33%  Similarity=0.942  Sum_probs=23.2

Q ss_pred             CCCcCCCC-CcccccCCCCCCceEEcCCCCCeee
Q 033869            2 EFCPTCGT-MLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         2 ~FCp~C~n-lL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      +|||.||+ +|.+.  .    .++.|..|||++.
T Consensus        21 ~fCP~Cg~~~m~~~--~----~r~~C~~Cgyt~~   48 (50)
T PRK00432         21 KFCPRCGSGFMAEH--L----DRWHCGKCGYTEF   48 (50)
T ss_pred             CcCcCCCcchhecc--C----CcEECCCcCCEEe
Confidence            59999999 88887  2    4899999999864


No 15 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=97.58  E-value=9.9e-05  Score=41.14  Aligned_cols=38  Identities=21%  Similarity=0.553  Sum_probs=27.2

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      .||.||+.-..--..++  .++--.++|.|.|+.|||+|.
T Consensus         1 ~CP~Cg~~a~ir~S~~~--s~~~~~~Y~qC~N~~Cg~tfv   38 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQL--SPLTRELYCQCTNPECGHTFV   38 (47)
T ss_pred             CcCCCCCeeEEEEchhh--CcceEEEEEEECCCcCCCEEE
Confidence            59999986544433332  334455899999999999985


No 16 
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=97.35  E-value=0.00018  Score=40.48  Aligned_cols=28  Identities=32%  Similarity=0.895  Sum_probs=22.1

Q ss_pred             CCCcCCC--CCcccccCCCCCCceEEcCCCCCeeee
Q 033869            2 EFCPTCG--TMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         2 ~FCp~C~--nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      +|||.||  .+|---      ..+++|-.|||++-.
T Consensus        20 ~~CPrCG~gvfmA~H------~dR~~CGkCgyTe~~   49 (51)
T COG1998          20 RFCPRCGPGVFMADH------KDRWACGKCGYTEFK   49 (51)
T ss_pred             ccCCCCCCcchhhhc------CceeEeccccceEee
Confidence            5999999  555444      459999999998754


No 17 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=97.31  E-value=0.00024  Score=43.18  Aligned_cols=38  Identities=24%  Similarity=0.594  Sum_probs=27.7

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCce-EEEEecCCCCCcccc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMS-IFYMCANKNCKHRWN  109 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T-~fY~C~~~~C~~~wr  109 (110)
                      ..||.||+.-.   ..-+|..+++.. ++|.|.|..|||+|.
T Consensus         2 m~CP~Cg~~a~---irtSr~~s~~~~~~Y~qC~N~eCg~tF~   40 (72)
T PRK09678          2 FHCPLCQHAAH---ARTSRYITDTTKERYHQCQNVNCSATFI   40 (72)
T ss_pred             ccCCCCCCccE---EEEChhcChhhheeeeecCCCCCCCEEE
Confidence            37999999763   233455555543 899999888999985


No 18 
>PHA00626 hypothetical protein
Probab=96.85  E-value=0.001  Score=38.42  Aligned_cols=36  Identities=22%  Similarity=0.480  Sum_probs=24.9

Q ss_pred             CCCcCCCCCcccccCCCC-CCceEEcCCCCCeeeeCC
Q 033869            2 EFCPTCGTMLQYELPHMD-RPSRFSCPACPYVCNMES   37 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~-~~~~~~C~~C~y~~~~~~   37 (110)
                      +.||+||+--..+..... ....|.|+.|||....+.
T Consensus         1 m~CP~CGS~~Ivrcg~cr~~snrYkCkdCGY~ft~~~   37 (59)
T PHA00626          1 MSCPKCGSGNIAKEKTMRGWSDDYVCCDCGYNDSKDA   37 (59)
T ss_pred             CCCCCCCCceeeeeceecccCcceEcCCCCCeechhh
Confidence            479999995444412222 267999999999876553


No 19 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=96.70  E-value=0.00075  Score=33.00  Aligned_cols=24  Identities=33%  Similarity=0.843  Sum_probs=18.4

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      +++||.||..+...        .-.|+.||..
T Consensus         2 ~~~Cp~Cg~~~~~~--------~~fC~~CG~~   25 (26)
T PF13248_consen    2 EMFCPNCGAEIDPD--------AKFCPNCGAK   25 (26)
T ss_pred             cCCCcccCCcCCcc--------cccChhhCCC
Confidence            46999999965444        5689999963


No 20 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=96.63  E-value=0.0016  Score=33.25  Aligned_cols=28  Identities=25%  Similarity=0.497  Sum_probs=18.0

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      +||+.||.-+.+.  ..  .-...|+.|+...
T Consensus         4 rfC~~CG~~t~~~--~~--g~~r~C~~Cg~~~   31 (32)
T PF09297_consen    4 RFCGRCGAPTKPA--PG--GWARRCPSCGHEH   31 (32)
T ss_dssp             SB-TTT--BEEE---SS--SS-EEESSSS-EE
T ss_pred             cccCcCCccccCC--CC--cCEeECCCCcCEe
Confidence            6999999999998  33  4689999999764


No 21 
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=96.57  E-value=0.0032  Score=33.67  Aligned_cols=34  Identities=26%  Similarity=0.626  Sum_probs=27.8

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCC---CCCeeeeCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPA---CPYVCNMES   37 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~---C~y~~~~~~   37 (110)
                      ..||.||..|..+  ....+..+.|.+   |.|+..+..
T Consensus         2 ~~CP~Cg~~lv~r--~~k~g~F~~Cs~yP~C~~~~~~~~   38 (39)
T PF01396_consen    2 EKCPKCGGPLVLR--RGKKGKFLGCSNYPECKYTEPLPK   38 (39)
T ss_pred             cCCCCCCceeEEE--ECCCCCEEECCCCCCcCCeEeCCC
Confidence            4699999999999  555568999997   999887653


No 22 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=96.56  E-value=0.0011  Score=32.55  Aligned_cols=24  Identities=33%  Similarity=0.820  Sum_probs=19.9

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      =||+|+..+...        .-.|+.|||...
T Consensus         2 ~CP~C~~~V~~~--------~~~Cp~CG~~F~   25 (26)
T PF10571_consen    2 TCPECGAEVPES--------AKFCPHCGYDFE   25 (26)
T ss_pred             cCCCCcCCchhh--------cCcCCCCCCCCc
Confidence            499999998666        678999999764


No 23 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=96.40  E-value=0.0015  Score=31.16  Aligned_cols=22  Identities=32%  Similarity=0.970  Sum_probs=17.2

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      |||.||+-+...        .-.|+.||..
T Consensus         1 ~Cp~CG~~~~~~--------~~fC~~CG~~   22 (23)
T PF13240_consen    1 YCPNCGAEIEDD--------AKFCPNCGTP   22 (23)
T ss_pred             CCcccCCCCCCc--------CcchhhhCCc
Confidence            899999988654        4459999863


No 24 
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=96.39  E-value=0.0042  Score=33.24  Aligned_cols=32  Identities=34%  Similarity=0.720  Sum_probs=22.7

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecC-CCCCcc
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCAN-KNCKHR  107 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~-~~C~~~  107 (110)
                      ++.||+|| ..++.     |.+--|  .||-|.+ |.|.++
T Consensus         1 ~~~CP~Cg-~~lv~-----r~~k~g--~F~~Cs~yP~C~~~   33 (39)
T PF01396_consen    1 VEKCPKCG-GPLVL-----RRGKKG--KFLGCSNYPECKYT   33 (39)
T ss_pred             CcCCCCCC-ceeEE-----EECCCC--CEEECCCCCCcCCe
Confidence            36899999 44433     444445  9999998 689875


No 25 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=96.24  E-value=0.0049  Score=29.66  Aligned_cols=24  Identities=29%  Similarity=1.003  Sum_probs=19.6

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      |..||-.|.++    .+...|.|++||+
T Consensus         1 C~sC~~~i~~r----~~~v~f~CPnCG~   24 (24)
T PF07754_consen    1 CTSCGRPIAPR----EQAVPFPCPNCGF   24 (24)
T ss_pred             CccCCCcccCc----ccCceEeCCCCCC
Confidence            67899999988    2356999999995


No 26 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=96.21  E-value=0.022  Score=43.46  Aligned_cols=72  Identities=22%  Similarity=0.558  Sum_probs=41.2

Q ss_pred             CCCcCCCCCcccc---cCCCCCCceEEcCCCCCeeeeCCceEEEEecccCccccccccccccccCCCCCcccCCCCCCC-
Q 033869            2 EFCPTCGTMLQYE---LPHMDRPSRFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMMEGPQTEVTCPACKHG-   77 (110)
Q Consensus         2 ~FCp~C~nlL~~~---~~~~~~~~~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CpkCg~~-   77 (110)
                      .+||-||+.=...   ....++.-++.|..|+..+...                               ...||.||+. 
T Consensus       188 ~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~teW~~~-------------------------------R~~C~~Cg~~~  236 (309)
T PRK03564        188 QFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESEWHVV-------------------------------RVKCSNCEQSG  236 (309)
T ss_pred             CCCCCCCCcchhheeeccCCCCceEEEcCCCCCccccc-------------------------------CccCCCCCCCC
Confidence            4788888762111   0012334577888888655432                               3468888864 


Q ss_pred             ceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           78 KAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        78 ~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      +..||.+-   .+++-...++|..  |+.-++
T Consensus       237 ~l~y~~~~---~~~~~~r~e~C~~--C~~YlK  263 (309)
T PRK03564        237 KLHYWSLD---SEQAAVKAESCGD--CGTYLK  263 (309)
T ss_pred             ceeeeeec---CCCcceEeeeccc--ccccce
Confidence            55565552   1224457788887  876543


No 27 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=96.18  E-value=0.0042  Score=31.96  Aligned_cols=15  Identities=27%  Similarity=0.685  Sum_probs=11.9

Q ss_pred             cccCCCCCCCceEEE
Q 033869           68 EVTCPACKHGKAVYH   82 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~   82 (110)
                      +..||.||..+..|.
T Consensus        17 ~~~CP~Cg~~~~~F~   31 (33)
T cd00350          17 PWVCPVCGAPKDKFE   31 (33)
T ss_pred             CCcCcCCCCcHHHcE
Confidence            458999999877664


No 28 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=95.90  E-value=0.002  Score=32.65  Aligned_cols=27  Identities=33%  Similarity=0.966  Sum_probs=14.3

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      +||+||....+        .|   ...|+|..  |+|.|.
T Consensus         4 ~Cp~C~se~~y--------~D---~~~~vCp~--C~~ew~   30 (30)
T PF08274_consen    4 KCPLCGSEYTY--------ED---GELLVCPE--CGHEWN   30 (30)
T ss_dssp             --TTT-----E--------E----SSSEEETT--TTEEE-
T ss_pred             CCCCCCCccee--------cc---CCEEeCCc--ccccCC
Confidence            79999998877        22   22489999  999994


No 29 
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=95.88  E-value=0.0093  Score=44.74  Aligned_cols=72  Identities=21%  Similarity=0.489  Sum_probs=30.5

Q ss_pred             CCCcCCCCC-----cccccCCCCCCceEEcCCCCCeeeeCCceEEEEecccCccccccccccccccCCCCCcccCCCCCC
Q 033869            2 EFCPTCGTM-----LQYELPHMDRPSRFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMMEGPQTEVTCPACKH   76 (110)
Q Consensus         2 ~FCp~C~nl-----L~~~~~~~~~~~~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CpkCg~   76 (110)
                      .+||-||+.     |...++  .+.-++.|..|+..+...                               ...||.||+
T Consensus       173 g~CPvCGs~P~~s~l~~~~~--~G~R~L~Cs~C~t~W~~~-------------------------------R~~Cp~Cg~  219 (290)
T PF04216_consen  173 GYCPVCGSPPVLSVLRGGER--EGKRYLHCSLCGTEWRFV-------------------------------RIKCPYCGN  219 (290)
T ss_dssp             SS-TTT---EEEEEEE--------EEEEEETTT--EEE---------------------------------TTS-TTT--
T ss_pred             CcCCCCCCcCceEEEecCCC--CccEEEEcCCCCCeeeec-------------------------------CCCCcCCCC
Confidence            368888875     222211  123577888888765532                               336999998


Q ss_pred             CceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           77 GKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        77 ~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      .+..=+.. ....+++.-..++|-+  |+.-++
T Consensus       220 ~~~~~l~~-~~~e~~~~~rve~C~~--C~~YlK  249 (290)
T PF04216_consen  220 TDHEKLEY-FTVEGEPAYRVEVCES--CGSYLK  249 (290)
T ss_dssp             -SS-EEE---------SEEEEEETT--TTEEEE
T ss_pred             CCCcceee-EecCCCCcEEEEECCc--ccchHH
Confidence            65432222 2245667888899999  987654


No 30 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=95.87  E-value=0.012  Score=32.34  Aligned_cols=31  Identities=23%  Similarity=0.673  Sum_probs=23.2

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      =|+.||..+...  ...  ..+.|+.||.......
T Consensus         5 ~C~~CG~~~~~~--~~~--~~~~Cp~CG~~~~~~~   35 (46)
T PRK00398          5 KCARCGREVELD--EYG--TGVRCPYCGYRILFKE   35 (46)
T ss_pred             ECCCCCCEEEEC--CCC--CceECCCCCCeEEEcc
Confidence            399999998887  322  2799999998665544


No 31 
>PHA00626 hypothetical protein
Probab=95.80  E-value=0.0095  Score=34.41  Aligned_cols=33  Identities=30%  Similarity=0.631  Sum_probs=22.3

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      .||+||+.+.+ -....|    .+..-|+|..  |||.++
T Consensus         2 ~CP~CGS~~Iv-rcg~cr----~~snrYkCkd--CGY~ft   34 (59)
T PHA00626          2 SCPKCGSGNIA-KEKTMR----GWSDDYVCCD--CGYNDS   34 (59)
T ss_pred             CCCCCCCceee-eeceec----ccCcceEcCC--CCCeec
Confidence            69999997764 211112    2345599998  999875


No 32 
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=95.80  E-value=0.046  Score=41.67  Aligned_cols=72  Identities=21%  Similarity=0.482  Sum_probs=41.7

Q ss_pred             CCcCCCCCccc---cc-CCCCCCceEEcCCCCCeeeeCCceEEEEecccCccccccccccccccCCCCCcccCCCCCCC-
Q 033869            3 FCPTCGTMLQY---EL-PHMDRPSRFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMMEGPQTEVTCPACKHG-   77 (110)
Q Consensus         3 FCp~C~nlL~~---~~-~~~~~~~~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CpkCg~~-   77 (110)
                      +||-||+.=..   .. ...++.-++.|..|+..+...                               ...||.||+. 
T Consensus       186 ~CPvCGs~P~~s~~~~~~~~~G~RyL~CslC~teW~~~-------------------------------R~~C~~Cg~~~  234 (305)
T TIGR01562       186 LCPACGSPPVASMVRQGGKETGLRYLSCSLCATEWHYV-------------------------------RVKCSHCEESK  234 (305)
T ss_pred             cCCCCCChhhhhhhcccCCCCCceEEEcCCCCCccccc-------------------------------CccCCCCCCCC
Confidence            78888876322   10 012334578888888665432                               3468888865 


Q ss_pred             ceEEEEeccCCCCCCceEEEEecCCCCCccc
Q 033869           78 KAVYHELQTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        78 ~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      +..||.+-. ..+++-....+|..  |+.-+
T Consensus       235 ~l~y~~~e~-~~~~~~~r~e~C~~--C~~Yl  262 (305)
T TIGR01562       235 HLAYLSLEH-DAEKAVLKAETCDS--CQGYL  262 (305)
T ss_pred             ceeeEeecC-CCCCcceEEeeccc--cccch
Confidence            344665532 11234567788887  87644


No 33 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=95.76  E-value=0.019  Score=34.09  Aligned_cols=11  Identities=27%  Similarity=0.809  Sum_probs=6.8

Q ss_pred             cCCCCCCCceE
Q 033869           70 TCPACKHGKAV   80 (110)
Q Consensus        70 ~CpkCg~~~a~   80 (110)
                      .|||||+.+..
T Consensus         2 ~C~KCg~~~~e   12 (64)
T PF09855_consen    2 KCPKCGNEEYE   12 (64)
T ss_pred             CCCCCCCccee
Confidence            57777775543


No 34 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=95.74  E-value=0.014  Score=33.55  Aligned_cols=49  Identities=29%  Similarity=0.572  Sum_probs=30.1

Q ss_pred             eEEcCCCCCeeeeCCceEEEEecccCccccccccccccccC-CCCCcccCCCCCCCceEEEEe
Q 033869           23 RFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMME-GPQTEVTCPACKHGKAVYHEL   84 (110)
Q Consensus        23 ~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~CpkCg~~~a~~~~~   84 (110)
                      .|.|+.|||+++....           .....|-.+. .+. +| .+..||.||-.+..|..+
T Consensus         3 ~~~C~~CG~vYd~e~G-----------dp~~gi~pgT-~fedlP-d~w~CP~Cg~~K~~F~~~   52 (55)
T COG1773           3 RWRCSVCGYVYDPEKG-----------DPRCGIAPGT-PFEDLP-DDWVCPECGVGKKDFEMI   52 (55)
T ss_pred             ceEecCCceEeccccC-----------CccCCCCCCC-chhhCC-CccCCCCCCCCHhHeeec
Confidence            6899999998876541           1111222111 122 22 478999999888877654


No 35 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=95.66  E-value=0.0079  Score=34.00  Aligned_cols=47  Identities=23%  Similarity=0.572  Sum_probs=27.3

Q ss_pred             eEEcCCCCCeeeeCCceEEEEecccCccccccccccccccC-CCCCcccCCCCCCCceEEE
Q 033869           23 RFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMME-GPQTEVTCPACKHGKAVYH   82 (110)
Q Consensus        23 ~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~CpkCg~~~a~~~   82 (110)
                      .|.|+.|||+++....           .....|..+. .+. ||. +..||.||..+..|-
T Consensus         1 ~y~C~~CgyiYd~~~G-----------d~~~~i~pGt-~f~~Lp~-~w~CP~C~a~K~~F~   48 (50)
T cd00730           1 KYECRICGYIYDPAEG-----------DPDEGIPPGT-PFEDLPD-DWVCPVCGAGKDDFE   48 (50)
T ss_pred             CcCCCCCCeEECCCCC-----------CcccCcCCCC-CHhHCCC-CCCCCCCCCcHHHcE
Confidence            3789999998875431           0001122111 122 443 789999998876653


No 36 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=95.53  E-value=0.013  Score=32.24  Aligned_cols=28  Identities=25%  Similarity=0.599  Sum_probs=20.8

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      ..||+||+.+++....         ...|.|.+  |+++
T Consensus        19 ~~CP~Cg~~~~~~~~~---------~~~~~C~~--C~~q   46 (46)
T PF12760_consen   19 FVCPHCGSTKHYRLKT---------RGRYRCKA--CRKQ   46 (46)
T ss_pred             CCCCCCCCeeeEEeCC---------CCeEECCC--CCCc
Confidence            5699999995555432         45699999  9874


No 37 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=95.48  E-value=0.017  Score=32.18  Aligned_cols=46  Identities=28%  Similarity=0.622  Sum_probs=23.8

Q ss_pred             eEEcCCCCCeeeeCCceEEEEecccCccccccccccccccC-CCCCcccCCCCCCCceEE
Q 033869           23 RFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMME-GPQTEVTCPACKHGKAVY   81 (110)
Q Consensus        23 ~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~CpkCg~~~a~~   81 (110)
                      .|.|+.|||+.+....           +....|..+. .+. || .+..||.||..+..|
T Consensus         1 ky~C~~CgyvYd~~~G-----------d~~~~i~pGt-~F~~Lp-~~w~CP~C~a~K~~F   47 (47)
T PF00301_consen    1 KYQCPVCGYVYDPEKG-----------DPENGIPPGT-PFEDLP-DDWVCPVCGAPKSDF   47 (47)
T ss_dssp             EEEETTTSBEEETTTB-----------BGGGTB-TT---GGGS--TT-B-TTTSSBGGGE
T ss_pred             CcCCCCCCEEEcCCcC-----------CcccCcCCCC-CHHHCC-CCCcCcCCCCccccC
Confidence            4899999998875441           1111222211 122 43 368999999876433


No 38 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.47  E-value=0.016  Score=30.06  Aligned_cols=12  Identities=33%  Similarity=1.115  Sum_probs=10.1

Q ss_pred             eEEcCCCCCeee
Q 033869           23 RFSCPACPYVCN   34 (110)
Q Consensus        23 ~~~C~~C~y~~~   34 (110)
                      .|.|+.|||+..
T Consensus         2 ~~~C~~CG~i~~   13 (34)
T cd00729           2 VWVCPVCGYIHE   13 (34)
T ss_pred             eEECCCCCCEeE
Confidence            689999999754


No 39 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=95.41  E-value=0.0091  Score=34.87  Aligned_cols=26  Identities=31%  Similarity=0.885  Sum_probs=15.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      -|.-||-.|.|.    .+...|.|++||.+
T Consensus        11 ~CtSCg~~i~p~----e~~v~F~CPnCGe~   36 (61)
T COG2888          11 VCTSCGREIAPG----ETAVKFPCPNCGEV   36 (61)
T ss_pred             eeccCCCEeccC----CceeEeeCCCCCce
Confidence            356666666665    22346677777743


No 40 
>PF12773 DZR:  Double zinc ribbon
Probab=95.38  E-value=0.008  Score=33.36  Aligned_cols=27  Identities=41%  Similarity=0.833  Sum_probs=18.7

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      .||+.||..|...     ....+.|+.||+..
T Consensus        13 ~fC~~CG~~l~~~-----~~~~~~C~~Cg~~~   39 (50)
T PF12773_consen   13 KFCPHCGTPLPPP-----DQSKKICPNCGAEN   39 (50)
T ss_pred             cCChhhcCChhhc-----cCCCCCCcCCcCCC
Confidence            6888888888822     13467888888753


No 41 
>PF14353 CpXC:  CpXC protein
Probab=95.17  E-value=0.018  Score=38.10  Aligned_cols=45  Identities=22%  Similarity=0.440  Sum_probs=25.2

Q ss_pred             EEcCCCCCeeeeCCceEEEEeccc--CccccccccccccccCCCCCcccCCCCCCCc
Q 033869           24 FSCPACPYVCNMESRVKIKRKQPL--SKKEIQPIFTQDAMMEGPQTEVTCPACKHGK   78 (110)
Q Consensus        24 ~~C~~C~y~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~~~CpkCg~~~   78 (110)
                      +.|+.|+....++-.    ..+..  ...-.+.++.++      --...||+||+.-
T Consensus         2 itCP~C~~~~~~~v~----~~I~~~~~p~l~e~il~g~------l~~~~CP~Cg~~~   48 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVW----TSINADEDPELKEKILDGS------LFSFTCPSCGHKF   48 (128)
T ss_pred             cCCCCCCCeeEEEEE----eEEcCcCCHHHHHHHHcCC------cCEEECCCCCCce
Confidence            579999998776542    11221  121122344322      2367999999854


No 42 
>COG3478 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=95.09  E-value=0.018  Score=34.11  Aligned_cols=34  Identities=26%  Similarity=0.696  Sum_probs=20.9

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceEEE----------EecCCCCCcc
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSIFY----------MCANKNCKHR  107 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~fY----------~C~~~~C~~~  107 (110)
                      +|||||+++  |.+.+++...++..-||          .|.+  |||+
T Consensus         6 kCpKCgn~~--~~ekei~~tg~~lskifdvq~n~f~~itCk~--CgYt   49 (68)
T COG3478           6 KCPKCGNTN--YEEKEIAATGGGLSKIFDVQNNKFIVITCKN--CGYT   49 (68)
T ss_pred             cCCCcCCcc--hhhceeeccCCCcceeEEecccEEEEEEecc--CCch
Confidence            488888765  35555556656655443          4667  7764


No 43 
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=94.97  E-value=0.015  Score=29.42  Aligned_cols=26  Identities=35%  Similarity=0.821  Sum_probs=15.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      =||.|++-.... |    +..|+|+.|+++.
T Consensus         4 ~Cp~C~se~~y~-D----~~~~vCp~C~~ew   29 (30)
T PF08274_consen    4 KCPLCGSEYTYE-D----GELLVCPECGHEW   29 (30)
T ss_dssp             --TTT-----EE------SSSEEETTTTEEE
T ss_pred             CCCCCCCcceec-c----CCEEeCCcccccC
Confidence            499999887775 2    4599999999875


No 44 
>PRK14973 DNA topoisomerase I; Provisional
Probab=94.80  E-value=0.057  Score=46.74  Aligned_cols=33  Identities=24%  Similarity=0.415  Sum_probs=21.8

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      ++..||+||.+.    .+.+|...-|+  |.-|..  |+|.
T Consensus       634 ~~~~Cp~CG~p~----~~~~r~Gr~g~--fl~CP~--C~~~  666 (936)
T PRK14973        634 TDEVCPIHHLNH----VRLIRKGARPW--DIGCPL--CSHI  666 (936)
T ss_pred             CCCCCCCCCCCc----eEEeecCCCcc--cccCcc--ccch
Confidence            356899999862    22235555566  778966  9884


No 45 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=94.70  E-value=0.018  Score=34.22  Aligned_cols=15  Identities=27%  Similarity=0.476  Sum_probs=12.0

Q ss_pred             CcccCCCCCCCceEE
Q 033869           67 TEVTCPACKHGKAVY   81 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~   81 (110)
                      +-+.|++||+.|.+-
T Consensus        35 ~~v~C~~CGYTE~Y~   49 (64)
T PF09855_consen   35 TTVSCTNCGYTEFYK   49 (64)
T ss_pred             EEEECCCCCCEEEEe
Confidence            456899999998755


No 46 
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=94.62  E-value=0.044  Score=37.58  Aligned_cols=36  Identities=31%  Similarity=0.704  Sum_probs=28.5

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceEE--EEecCCCCCcccc
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSIF--YMCANKNCKHRWN  109 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~f--Y~C~~~~C~~~wr  109 (110)
                      +||.|||.+-.-  +-+|++++|.++=  -.|.+  |+++|.
T Consensus         2 ~CP~C~~~dtkV--iDSR~~~dg~~IRRRReC~~--C~~RFT   39 (147)
T TIGR00244         2 HCPFCQHHNTRV--LDSRLVEDGQSIRRRRECLE--CHERFT   39 (147)
T ss_pred             CCCCCCCCCCEe--eeccccCCCCeeeecccCCc--cCCccc
Confidence            699999976644  4579999997764  68998  999885


No 47 
>KOG3084 consensus NADH pyrophosphatase I of the Nudix family of hydrolases [Replication, recombination and repair]
Probab=94.61  E-value=0.048  Score=41.82  Aligned_cols=40  Identities=28%  Similarity=0.585  Sum_probs=27.2

Q ss_pred             CCCcCCCCCcccccCCCCCCce-EEcCCCCCeeeeCCceEE
Q 033869            2 EFCPTCGTMLQYELPHMDRPSR-FSCPACPYVCNMESRVKI   41 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~-~~C~~C~y~~~~~~~~~~   41 (110)
                      +|||.||+-+.|++........ -.|+.|++.++..++.+|
T Consensus       151 kFCp~CG~~tkp~e~g~k~~Cs~~~C~~~n~~yPr~dPvVI  191 (345)
T KOG3084|consen  151 KFCPGCGSPTKPEEAGTKLQCSDETCPSCNVIYPRTDPVVI  191 (345)
T ss_pred             ccCcccCCCcccccCCccceeecccCCcCCeeccCCCCeEE
Confidence            6999999999999544322222 346666778887776443


No 48 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=94.59  E-value=0.023  Score=30.78  Aligned_cols=30  Identities=27%  Similarity=0.668  Sum_probs=20.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      .||.||+-. +..|.  ....++|+.||.+..-
T Consensus         2 ~Cp~Cg~~~-~~~D~--~~g~~vC~~CG~Vl~e   31 (43)
T PF08271_consen    2 KCPNCGSKE-IVFDP--ERGELVCPNCGLVLEE   31 (43)
T ss_dssp             SBTTTSSSE-EEEET--TTTEEEETTT-BBEE-
T ss_pred             CCcCCcCCc-eEEcC--CCCeEECCCCCCEeec
Confidence            699999865 33233  3568899999987553


No 49 
>PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated
Probab=94.49  E-value=0.11  Score=44.73  Aligned_cols=32  Identities=25%  Similarity=0.530  Sum_probs=22.9

Q ss_pred             CCcCCCC-CcccccCCCCCCceEEcCC---CCCeeeeC
Q 033869            3 FCPTCGT-MLQYELPHMDRPSRFSCPA---CPYVCNME   36 (110)
Q Consensus         3 FCp~C~n-lL~~~~~~~~~~~~~~C~~---C~y~~~~~   36 (110)
                      =||.||. .|..+  .+..+..+.|.+   |.|..++.
T Consensus       594 ~CP~Cg~~~L~~k--~gr~G~Fl~Cs~yP~C~~t~~~~  629 (860)
T PRK06319        594 DCPKCHKGKLVKI--WAKNRYFYGCSEYPECDYKTSEE  629 (860)
T ss_pred             ccCCCCCcceeEE--ecCCCceeeccCCccccccCCcc
Confidence            4999964 77766  445567999976   88876554


No 50 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=94.45  E-value=0.035  Score=29.04  Aligned_cols=33  Identities=21%  Similarity=0.489  Sum_probs=23.5

Q ss_pred             CCcCCCCCcccccCCC-CCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHM-DRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~-~~~~~~~C~~C~y~~~~   35 (110)
                      =||.|+....+..+.. ..+..+.|++|+....+
T Consensus         4 ~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~~~~   37 (38)
T TIGR02098         4 QCPNCKTSFRVVDSQLGANGGKVRCGKCGHVWYA   37 (38)
T ss_pred             ECCCCCCEEEeCHHHcCCCCCEEECCCCCCEEEe
Confidence            3999999887774332 23348999999987653


No 51 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=94.34  E-value=0.031  Score=32.62  Aligned_cols=26  Identities=31%  Similarity=0.857  Sum_probs=18.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      .|.-||-.|.+.    ++...|.|++||..
T Consensus         9 ~CtSCg~~i~~~----~~~~~F~CPnCG~~   34 (59)
T PRK14890          9 KCTSCGIEIAPR----EKAVKFLCPNCGEV   34 (59)
T ss_pred             cccCCCCcccCC----CccCEeeCCCCCCe
Confidence            577788777776    22457888888864


No 52 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=94.24  E-value=0.043  Score=28.85  Aligned_cols=32  Identities=25%  Similarity=0.606  Sum_probs=24.2

Q ss_pred             CCcCCCCCcccccCCC-CCCceEEcCCCCCeee
Q 033869            3 FCPTCGTMLQYELPHM-DRPSRFSCPACPYVCN   34 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~-~~~~~~~C~~C~y~~~   34 (110)
                      =||.|+..+.++.++- ..+..+.|+.|+..+.
T Consensus         4 ~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f~   36 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVFR   36 (37)
T ss_pred             ECCCCCceEEcCHHHcccCCcEEECCCCCcEee
Confidence            3999999988874431 3456899999998764


No 53 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=94.15  E-value=0.014  Score=49.18  Aligned_cols=25  Identities=20%  Similarity=0.331  Sum_probs=16.2

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCC
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADE   91 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE   91 (110)
                      +-..||+||....+++-.-|....|
T Consensus       474 ~p~~Cp~Cgs~~L~~~G~Gteriee  498 (730)
T COG1198         474 IPQSCPECGSEHLRAVGPGTERIEE  498 (730)
T ss_pred             CCCCCCCCCCCeeEEecccHHHHHH
Confidence            3457999988877776655444333


No 54 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=94.12  E-value=0.033  Score=29.82  Aligned_cols=29  Identities=31%  Similarity=0.655  Sum_probs=23.0

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      ||.|++.|...  .........|+.|+-...
T Consensus         2 CP~C~~~l~~~--~~~~~~id~C~~C~G~W~   30 (41)
T PF13453_consen    2 CPRCGTELEPV--RLGDVEIDVCPSCGGIWF   30 (41)
T ss_pred             cCCCCcccceE--EECCEEEEECCCCCeEEc
Confidence            99999988877  434467889999997654


No 55 
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=94.09  E-value=0.066  Score=40.32  Aligned_cols=38  Identities=24%  Similarity=0.334  Sum_probs=29.5

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeee-eCCceEEEE
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN-MESRVKIKR   43 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~-~~~~~~~~~   43 (110)
                      +||+.||.-+++.    .......|+.||+... ..++.+|+-
T Consensus       112 RFCg~CG~~~~~~----~~g~~~~C~~cg~~~fPR~dP~vIv~  150 (279)
T COG2816         112 RFCGRCGTKTYPR----EGGWARVCPKCGHEHFPRIDPCVIVA  150 (279)
T ss_pred             cCCCCCCCcCccc----cCceeeeCCCCCCccCCCCCCeEEEE
Confidence            7999999999999    3356899999998754 455655543


No 56 
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=94.07  E-value=0.085  Score=28.19  Aligned_cols=30  Identities=23%  Similarity=0.534  Sum_probs=20.9

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      .||+|+. .+.=..+       +-...+.|.+  |+-.|=
T Consensus         1 ~CP~C~~-~l~~~~~-------~~~~id~C~~--C~G~W~   30 (41)
T PF13453_consen    1 KCPRCGT-ELEPVRL-------GDVEIDVCPS--CGGIWF   30 (41)
T ss_pred             CcCCCCc-ccceEEE-------CCEEEEECCC--CCeEEc
Confidence            5999998 4432222       3367799999  999884


No 57 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=94.06  E-value=0.059  Score=29.89  Aligned_cols=12  Identities=17%  Similarity=0.517  Sum_probs=9.1

Q ss_pred             EEEecCCCCCcccc
Q 033869           96 FYMCANKNCKHRWN  109 (110)
Q Consensus        96 fY~C~~~~C~~~wr  109 (110)
                      .|+|..  |||.++
T Consensus        20 ~~vC~~--Cg~~~~   31 (52)
T smart00661       20 RFVCRK--CGYEEP   31 (52)
T ss_pred             EEECCc--CCCeEE
Confidence            778887  888764


No 58 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=94.04  E-value=0.077  Score=36.67  Aligned_cols=36  Identities=25%  Similarity=0.636  Sum_probs=24.5

Q ss_pred             cCCCCCCCceEEEEeccCCCCCC--ceEEEEecCCCCCcccc
Q 033869           70 TCPACKHGKAVYHELQTRSADEP--MSIFYMCANKNCKHRWN  109 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~--~T~fY~C~~~~C~~~wr  109 (110)
                      +||-||+....-  .-.|...+|  -+.||.|.+  ||.+|.
T Consensus         2 ~cp~c~~~~~~~--~~s~~~~~~~~~~~~~~c~~--c~~~f~   39 (154)
T PRK00464          2 RCPFCGHPDTRV--IDSRPAEDGNAIRRRRECLA--CGKRFT   39 (154)
T ss_pred             cCCCCCCCCCEe--EeccccCCCCceeeeeeccc--cCCcce
Confidence            799999976211  123334465  567899999  999874


No 59 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=94.02  E-value=0.075  Score=42.95  Aligned_cols=27  Identities=30%  Similarity=0.816  Sum_probs=12.8

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      ||.|+.-|...  +.  ...+.|..|||...
T Consensus       225 C~~C~~~l~~h--~~--~~~l~Ch~Cg~~~~  251 (505)
T TIGR00595       225 CPNCDVSLTYH--KK--EGKLRCHYCGYQEP  251 (505)
T ss_pred             CCCCCCceEEe--cC--CCeEEcCCCcCcCC
Confidence            45555444444  21  23555555555444


No 60 
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=93.83  E-value=0.088  Score=28.19  Aligned_cols=30  Identities=23%  Similarity=0.496  Sum_probs=19.6

Q ss_pred             CcCCCCCc------ccccCCCCCCceEEcCCCCCee
Q 033869            4 CPTCGTML------QYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp~C~nlL------~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      ||.||+--      ..+...+...+.|.|.+|++..
T Consensus         3 Cp~C~~~~a~~~q~Q~RsaDE~mT~fy~C~~C~~~w   38 (40)
T smart00440        3 CPKCGNREATFFQLQTRSADEPMTVFYVCTKCGHRW   38 (40)
T ss_pred             CCCCCCCeEEEEEEcccCCCCCCeEEEEeCCCCCEe
Confidence            89999752      1221122346789999999865


No 61 
>PRK00241 nudC NADH pyrophosphatase; Reviewed
Probab=93.79  E-value=0.1  Score=38.65  Aligned_cols=32  Identities=22%  Similarity=0.480  Sum_probs=25.2

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      .+|||.||+-|...  .+  .....|..|+......
T Consensus        99 ~~fC~~CG~~~~~~--~~--~~~~~C~~c~~~~yp~  130 (256)
T PRK00241         99 HRFCGYCGHPMHPS--KT--EWAMLCPHCRERYYPR  130 (256)
T ss_pred             CccccccCCCCeec--CC--ceeEECCCCCCEECCC
Confidence            47999999999876  32  4578999999877643


No 62 
>PRK07220 DNA topoisomerase I; Validated
Probab=93.63  E-value=0.25  Score=41.79  Aligned_cols=32  Identities=19%  Similarity=0.357  Sum_probs=19.0

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      ++..||+||......    .+....+  -||.|.+  |.+
T Consensus       634 ~~~~Cp~Cg~~~~k~----~~~g~~~--~~~~Cp~--C~~  665 (740)
T PRK07220        634 TDKVCEAHGLNHIRI----INGGKRP--WDLGCPQ--CNF  665 (740)
T ss_pred             CCCCCCCCCCceEEE----EecCCcc--ceeeCCC--CCC
Confidence            356899999754311    1222122  2889977  986


No 63 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=93.63  E-value=0.12  Score=31.29  Aligned_cols=37  Identities=16%  Similarity=0.354  Sum_probs=27.5

Q ss_pred             CCCCcCCCCCcccccCC----CCCCceEEcC--CCCCeeeeCC
Q 033869            1 MEFCPTCGTMLQYELPH----MDRPSRFSCP--ACPYVCNMES   37 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~----~~~~~~~~C~--~C~y~~~~~~   37 (110)
                      |+.||.||+-..+...+    ....+++.|.  .||+..-...
T Consensus         1 mm~CP~Cg~~a~irtSr~~s~~~~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678          1 MFHCPLCQHAAHARTSRYITDTTKERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             CccCCCCCCccEEEEChhcChhhheeeeecCCCCCCCEEEEEE
Confidence            89999999988665222    1347899999  7999876544


No 64 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=93.62  E-value=0.062  Score=30.78  Aligned_cols=33  Identities=24%  Similarity=0.491  Sum_probs=24.1

Q ss_pred             CCCcccCCCCC-CCceEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           65 PQTEVTCPACK-HGKAVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        65 ~~~~~~CpkCg-~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      .+.-..|++|. |++++.       ..|...+-|+|..  |++
T Consensus        19 ~r~aLIC~~C~~hNGla~-------~~~~~~i~y~C~~--Cg~   52 (54)
T PF10058_consen   19 NRYALICSKCFSHNGLAP-------KEEFEEIQYRCPY--CGA   52 (54)
T ss_pred             CceeEECcccchhhcccc-------cccCCceEEEcCC--CCC
Confidence            34567899999 455543       4566777899999  986


No 65 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=93.60  E-value=0.081  Score=29.22  Aligned_cols=34  Identities=21%  Similarity=0.523  Sum_probs=25.4

Q ss_pred             CcCCCCCcccccCC----CCCCceEEcCC--CCCeeeeCC
Q 033869            4 CPTCGTMLQYELPH----MDRPSRFSCPA--CPYVCNMES   37 (110)
Q Consensus         4 Cp~C~nlL~~~~~~----~~~~~~~~C~~--C~y~~~~~~   37 (110)
                      ||.||+.+..+...    ....+++.|.+  ||+...+..
T Consensus         2 CP~Cg~~a~ir~S~~~s~~~~~~Y~qC~N~~Cg~tfv~~~   41 (47)
T PF04606_consen    2 CPHCGSKARIRTSRQLSPLTRELYCQCTNPECGHTFVANL   41 (47)
T ss_pred             cCCCCCeeEEEEchhhCcceEEEEEEECCCcCCCEEEEEE
Confidence            99999988876222    23478899999  999876543


No 66 
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=93.56  E-value=0.058  Score=35.12  Aligned_cols=30  Identities=30%  Similarity=0.816  Sum_probs=24.1

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      .=||.|++-...+  .   +..|.|+.|+|++...
T Consensus         3 p~CP~C~seytY~--d---g~~~iCpeC~~EW~~~   32 (109)
T TIGR00686         3 PPCPKCNSEYTYH--D---GTQLICPSCLYEWNEN   32 (109)
T ss_pred             CcCCcCCCcceEe--c---CCeeECcccccccccc
Confidence            4599999988887  2   3479999999998654


No 67 
>PF09151 DUF1936:  Domain of unknown function (DUF1936);  InterPro: IPR015234 This domain is found in a set of hypothetical archaeal proteins. Its exact function has not, as yet, been defined. ; PDB: 2QH1_B 1PVM_B.
Probab=93.56  E-value=0.23  Score=25.29  Aligned_cols=32  Identities=28%  Similarity=0.718  Sum_probs=18.1

Q ss_pred             ccCCCCCCC--ceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           69 VTCPACKHG--KAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~--~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      ..|||||-.  +.+|-+       .|....|.|.||.|.+.
T Consensus         2 hlcpkcgvgvl~pvy~~-------kgeikvfrcsnpacdye   35 (36)
T PF09151_consen    2 HLCPKCGVGVLEPVYNQ-------KGEIKVFRCSNPACDYE   35 (36)
T ss_dssp             -B-TTTSSSBEEEEE-T-------TS-EEEEEES-TT---E
T ss_pred             ccCCccCceEEEEeecC-------CCcEEEEEcCCCccccC
Confidence            469999986  445532       37788899999999763


No 68 
>PRK07219 DNA topoisomerase I; Validated
Probab=93.54  E-value=0.28  Score=41.92  Aligned_cols=33  Identities=21%  Similarity=0.385  Sum_probs=19.0

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEec-CCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCA-NKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~-~~~C~~~  107 (110)
                      +...||+||..-.   ....+.   |  .|+.|. .+.|++.
T Consensus       732 ~~~~CpkCg~~l~---~~k~~~---g--~~~~Cs~~p~C~~~  765 (822)
T PRK07219        732 TDEKCPECGLPLL---RVKGGF---G--DELGCCNNPKCNYT  765 (822)
T ss_pred             ccCCCCCCCCeEE---EEecCC---C--ceeeeCCCCCCCcc
Confidence            5679999997522   222222   2  378883 2448764


No 69 
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=93.46  E-value=0.068  Score=43.71  Aligned_cols=42  Identities=24%  Similarity=0.560  Sum_probs=29.7

Q ss_pred             CcccCCCCCCC-ceEEEEeccCCCCCCceEEEEecCCCCCccccC
Q 033869           67 TEVTCPACKHG-KAVYHELQTRSADEPMSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        67 ~~~~CpkCg~~-~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wre  110 (110)
                      -.+.||.||+. ...|-.++--....+.+..|+|..  ||+.|.+
T Consensus       199 ~~vpCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~--Cg~~i~e  241 (557)
T PF05876_consen  199 YYVPCPHCGEEQVLEWENLKWDKGEAPETARYVCPH--CGCEIEE  241 (557)
T ss_pred             EEccCCCCCCCccccccceeecCCCCccceEEECCC--CcCCCCH
Confidence            36799999985 444444544111168999999998  9998864


No 70 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=93.44  E-value=0.12  Score=29.64  Aligned_cols=31  Identities=23%  Similarity=0.555  Sum_probs=24.6

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      =||.||.-+.++  ....+..+.|+.||....+
T Consensus         4 ~CP~CG~~iev~--~~~~GeiV~Cp~CGaeleV   34 (54)
T TIGR01206         4 ECPDCGAEIELE--NPELGELVICDECGAELEV   34 (54)
T ss_pred             CCCCCCCEEecC--CCccCCEEeCCCCCCEEEE
Confidence            599999999887  3333678999999987664


No 71 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=93.43  E-value=0.079  Score=35.68  Aligned_cols=27  Identities=37%  Similarity=0.824  Sum_probs=22.2

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      -||.||.-|.-+      ....+|+.|||....
T Consensus        30 hCp~Cg~PLF~K------dG~v~CPvC~~~~~~   56 (131)
T COG1645          30 HCPKCGTPLFRK------DGEVFCPVCGYREVV   56 (131)
T ss_pred             hCcccCCcceee------CCeEECCCCCceEEE
Confidence            499999999886      448999999986543


No 72 
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=93.39  E-value=0.12  Score=37.17  Aligned_cols=42  Identities=19%  Similarity=0.323  Sum_probs=33.7

Q ss_pred             CCcccCCCCCCCceEEEEeccCCCCCC--ceEEEEecCCCCCccccC
Q 033869           66 QTEVTCPACKHGKAVYHELQTRSADEP--MSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        66 ~~~~~CpkCg~~~a~~~~~Q~RsaDE~--~T~fY~C~~~~C~~~wre  110 (110)
                      .....||-||+ ..+..+.+..-.-.|  +-..+.|-+  |||+.++
T Consensus        12 ~~~~~CPvCg~-~l~~~~~~~~IPyFG~V~i~t~~C~~--CgYR~~D   55 (201)
T COG1779          12 ETRIDCPVCGG-TLKAHMYLYDIPYFGEVLISTGVCER--CGYRSTD   55 (201)
T ss_pred             eeeecCCcccc-eeeEEEeeecCCccceEEEEEEEccc--cCCcccc
Confidence            35789999999 777777777776666  566789999  9999864


No 73 
>PRK10220 hypothetical protein; Provisional
Probab=93.37  E-value=0.073  Score=34.73  Aligned_cols=31  Identities=29%  Similarity=0.749  Sum_probs=24.6

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      .=||.|++-..+.  .   +..|.|+.|+|++...+
T Consensus         4 P~CP~C~seytY~--d---~~~~vCpeC~hEW~~~~   34 (111)
T PRK10220          4 PHCPKCNSEYTYE--D---NGMYICPECAHEWNDAE   34 (111)
T ss_pred             CcCCCCCCcceEc--C---CCeEECCcccCcCCccc
Confidence            4599999988877  1   34799999999987654


No 74 
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=93.29  E-value=0.085  Score=37.46  Aligned_cols=44  Identities=25%  Similarity=0.566  Sum_probs=31.9

Q ss_pred             CCCCcccCCCCCCCceEEEEeccCCCCCCc----eEEEEecCCCCCcccc
Q 033869           64 GPQTEVTCPACKHGKAVYHELQTRSADEPM----SIFYMCANKNCKHRWN  109 (110)
Q Consensus        64 ~~~~~~~CpkCg~~~a~~~~~Q~RsaDE~~----T~fY~C~~~~C~~~wr  109 (110)
                      +|..-..|++||..+++--.--.|---.|-    =++|.|++  |.++|-
T Consensus        13 ~pq~~k~C~~Cg~kr~f~cSg~fRvNAq~K~LDvWlIYkC~~--Cd~tWN   60 (203)
T COG4332          13 APQPAKRCNSCGVKRAFTCSGKFRVNAQGKVLDVWLIYKCTH--CDYTWN   60 (203)
T ss_pred             CChhhhhCcccCCcceeeecCcEEEcCCCcEEEEEEEEEeec--cCCccc
Confidence            567778999999988865444444444442    36899999  999994


No 75 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=93.25  E-value=0.082  Score=28.99  Aligned_cols=27  Identities=30%  Similarity=0.834  Sum_probs=18.6

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      .||.||+. ...  .......|.|..|++.
T Consensus        20 ~CP~Cg~~-~~~--~~~~~~~~~C~~C~~q   46 (46)
T PF12760_consen   20 VCPHCGST-KHY--RLKTRGRYRCKACRKQ   46 (46)
T ss_pred             CCCCCCCe-eeE--EeCCCCeEECCCCCCc
Confidence            49999987 222  2223579999999863


No 76 
>PRK07219 DNA topoisomerase I; Validated
Probab=93.15  E-value=0.36  Score=41.31  Aligned_cols=31  Identities=26%  Similarity=0.611  Sum_probs=21.5

Q ss_pred             CcCCCCCcccccCCCCCC-ceEEcCC---CCCeeeeC
Q 033869            4 CPTCGTMLQYELPHMDRP-SRFSCPA---CPYVCNME   36 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~-~~~~C~~---C~y~~~~~   36 (110)
                      ||.||.-|..+  +...+ ..+.|.+   |++..+..
T Consensus       605 CP~Cg~~l~~r--~~~~g~~F~gCs~yp~C~~t~~lp  639 (822)
T PRK07219        605 CPECGGDLIII--RTDKGSRFVGCSGYPDCRNTFPLP  639 (822)
T ss_pred             CCCCCCcceee--eccCCceeeecCCCcCCCCeeecC
Confidence            99999866555  22223 4689987   99887654


No 77 
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=92.97  E-value=0.079  Score=34.36  Aligned_cols=34  Identities=18%  Similarity=0.276  Sum_probs=25.4

Q ss_pred             CCCcCCCCCcccccCC----CCCCceEEcCCCCCeeee
Q 033869            2 EFCPTCGTMLQYELPH----MDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~----~~~~~~~~C~~C~y~~~~   35 (110)
                      .||+.|+++|.|-..-    ..+.+.+.|..||++.-.
T Consensus        57 ~~CkkC~t~Lvpg~n~rvR~~~~~v~vtC~~CG~~~R~   94 (105)
T COG2023          57 TICKKCYTPLVPGKNARVRLRKGRVVVTCLECGTIRRY   94 (105)
T ss_pred             HhccccCcccccCcceEEEEcCCeEEEEecCCCcEEEe
Confidence            4899999999996221    133589999999987543


No 78 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=92.85  E-value=0.092  Score=30.88  Aligned_cols=31  Identities=26%  Similarity=0.730  Sum_probs=23.9

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      =||.||..+.-.  .  ..-.|.|+.||+..+++-
T Consensus        30 ~C~~CG~~~~~~--~--~~r~~~C~~Cg~~~~rD~   60 (69)
T PF07282_consen   30 TCPRCGHRNKKR--R--SGRVFTCPNCGFEMDRDV   60 (69)
T ss_pred             CccCcccccccc--c--ccceEEcCCCCCEECcHH
Confidence            499999988773  2  244899999999877653


No 79 
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=92.79  E-value=0.21  Score=34.85  Aligned_cols=38  Identities=21%  Similarity=0.385  Sum_probs=22.8

Q ss_pred             CCCCCCCceEEEEeccCCCCCC--ceEEEEecCCCCCccccC
Q 033869           71 CPACKHGKAVYHELQTRSADEP--MSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        71 CpkCg~~~a~~~~~Q~RsaDE~--~T~fY~C~~~~C~~~wre  110 (110)
                      ||.||+..+.+.+..+.-.-=+  .-.-|.|.+  |||+..|
T Consensus         1 CP~Cg~~~~~~~~~~~~IP~F~evii~sf~C~~--CGyr~~e   40 (163)
T TIGR00340         1 CPVCGSRTLKAVTYDYDIPYFGKIMLSTYICEK--CGYRSTD   40 (163)
T ss_pred             CCCCCCcceEeeeEeccCCCcceEEEEEEECCC--CCCchhh
Confidence            7888877555544444433333  233478887  8887654


No 80 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=92.78  E-value=0.077  Score=28.65  Aligned_cols=28  Identities=29%  Similarity=0.710  Sum_probs=19.0

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCccc
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      +||.||+...++ -        ..+-.++|.+  ||...
T Consensus         2 ~Cp~Cg~~~~~~-D--------~~~g~~vC~~--CG~Vl   29 (43)
T PF08271_consen    2 KCPNCGSKEIVF-D--------PERGELVCPN--CGLVL   29 (43)
T ss_dssp             SBTTTSSSEEEE-E--------TTTTEEEETT--T-BBE
T ss_pred             CCcCCcCCceEE-c--------CCCCeEECCC--CCCEe
Confidence            699999988322 2        3444579999  98754


No 81 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=92.71  E-value=0.092  Score=43.79  Aligned_cols=24  Identities=25%  Similarity=0.506  Sum_probs=18.3

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      |.+||.||.-....        .-.|..||..
T Consensus         1 M~~Cp~Cg~~n~~~--------akFC~~CG~~   24 (645)
T PRK14559          1 MLICPQCQFENPNN--------NRFCQKCGTS   24 (645)
T ss_pred             CCcCCCCCCcCCCC--------CccccccCCC
Confidence            88999999876444        4578888874


No 82 
>PF14353 CpXC:  CpXC protein
Probab=92.58  E-value=0.2  Score=32.96  Aligned_cols=39  Identities=23%  Similarity=0.612  Sum_probs=27.3

Q ss_pred             ccCCCCCCC-ceEEEEeccCCCC--------CCceEEEEecCCCCCcccc
Q 033869           69 VTCPACKHG-KAVYHELQTRSAD--------EPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        69 ~~CpkCg~~-~a~~~~~Q~RsaD--------E~~T~fY~C~~~~C~~~wr  109 (110)
                      ..||+||+. ++..|+.=.-+.|        +|.--.|+|.+  ||+..+
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l~~~~CP~--Cg~~~~   49 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKILDGSLFSFTCPS--CGHKFR   49 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCcCEEECCC--CCCcee
Confidence            579999985 6777776443333        34445799999  999764


No 83 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=92.55  E-value=0.1  Score=33.48  Aligned_cols=31  Identities=19%  Similarity=0.613  Sum_probs=22.3

Q ss_pred             CCcCCCC-CcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGT-MLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~n-lL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      -||.||+ .|..+.++  +....+|++||+....
T Consensus        23 ~CP~Cge~~v~v~~~k--~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         23 ECPRCGKVSISVKIKK--NIAIITCGNCGLYTEF   54 (99)
T ss_pred             ECCCCCCeEeeeecCC--CcceEECCCCCCccCE
Confidence            4999994 34445333  5789999999987553


No 84 
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=92.45  E-value=0.072  Score=30.15  Aligned_cols=33  Identities=18%  Similarity=0.468  Sum_probs=25.5

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      =|+.||.+|---  .+-..+.+.|+.|+....+..
T Consensus         6 RC~~CnklLa~~--g~~~~leIKCpRC~tiN~~~a   38 (51)
T PF10122_consen    6 RCGHCNKLLAKA--GEVIELEIKCPRCKTINHVRA   38 (51)
T ss_pred             eccchhHHHhhh--cCccEEEEECCCCCccceEec
Confidence            499999999875  334468999999998766544


No 85 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=92.37  E-value=0.19  Score=28.59  Aligned_cols=30  Identities=23%  Similarity=0.834  Sum_probs=21.6

Q ss_pred             CCCCc--CCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            1 MEFCP--TCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         1 M~FCp--~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      +.+||  .|+.++...  .+.....+.|+.|++.
T Consensus        18 ~~~CP~~~C~~~~~~~--~~~~~~~v~C~~C~~~   49 (64)
T smart00647       18 LKWCPAPDCSAAIIVT--EEEGCNRVTCPKCGFS   49 (64)
T ss_pred             ccCCCCCCCcceEEec--CCCCCCeeECCCCCCe
Confidence            35799  999888776  2234568888888875


No 86 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=92.10  E-value=0.14  Score=45.57  Aligned_cols=12  Identities=33%  Similarity=0.830  Sum_probs=8.2

Q ss_pred             cccCCCCCCCce
Q 033869           68 EVTCPACKHGKA   79 (110)
Q Consensus        68 ~~~CpkCg~~~a   79 (110)
                      ...||+||.+-.
T Consensus       709 a~~CP~CGtplv  720 (1337)
T PRK14714        709 RVECPRCDVELT  720 (1337)
T ss_pred             cccCCCCCCccc
Confidence            347999987543


No 87 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=91.83  E-value=0.11  Score=29.60  Aligned_cols=30  Identities=20%  Similarity=0.698  Sum_probs=15.1

Q ss_pred             CCCCcC--CCCCcccccCCCCCCceEEcCCCCCe
Q 033869            1 MEFCPT--CGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         1 M~FCp~--C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      +++||.  |+.++...  .......+.|+.|++.
T Consensus        18 ~~~Cp~~~C~~~~~~~--~~~~~~~~~C~~C~~~   49 (64)
T PF01485_consen   18 IRWCPNPDCEYIIEKD--DGCNSPIVTCPSCGTE   49 (64)
T ss_dssp             CC--TTSST---ECS---SSTTS--CCTTSCCSE
T ss_pred             ccCCCCCCCcccEEec--CCCCCCeeECCCCCCc
Confidence            358977  99998887  3332224888888875


No 88 
>PRK05580 primosome assembly protein PriA; Validated
Probab=91.66  E-value=0.25  Score=41.37  Aligned_cols=10  Identities=30%  Similarity=0.919  Sum_probs=5.7

Q ss_pred             ccCCCCCCCc
Q 033869           69 VTCPACKHGK   78 (110)
Q Consensus        69 ~~CpkCg~~~   78 (110)
                      ..||+||...
T Consensus       422 ~~Cp~Cg~~~  431 (679)
T PRK05580        422 KACPECGSTD  431 (679)
T ss_pred             CCCCCCcCCe
Confidence            3566666654


No 89 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=91.65  E-value=0.14  Score=26.89  Aligned_cols=25  Identities=28%  Similarity=0.777  Sum_probs=19.8

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      |+.|++.+...  .   ...+.|..||.+.
T Consensus        11 C~~C~~~~~~~--~---dG~~yC~~cG~~~   35 (36)
T PF11781_consen   11 CPVCGSRWFYS--D---DGFYYCDRCGHQS   35 (36)
T ss_pred             CCCCCCeEeEc--c---CCEEEhhhCceEc
Confidence            99999996666  2   3499999999763


No 90 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=91.62  E-value=0.13  Score=44.90  Aligned_cols=21  Identities=33%  Similarity=0.752  Sum_probs=16.9

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      +|||.||..+          ..+.|+.||..
T Consensus       627 RfCpsCG~~t----------~~frCP~CG~~  647 (1121)
T PRK04023        627 RKCPSCGKET----------FYRRCPFCGTH  647 (1121)
T ss_pred             ccCCCCCCcC----------CcccCCCCCCC
Confidence            6999999874          25789999965


No 91 
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=91.52  E-value=0.13  Score=35.49  Aligned_cols=36  Identities=31%  Similarity=0.694  Sum_probs=25.0

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceE--EEEecCCCCCcccc
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSI--FYMCANKNCKHRWN  109 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~--fY~C~~~~C~~~wr  109 (110)
                      .||.|+|++-..  +-.|.+++|.++  =-.|.+  |+++|.
T Consensus         2 ~CPfC~~~~tkV--iDSR~~edg~aIRRRReC~~--C~~RFT   39 (156)
T COG1327           2 KCPFCGHEDTKV--IDSRPAEEGNAIRRRRECLE--CGERFT   39 (156)
T ss_pred             CCCCCCCCCCee--eecccccccchhhhhhcccc--cccccc
Confidence            588888876544  446788887664  357877  887764


No 92 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=91.48  E-value=0.17  Score=26.48  Aligned_cols=30  Identities=20%  Similarity=0.625  Sum_probs=20.2

Q ss_pred             CcCCCCCcccccCCC-CCCceEEcCCCCCee
Q 033869            4 CPTCGTMLQYELPHM-DRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~-~~~~~~~C~~C~y~~   33 (110)
                      ||.|+.-..+++++. ..+..+.|++|+.++
T Consensus         5 Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    5 CPNCQAKYEIDDEKIPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             CCCCCCEEeCCHHHCCCCCcEEECCCCCCEe
Confidence            888887766663322 345678888888754


No 93 
>PF12773 DZR:  Double zinc ribbon
Probab=91.37  E-value=0.13  Score=28.40  Aligned_cols=21  Identities=33%  Similarity=0.874  Sum_probs=15.9

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACP   30 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~   30 (110)
                      .+||.||..+.+.        .-.|..||
T Consensus        30 ~~C~~Cg~~~~~~--------~~fC~~CG   50 (50)
T PF12773_consen   30 KICPNCGAENPPN--------AKFCPNCG   50 (50)
T ss_pred             CCCcCCcCCCcCC--------cCccCccc
Confidence            5899999986665        55777776


No 94 
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=91.22  E-value=0.47  Score=26.68  Aligned_cols=34  Identities=18%  Similarity=0.470  Sum_probs=21.9

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      +.||.||.....+. .  +..|.+-.-+|.|.+  |+..
T Consensus         2 kPCPfCGg~~~~~~-~--~~~~~~~~~~~~C~~--Cga~   35 (53)
T TIGR03655         2 KPCPFCGGADVYLR-R--GFDPLDLSHYFECST--CGAS   35 (53)
T ss_pred             CCCCCCCCcceeeE-e--ccCCCCCEEEEECCC--CCCC
Confidence            47999998554342 1  233455566668998  9874


No 95 
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=91.15  E-value=0.13  Score=25.52  Aligned_cols=21  Identities=38%  Similarity=0.842  Sum_probs=10.7

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCP   27 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~   27 (110)
                      +||.||+-|.-.++    .-.+.|.
T Consensus         1 ~CP~C~s~l~~~~~----ev~~~C~   21 (28)
T PF03119_consen    1 TCPVCGSKLVREEG----EVDIRCP   21 (28)
T ss_dssp             B-TTT--BEEE-CC----TTCEEE-
T ss_pred             CcCCCCCEeEcCCC----CEeEECC
Confidence            69999999996522    2266665


No 96 
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=91.10  E-value=0.17  Score=29.27  Aligned_cols=24  Identities=33%  Similarity=0.741  Sum_probs=18.2

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      ..||+||++..+         ..+|..|||-..
T Consensus        28 ~~C~~CG~~~~~---------H~vC~~CG~Y~g   51 (57)
T PRK12286         28 VECPNCGEPKLP---------HRVCPSCGYYKG   51 (57)
T ss_pred             eECCCCCCccCC---------eEECCCCCcCCC
Confidence            469999988766         578999997543


No 97 
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=91.07  E-value=0.22  Score=35.49  Aligned_cols=28  Identities=21%  Similarity=0.514  Sum_probs=23.6

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      -|++|+..|..+      ...+.|++||+++..+
T Consensus       151 ~CsrC~~~L~~~------~~~l~Cp~Cg~tEkRK  178 (188)
T COG1096         151 RCSRCRAPLVKK------GNMLKCPNCGNTEKRK  178 (188)
T ss_pred             EccCCCcceEEc------CcEEECCCCCCEEeee
Confidence            499999999986      4599999999987653


No 98 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=90.94  E-value=0.31  Score=40.88  Aligned_cols=14  Identities=21%  Similarity=0.508  Sum_probs=7.4

Q ss_pred             ccCCCCCCCceEEE
Q 033869           69 VTCPACKHGKAVYH   82 (110)
Q Consensus        69 ~~CpkCg~~~a~~~   82 (110)
                      ..||+||+....++
T Consensus       423 ~~Cp~Cgs~~l~~~  436 (665)
T PRK14873        423 WRCPRCGSDRLRAV  436 (665)
T ss_pred             ccCCCCcCCcceee
Confidence            35666666544433


No 99 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=90.87  E-value=0.14  Score=35.91  Aligned_cols=29  Identities=28%  Similarity=0.746  Sum_probs=22.0

Q ss_pred             eEEcCCCCCeeeeCCceEEEEecccCccccccccccccccCCCCCcccCCCCCCCceEE
Q 033869           23 RFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMMEGPQTEVTCPACKHGKAVY   81 (110)
Q Consensus        23 ~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CpkCg~~~a~~   81 (110)
                      .|+|+.|||...- .                             ....||-||+.+..|
T Consensus       134 ~~vC~vCGy~~~g-e-----------------------------~P~~CPiCga~k~~F  162 (166)
T COG1592         134 VWVCPVCGYTHEG-E-----------------------------APEVCPICGAPKEKF  162 (166)
T ss_pred             EEEcCCCCCcccC-C-----------------------------CCCcCCCCCChHHHh
Confidence            8999999996442 1                             134799999987766


No 100
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=90.78  E-value=0.24  Score=31.10  Aligned_cols=29  Identities=21%  Similarity=0.579  Sum_probs=21.5

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      -||.|+.- ..+  +. ...+|.|+.||++.--
T Consensus        37 ~Cp~C~~~-~Vk--R~-a~GIW~C~kCg~~fAG   65 (89)
T COG1997          37 VCPFCGRT-TVK--RI-ATGIWKCRKCGAKFAG   65 (89)
T ss_pred             cCCCCCCc-cee--ee-ccCeEEcCCCCCeecc
Confidence            59999998 444  22 2469999999998653


No 101
>PF09526 DUF2387:  Probable metal-binding protein (DUF2387);  InterPro: IPR012658 Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various proteobacteria.
Probab=90.57  E-value=0.21  Score=30.14  Aligned_cols=35  Identities=20%  Similarity=0.441  Sum_probs=24.9

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -||.|+.|=.+.--.+++.....|-.|||.....+
T Consensus        10 ~CP~C~~~D~i~~~~e~~ve~vECV~CGy~e~~~~   44 (71)
T PF09526_consen   10 VCPKCQAMDTIMMWRENGVEYVECVECGYTERQPD   44 (71)
T ss_pred             cCCCCcCccEEEEEEeCCceEEEecCCCCeeccCC
Confidence            39999988333211334467999999999987766


No 102
>COG0551 TopA Zn-finger domain associated with topoisomerase type I [DNA replication, recombination, and repair]
Probab=90.53  E-value=1.2  Score=29.69  Aligned_cols=37  Identities=30%  Similarity=0.609  Sum_probs=21.1

Q ss_pred             CCcccCCCCCCCceEEEEeccCCCCCCceEEEEecC-CCCCccc
Q 033869           66 QTEVTCPACKHGKAVYHELQTRSADEPMSIFYMCAN-KNCKHRW  108 (110)
Q Consensus        66 ~~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~-~~C~~~w  108 (110)
                      .+.+.||+||....+.     |.+.-+ ..||.|.+ |.|.+.+
T Consensus        58 ~~~~~Cp~C~~~~~~~-----k~~~~~-~~f~~~~~~Pkc~~~~   95 (140)
T COG0551          58 KTGVKCPKCGKGLLVL-----KKGRFG-KNFLGCSNYPKCRFTE   95 (140)
T ss_pred             cCceeCCCCCCCceEE-----EeccCC-ceEEeecCCCcCceee
Confidence            3577899999744433     222222 67887754 2355544


No 103
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=90.53  E-value=0.16  Score=31.41  Aligned_cols=31  Identities=19%  Similarity=0.523  Sum_probs=18.7

Q ss_pred             CcCCCC--CcccccCCCCCCceEEcCCCCCeee
Q 033869            4 CPTCGT--MLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         4 Cp~C~n--lL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      ||.||+  -+..+.++......+.|+.||....
T Consensus        25 CPfC~~~~sV~v~idkk~~~~~~~C~~Cg~~~~   57 (81)
T PF05129_consen   25 CPFCNHEKSVSVKIDKKEGIGILSCRVCGESFQ   57 (81)
T ss_dssp             -TTT--SS-EEEEEETTTTEEEEEESSS--EEE
T ss_pred             CCcCCCCCeEEEEEEccCCEEEEEecCCCCeEE
Confidence            888883  3666666667778899999987654


No 104
>PRK00420 hypothetical protein; Validated
Probab=90.46  E-value=0.3  Score=32.08  Aligned_cols=30  Identities=30%  Similarity=0.538  Sum_probs=22.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -||.||.-|.--  +   .....|++||....+.+
T Consensus        25 ~CP~Cg~pLf~l--k---~g~~~Cp~Cg~~~~v~~   54 (112)
T PRK00420         25 HCPVCGLPLFEL--K---DGEVVCPVHGKVYIVKS   54 (112)
T ss_pred             CCCCCCCcceec--C---CCceECCCCCCeeeecc
Confidence            599999888763  1   34899999998766544


No 105
>KOG2907 consensus RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12 [Transcription]
Probab=90.18  E-value=0.31  Score=31.99  Aligned_cols=32  Identities=31%  Similarity=0.780  Sum_probs=22.4

Q ss_pred             CCcCCCCC------cccccCCCCCCceEEcCCCCCeee
Q 033869            3 FCPTCGTM------LQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         3 FCp~C~nl------L~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      -||.||+-      |..+...++....|.|.+|+|.+.
T Consensus        76 kCpkCghe~m~Y~T~QlRSADEGQTVFYTC~kC~~k~~  113 (116)
T KOG2907|consen   76 KCPKCGHEEMSYHTLQLRSADEGQTVFYTCPKCKYKFT  113 (116)
T ss_pred             cCcccCCchhhhhhhhcccccCCceEEEEcCccceeee
Confidence            49999963      445533345567899999999764


No 106
>TIGR02443 conserved hypothetical metal-binding protein. Members of this family are small proteins, about 70 residues in length, with a basic triplet near the N-terminus and a probable metal-binding motif CPXCX(18)CXXC. Members are found in various Proteobacteria.
Probab=90.13  E-value=0.24  Score=28.88  Aligned_cols=35  Identities=17%  Similarity=0.441  Sum_probs=24.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -||.|+.|=.+.--.++......|-.|||.+..++
T Consensus        11 ~CP~C~~~Dtl~~~~e~~~e~vECv~Cg~~~~~~~   45 (59)
T TIGR02443        11 VCPACSAQDTLAMWKENNIELVECVECGYQEQQKD   45 (59)
T ss_pred             cCCCCcCccEEEEEEeCCceEEEeccCCCccccCC
Confidence            39999987333222344556899999999987665


No 107
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=89.92  E-value=0.57  Score=31.51  Aligned_cols=16  Identities=13%  Similarity=0.449  Sum_probs=13.4

Q ss_pred             CceEEcCCCCCeeeeC
Q 033869           21 PSRFSCPACPYVCNME   36 (110)
Q Consensus        21 ~~~~~C~~C~y~~~~~   36 (110)
                      ...+.|+.||+.....
T Consensus        68 p~~~~C~~CG~~~~~~   83 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK   83 (135)
T ss_pred             ceEEECCCCCCEEecc
Confidence            4689999999988765


No 108
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=89.89  E-value=0.32  Score=33.34  Aligned_cols=16  Identities=19%  Similarity=0.584  Sum_probs=12.4

Q ss_pred             CCceEEcCCCCCeeee
Q 033869           20 RPSRFSCPACPYVCNM   35 (110)
Q Consensus        20 ~~~~~~C~~C~y~~~~   35 (110)
                      +...|+|.+||+....
T Consensus       109 g~G~l~C~~Cg~~~~~  124 (146)
T PF07295_consen  109 GPGTLVCENCGHEVEL  124 (146)
T ss_pred             cCceEecccCCCEEEe
Confidence            3568999999987544


No 109
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=89.81  E-value=0.57  Score=32.49  Aligned_cols=38  Identities=29%  Similarity=0.467  Sum_probs=22.7

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceE--EEEecCCCCCccccC
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSI--FYMCANKNCKHRWNE  110 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~--fY~C~~~~C~~~wre  110 (110)
                      .||.||++ ...-...+.-..-+-.+  -|.|.+  |||+..|
T Consensus         2 ~Cp~C~~~-~~~~~~~~~IP~F~evii~sf~C~~--CGyk~~e   41 (160)
T smart00709        2 DCPSCGGN-GTTRMLLTSIPYFREVIIMSFECEH--CGYRNNE   41 (160)
T ss_pred             cCCCCCCC-CEEEEEEecCCCcceEEEEEEECCC--CCCccce
Confidence            48888865 34444445444444333  478887  8887654


No 110
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=89.63  E-value=0.25  Score=27.66  Aligned_cols=31  Identities=13%  Similarity=0.337  Sum_probs=22.8

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      +.||+.||+-|.....+ ....+|.|++....
T Consensus         5 ~l~C~~CG~~m~~~~~~-~~~~yy~C~~~~~~   35 (58)
T PF13408_consen    5 LLRCGHCGSKMTRRKRK-GKYRYYRCSNRRRK   35 (58)
T ss_pred             cEEcccCCcEeEEEECC-CCceEEEcCCCcCC
Confidence            46899999999987333 44578999877643


No 111
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=89.52  E-value=0.46  Score=24.11  Aligned_cols=26  Identities=35%  Similarity=0.740  Sum_probs=21.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      -|..|+++|..+  .+  ...+.|..|...
T Consensus         3 ~C~~C~t~L~yP--~g--A~~vrCs~C~~v   28 (31)
T TIGR01053         3 VCGGCRTLLMYP--RG--ASSVRCALCQTV   28 (31)
T ss_pred             CcCCCCcEeecC--CC--CCeEECCCCCeE
Confidence            489999999888  44  458999999865


No 112
>PF06827 zf-FPG_IleRS:  Zinc finger found in FPG and IleRS;  InterPro: IPR010663 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger domain found at the C-terminal in both DNA glycosylase/AP lyase enzymes and in isoleucyl tRNA synthetase. In these two types of enzymes, the C-terminal domain forms a zinc finger. Some related proteins may not bind zinc.  DNA glycosylase/AP lyase enzymes are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. These enzymes have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC) []. Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines []. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above, but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine [, ].  An Fpg-type zinc finger is also found at the C terminus of isoleucyl tRNA synthetase (6.1.1.5 from EC) [, ]. This enzyme catalyses the attachment of isoleucine to tRNA(Ile). As IleRS can inadvertently accommodate and process structurally similar amino acids such as valine, to avoid such errors it has two additional distinct tRNA(Ile)-dependent editing activities. One activity is designated as 'pre-transfer' editing and involves the hydrolysis of activated Val-AMP. The other activity is designated 'post-transfer' editing and involves deacylation of mischarged Val-tRNA(Ile) [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003824 catalytic activity; PDB: 1K82_C 1Q39_A 2OQ4_B 2OPF_A 1K3X_A 1K3W_A 1Q3B_A 2EA0_A 1Q3C_A 2XZF_A ....
Probab=89.40  E-value=0.16  Score=25.21  Aligned_cols=27  Identities=26%  Similarity=0.698  Sum_probs=17.3

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      =||.|++.+...  ..+....+.|+.|..
T Consensus         3 ~C~rC~~~~~~~--~~~~r~~~~C~rCq~   29 (30)
T PF06827_consen    3 KCPRCWNYIEDI--GINGRSTYLCPRCQK   29 (30)
T ss_dssp             B-TTT--BBEEE--EETTEEEEE-TTTCC
T ss_pred             cCccCCCcceEe--EecCCCCeECcCCcC
Confidence            389999998776  445677899999963


No 113
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=89.34  E-value=0.074  Score=40.18  Aligned_cols=30  Identities=30%  Similarity=0.605  Sum_probs=23.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      =||.|+.+|+.++-   ..+.++|+.|||-...
T Consensus        28 ~c~~c~~~~~~~~l---~~~~~vc~~c~~h~rl   57 (285)
T TIGR00515        28 KCPKCGQVLYTKEL---ERNLEVCPKCDHHMRM   57 (285)
T ss_pred             ECCCCcchhhHHHH---HhhCCCCCCCCCcCcC
Confidence            49999999999832   2346899999997654


No 114
>COG4640 Predicted membrane protein [Function unknown]
Probab=89.27  E-value=0.2  Score=39.58  Aligned_cols=26  Identities=31%  Similarity=0.806  Sum_probs=17.8

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      |+|||.||+-=.-        ..+.|..||....
T Consensus         1 M~fC~kcG~qk~E--------d~~qC~qCG~~~t   26 (465)
T COG4640           1 MKFCPKCGSQKAE--------DDVQCTQCGHKFT   26 (465)
T ss_pred             CCccccccccccc--------ccccccccCCcCC
Confidence            9999999953111        1333999998643


No 115
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=89.21  E-value=0.37  Score=38.71  Aligned_cols=52  Identities=25%  Similarity=0.604  Sum_probs=32.1

Q ss_pred             CCceEEcCCCCCeeeeCCceEEEEecccCccccccccccccccC-CCCCcccCCCCCCCceEEEEe
Q 033869           20 RPSRFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMME-GPQTEVTCPACKHGKAVYHEL   84 (110)
Q Consensus        20 ~~~~~~C~~C~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~CpkCg~~~a~~~~~   84 (110)
                      ....|.|+.|||+++....           +....|..+ ..+. +|- ++.||.||..+..|-.+
T Consensus       422 ~~~~~~c~~c~~~yd~~~g-----------~~~~~~~~g-t~~~~lp~-~~~cp~c~~~k~~f~~~  474 (479)
T PRK05452        422 LGPRMQCSVCQWIYDPAKG-----------EPMQDVAPG-TPWSEVPD-NFLCPECSLGKDVFDEL  474 (479)
T ss_pred             CCCeEEECCCCeEECCCCC-----------CcccCCCCC-CChhhCCC-CCcCcCCCCcHHHhEec
Confidence            3568999999998875431           001112211 1223 553 88999999998876544


No 116
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=89.11  E-value=0.072  Score=40.49  Aligned_cols=31  Identities=19%  Similarity=0.399  Sum_probs=23.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      =||.|+.+|+.++-.   .+.++|+.|+|-...+
T Consensus        40 kc~~C~~~~~~~~l~---~~~~vcp~c~~h~rlt   70 (296)
T CHL00174         40 QCENCYGLNYKKFLK---SKMNICEQCGYHLKMS   70 (296)
T ss_pred             ECCCccchhhHHHHH---HcCCCCCCCCCCcCCC
Confidence            499999999998322   4579999999965443


No 117
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=89.08  E-value=0.21  Score=26.20  Aligned_cols=28  Identities=25%  Similarity=0.541  Sum_probs=17.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      .|++||+.......... .....|+.||.
T Consensus         7 ~C~~Cg~~fe~~~~~~~-~~~~~CP~Cg~   34 (41)
T smart00834        7 RCEDCGHTFEVLQKISD-DPLATCPECGG   34 (41)
T ss_pred             EcCCCCCEEEEEEecCC-CCCCCCCCCCC
Confidence            48888885544321211 45677888886


No 118
>COG2051 RPS27A Ribosomal protein S27E [Translation, ribosomal structure and biogenesis]
Probab=88.99  E-value=0.3  Score=29.15  Aligned_cols=30  Identities=27%  Similarity=0.665  Sum_probs=22.6

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      .+++||.|||...+|--.|+         --.|..  ||..
T Consensus        18 l~VkCpdC~N~q~vFshast---------~V~C~~--CG~~   47 (67)
T COG2051          18 LRVKCPDCGNEQVVFSHAST---------VVTCLI--CGTT   47 (67)
T ss_pred             EEEECCCCCCEEEEeccCce---------EEEecc--cccE
Confidence            37899999999999955443         257877  8753


No 119
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=88.90  E-value=0.51  Score=24.72  Aligned_cols=33  Identities=21%  Similarity=0.539  Sum_probs=22.1

Q ss_pred             CCCcccCCCCCCCceEEEEeccCCCCCCceEEEEecC
Q 033869           65 PQTEVTCPACKHGKAVYHELQTRSADEPMSIFYMCAN  101 (110)
Q Consensus        65 ~~~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~  101 (110)
                      +++++.||.|+..+.++-.=+.   ..|-. =|.|..
T Consensus         2 a~i~v~CP~C~s~~~v~k~G~~---~~G~q-ryrC~~   34 (36)
T PF03811_consen    2 AKIDVHCPRCQSTEGVKKNGKS---PSGHQ-RYRCKD   34 (36)
T ss_pred             CcEeeeCCCCCCCCcceeCCCC---CCCCE-eEecCc
Confidence            4578999999999977744332   22333 377776


No 120
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=88.83  E-value=0.13  Score=38.86  Aligned_cols=31  Identities=29%  Similarity=0.623  Sum_probs=24.5

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      =||.|+.|||-++-   ..+.++|++|+|-..+.
T Consensus        30 KCp~c~~~~y~~eL---~~n~~vcp~c~~h~ri~   60 (294)
T COG0777          30 KCPSCGEMLYRKEL---ESNLKVCPKCGHHMRIS   60 (294)
T ss_pred             ECCCccceeeHHHH---HhhhhcccccCcccccC
Confidence            49999999999832   35689999999965543


No 121
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=88.54  E-value=0.43  Score=27.23  Aligned_cols=27  Identities=22%  Similarity=0.519  Sum_probs=17.8

Q ss_pred             CcCCC--CCcccccCCCCCCceEEcCCCCCe
Q 033869            4 CPTCG--TMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         4 Cp~C~--nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      |+.|.  |=|.++  .+.....|.|+.||+.
T Consensus        25 C~~C~~hNGla~~--~~~~~i~y~C~~Cg~~   53 (54)
T PF10058_consen   25 CSKCFSHNGLAPK--EEFEEIQYRCPYCGAL   53 (54)
T ss_pred             Ccccchhhccccc--ccCCceEEEcCCCCCc
Confidence            67776  446665  3444568888888863


No 122
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=88.53  E-value=0.3  Score=27.99  Aligned_cols=23  Identities=35%  Similarity=0.883  Sum_probs=16.4

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      ..||+||++..+         ..+|..|||-.
T Consensus        27 ~~C~~cG~~~~~---------H~vc~~cG~Y~   49 (55)
T TIGR01031        27 VVCPNCGEFKLP---------HRVCPSCGYYK   49 (55)
T ss_pred             eECCCCCCcccC---------eeECCccCeEC
Confidence            358888886554         57888888643


No 123
>PF11792 Baculo_LEF5_C:  Baculoviridae late expression factor 5 C-terminal domain;  InterPro: IPR021758  This C-terminal domain is likely to be a zinc-binding domain. 
Probab=88.35  E-value=0.019  Score=31.38  Aligned_cols=30  Identities=40%  Similarity=0.674  Sum_probs=23.3

Q ss_pred             CCCCceEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           74 CKHGKAVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        74 Cg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      |.|.= +.-..|+|+.||.-+.+=.|.+  |+.
T Consensus        13 C~H~f-~~~E~Q~RAGDE~VSfI~~C~~--C~~   42 (43)
T PF11792_consen   13 CKHKF-VTIEKQLRAGDEAVSFIKYCQK--CGQ   42 (43)
T ss_pred             ceeee-eehhhhhcccchHHHHHHHHHH--hCC
Confidence            65543 3556899999999888888888  875


No 124
>PRK06319 DNA topoisomerase I/SWI domain fusion protein; Validated
Probab=88.34  E-value=1.1  Score=38.75  Aligned_cols=33  Identities=30%  Similarity=0.715  Sum_probs=19.3

Q ss_pred             CcccCCC--CCCCceEEEEeccCCCCCCceEEEEecC-CCCCc
Q 033869           67 TEVTCPA--CKHGKAVYHELQTRSADEPMSIFYMCAN-KNCKH  106 (110)
Q Consensus        67 ~~~~Cpk--Cg~~~a~~~~~Q~RsaDE~~T~fY~C~~-~~C~~  106 (110)
                      +...||+  ||..   ...   |..--| ..||.|.+ +.|.+
T Consensus       692 ~~~~CP~~~C~g~---l~~---r~gr~G-~~f~~Cs~yp~C~~  727 (860)
T PRK06319        692 ETVPCPAIGCTGH---IVK---RRSRFN-KMFYSCSEYPACSV  727 (860)
T ss_pred             cCCCCCCcCCCCc---EEE---EecCCC-CeeeccCCCCCCce
Confidence            4568997  5642   222   333334 45888975 66875


No 125
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=88.30  E-value=0.15  Score=26.52  Aligned_cols=21  Identities=33%  Similarity=0.719  Sum_probs=12.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      -|+.||.+..|+        ...|+.|+-
T Consensus        13 rC~~Cg~~~~pP--------r~~Cp~C~s   33 (37)
T PF12172_consen   13 RCRDCGRVQFPP--------RPVCPHCGS   33 (37)
T ss_dssp             E-TTT--EEES----------SEETTTT-
T ss_pred             EcCCCCCEecCC--------CcCCCCcCc
Confidence            588999998888        568888873


No 126
>PF04032 Rpr2:  RNAse P Rpr2/Rpp21/SNM1 subunit domain;  InterPro: IPR007175 This family contains a ribonuclease P subunit of human and yeast. Other members of the family include the probable archaeal homologues. This subunit possibly binds the precursor tRNA [].; PDB: 2K3R_A 2KI7_B 2ZAE_B 1X0T_A.
Probab=88.26  E-value=0.2  Score=30.50  Aligned_cols=29  Identities=21%  Similarity=0.564  Sum_probs=14.3

Q ss_pred             CCCcCCCCCcccccCC---------CCCCceEEcCCCC
Q 033869            2 EFCPTCGTMLQYELPH---------MDRPSRFSCPACP   30 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~---------~~~~~~~~C~~C~   30 (110)
                      .||..||++|.|-...         ....+.+.|..||
T Consensus        47 ~~Ck~C~~~liPG~~~~vri~~~~~~~~~l~~~C~~C~   84 (85)
T PF04032_consen   47 TICKKCGSLLIPGVNCSVRIRKKKKKKNFLVYTCLNCG   84 (85)
T ss_dssp             TB-TTT--B--CTTTEEEEEE---SSS-EEEEEETTTT
T ss_pred             ccccCCCCEEeCCCccEEEEEecCCCCCEEEEEccccC
Confidence            4899999998886221         1335566777776


No 127
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=88.19  E-value=0.19  Score=30.56  Aligned_cols=9  Identities=56%  Similarity=1.693  Sum_probs=4.5

Q ss_pred             CCCcCCCCC
Q 033869            2 EFCPTCGTM   10 (110)
Q Consensus         2 ~FCp~C~nl   10 (110)
                      .|||.|||-
T Consensus        25 ~FCp~CGn~   33 (73)
T PF08772_consen   25 QFCPKCGNA   33 (73)
T ss_dssp             -S-SSS--S
T ss_pred             eeCcccCCC
Confidence            599999986


No 128
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=87.92  E-value=0.48  Score=25.60  Aligned_cols=23  Identities=35%  Similarity=0.892  Sum_probs=17.5

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACP   30 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~   30 (110)
                      .||.||..|.-.  ++   ....|..|+
T Consensus        19 ~Cp~C~~PL~~~--k~---g~~~Cv~C~   41 (41)
T PF06677_consen   19 HCPDCGTPLMRD--KD---GKIYCVSCG   41 (41)
T ss_pred             ccCCCCCeeEEe--cC---CCEECCCCC
Confidence            699999888874  32   367899885


No 129
>KOG3507 consensus DNA-directed RNA polymerase, subunit RPB7.0 [Transcription]
Probab=87.90  E-value=0.32  Score=28.36  Aligned_cols=25  Identities=24%  Similarity=0.664  Sum_probs=16.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      -|-+||.-+.++  +   +..+.||-|||.
T Consensus        22 iCgdC~~en~lk--~---~D~irCReCG~R   46 (62)
T KOG3507|consen   22 ICGDCGQENTLK--R---GDVIRCRECGYR   46 (62)
T ss_pred             Eecccccccccc--C---CCcEehhhcchH
Confidence            367777666665  2   346777777774


No 130
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=87.76  E-value=0.53  Score=27.55  Aligned_cols=30  Identities=30%  Similarity=0.692  Sum_probs=23.2

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCccc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      +-..||.||+....          ......|.|.+  ||+.+
T Consensus        27 TSq~C~~CG~~~~~----------~~~~r~~~C~~--Cg~~~   56 (69)
T PF07282_consen   27 TSQTCPRCGHRNKK----------RRSGRVFTCPN--CGFEM   56 (69)
T ss_pred             CccCccCccccccc----------ccccceEEcCC--CCCEE
Confidence            67789999986553          24556799999  99876


No 131
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=87.52  E-value=0.13  Score=39.04  Aligned_cols=31  Identities=26%  Similarity=0.596  Sum_probs=23.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      =||.|+.+++.++-.   .+.++|+.|||-....
T Consensus        29 ~c~~c~~~~~~~~l~---~~~~vc~~c~~h~rl~   59 (292)
T PRK05654         29 KCPSCGQVLYRKELE---ANLNVCPKCGHHMRIS   59 (292)
T ss_pred             ECCCccchhhHHHHH---hcCCCCCCCCCCeeCC
Confidence            499999999998322   3468999999976543


No 132
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=87.41  E-value=0.59  Score=30.72  Aligned_cols=23  Identities=39%  Similarity=0.989  Sum_probs=20.4

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      ||-||.-|.+.        .+.|..|+....
T Consensus         1 CPvCg~~l~vt--------~l~C~~C~t~i~   23 (113)
T PF09862_consen    1 CPVCGGELVVT--------RLKCPSCGTEIE   23 (113)
T ss_pred             CCCCCCceEEE--------EEEcCCCCCEEE
Confidence            99999999998        899999998643


No 133
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=87.28  E-value=0.57  Score=25.60  Aligned_cols=25  Identities=24%  Similarity=0.636  Sum_probs=19.3

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      |.+||.-..++  .   ...+.|+.||+..
T Consensus         5 C~~Cg~~~~~~--~---~~~irC~~CG~rI   29 (44)
T smart00659        5 CGECGRENEIK--S---KDVVRCRECGYRI   29 (44)
T ss_pred             CCCCCCEeecC--C---CCceECCCCCceE
Confidence            88999877665  2   3579999999853


No 134
>PRK11032 hypothetical protein; Provisional
Probab=87.09  E-value=0.59  Score=32.53  Aligned_cols=16  Identities=13%  Similarity=0.314  Sum_probs=12.0

Q ss_pred             CCceEEcCCCCCeeee
Q 033869           20 RPSRFSCPACPYVCNM   35 (110)
Q Consensus        20 ~~~~~~C~~C~y~~~~   35 (110)
                      +...++|.+||+...+
T Consensus       121 g~G~LvC~~Cg~~~~~  136 (160)
T PRK11032        121 GLGNLVCEKCHHHLAF  136 (160)
T ss_pred             ecceEEecCCCCEEEe
Confidence            3568999999986543


No 135
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=87.08  E-value=0.44  Score=35.19  Aligned_cols=26  Identities=38%  Similarity=1.016  Sum_probs=20.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      =||.||. |.        .-.+.|+.||++.+++-
T Consensus       311 ~C~~cg~-~~--------~r~~~C~~cg~~~~rD~  336 (364)
T COG0675         311 TCPCCGH-LS--------GRLFKCPRCGFVHDRDV  336 (364)
T ss_pred             cccccCC-cc--------ceeEECCCCCCeehhhH
Confidence            4999999 22        23899999999988875


No 136
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=86.83  E-value=0.87  Score=23.36  Aligned_cols=27  Identities=19%  Similarity=0.252  Sum_probs=20.0

Q ss_pred             CCcCCCCCccc-ccCCCCCCceEEcCCCCCeee
Q 033869            3 FCPTCGTMLQY-ELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         3 FCp~C~nlL~~-~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      -|+.||.-+.. +   +  +.++.|..||.+++
T Consensus         5 ~C~~C~~~~i~~~---~--~~~~~C~~Cg~~~~   32 (33)
T PF08792_consen    5 KCSKCGGNGIVNK---E--DDYEVCIFCGSSFP   32 (33)
T ss_pred             EcCCCCCCeEEEe---c--CCeEEcccCCcEee
Confidence            48889866655 4   1  45999999998764


No 137
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=86.20  E-value=0.69  Score=26.53  Aligned_cols=34  Identities=24%  Similarity=0.614  Sum_probs=26.1

Q ss_pred             CCcCCCCC--cccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTM--LQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nl--L~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      .||-|||-  +.+++|..-...-+.|+.|..+.-++
T Consensus         6 ~CP~CgnKTR~kir~DT~LkNfPlyCpKCK~EtlI~   41 (55)
T PF14205_consen    6 LCPICGNKTRLKIREDTVLKNFPLYCPKCKQETLID   41 (55)
T ss_pred             ECCCCCCccceeeecCceeccccccCCCCCceEEEE
Confidence            69999964  67776666667789999999876544


No 138
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=85.93  E-value=0.26  Score=35.32  Aligned_cols=37  Identities=19%  Similarity=0.497  Sum_probs=24.3

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      +...||.||..+. -+.+ ++.  .|....+.|.+  ||+.|+
T Consensus         5 iy~~Cp~Cg~eev-~hEV-ik~--~g~~~lvrC~e--CG~V~~   41 (201)
T COG1326           5 IYIECPSCGSEEV-SHEV-IKE--RGREPLVRCEE--CGTVHP   41 (201)
T ss_pred             EEEECCCCCcchh-hHHH-HHh--cCCceEEEccC--CCcEee
Confidence            4578999994443 1111 121  34558899999  999995


No 139
>PHA02942 putative transposase; Provisional
Probab=85.82  E-value=0.7  Score=36.22  Aligned_cols=31  Identities=29%  Similarity=0.712  Sum_probs=23.0

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      +-||.||......   .  .-.|.|..||+..+.+-
T Consensus       326 q~Cs~CG~~~~~l---~--~r~f~C~~CG~~~drD~  356 (383)
T PHA02942        326 VSCPKCGHKMVEI---A--HRYFHCPSCGYENDRDV  356 (383)
T ss_pred             ccCCCCCCccCcC---C--CCEEECCCCCCEeCcHH
Confidence            4699999876421   1  23799999999987764


No 140
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=85.60  E-value=0.43  Score=30.16  Aligned_cols=29  Identities=21%  Similarity=0.449  Sum_probs=22.0

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      .+||.||..-.-+  .  ...+|.|+.|++..-
T Consensus        36 y~Cp~Cgk~~vkR--~--a~GIW~C~~C~~~~A   64 (90)
T PF01780_consen   36 YTCPFCGKTSVKR--V--ATGIWKCKKCGKKFA   64 (90)
T ss_dssp             BEESSSSSSEEEE--E--ETTEEEETTTTEEEE
T ss_pred             CcCCCCCCceeEE--e--eeEEeecCCCCCEEe
Confidence            3799999988555  2  245899999998754


No 141
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=85.16  E-value=0.85  Score=26.66  Aligned_cols=10  Identities=20%  Similarity=0.434  Sum_probs=5.4

Q ss_pred             EEcCCCCCee
Q 033869           24 FSCPACPYVC   33 (110)
Q Consensus        24 ~~C~~C~y~~   33 (110)
                      -+|..||-..
T Consensus        10 ~~CtSCg~~i   19 (61)
T COG2888          10 PVCTSCGREI   19 (61)
T ss_pred             ceeccCCCEe
Confidence            3566666544


No 142
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=85.01  E-value=1.7  Score=31.04  Aligned_cols=39  Identities=23%  Similarity=0.527  Sum_probs=21.5

Q ss_pred             cCCCCCCC-ceEEEEec-cCCCCCCceEEEEecCCCCCccccC
Q 033869           70 TCPACKHG-KAVYHELQ-TRSADEPMSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        70 ~CpkCg~~-~a~~~~~Q-~RsaDE~~T~fY~C~~~~C~~~wre  110 (110)
                      .||.||.+ ........ +=--.|=+-.-|.|.+  |||+.+|
T Consensus         2 ~Cp~C~~~~~~~~~~~~~IP~F~evii~sf~C~~--CGyr~~e   42 (192)
T TIGR00310         2 DCPSCGGECETVMKTVNDIPYFGEVLETSTICEH--CGYRSND   42 (192)
T ss_pred             cCCCCCCCCEEEEEEEcCCCCcceEEEEEEECCC--CCCccce
Confidence            58999864 33333333 1111222334588888  9888764


No 143
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=84.89  E-value=1.1  Score=28.43  Aligned_cols=13  Identities=31%  Similarity=0.851  Sum_probs=7.6

Q ss_pred             CceEEcCCCCCee
Q 033869           21 PSRFSCPACPYVC   33 (110)
Q Consensus        21 ~~~~~C~~C~y~~   33 (110)
                      .+.|.|.+|+|.+
T Consensus        88 T~fy~C~~C~~~w  100 (104)
T TIGR01384        88 TRFYKCTKCGYVW  100 (104)
T ss_pred             EEEEEeCCCCCee
Confidence            4556666666654


No 144
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=84.87  E-value=0.28  Score=25.10  Aligned_cols=25  Identities=24%  Similarity=0.676  Sum_probs=17.0

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      |.+||.....+  ..   ..+.|+.|||..
T Consensus         3 C~~Cg~~~~~~--~~---~~irC~~CG~RI   27 (32)
T PF03604_consen    3 CGECGAEVELK--PG---DPIRCPECGHRI   27 (32)
T ss_dssp             ESSSSSSE-BS--TS---STSSBSSSS-SE
T ss_pred             CCcCCCeeEcC--CC---CcEECCcCCCeE
Confidence            78999887766  22   357999999853


No 145
>PF09082 DUF1922:  Domain of unknown function (DUF1922);  InterPro: IPR015166 Members of this family consist of a beta-sheet region followed by an alpha-helix and an unstructured C terminus. The beta-sheet region contains a CXCX...XCXC sequence with Cys residues located in two proximal loops and pointing towards each other. This precise function of this set of bacterial proteins is, as yet, unknown []. ; PDB: 1GH9_A.
Probab=84.66  E-value=0.66  Score=27.81  Aligned_cols=28  Identities=21%  Similarity=0.534  Sum_probs=18.9

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      | .||+.||.+++    .-.=.| .||+.-.++.
T Consensus         6 C-~Cgr~lya~e~----~kTkkC-~CG~~l~vk~   33 (68)
T PF09082_consen    6 C-DCGRYLYAKEG----AKTKKC-VCGKTLKVKE   33 (68)
T ss_dssp             E-TTS--EEEETT-----SEEEE-TTTEEEE--S
T ss_pred             e-cCCCEEEecCC----cceeEe-cCCCeeeeee
Confidence            7 79999999933    337899 9999887766


No 146
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=84.65  E-value=1.2  Score=25.89  Aligned_cols=8  Identities=25%  Similarity=0.758  Sum_probs=4.3

Q ss_pred             EEcCCCCC
Q 033869           24 FSCPACPY   31 (110)
Q Consensus        24 ~~C~~C~y   31 (110)
                      .+|..||-
T Consensus         8 ~~CtSCg~   15 (59)
T PRK14890          8 PKCTSCGI   15 (59)
T ss_pred             ccccCCCC
Confidence            35556654


No 147
>PF06943 zf-LSD1:  LSD1 zinc finger;  InterPro: IPR005735 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC []. This domain may play a role in the regulation of transcription, via either repression of a prodeath pathway or activation of an antideath pathway, in response to signals emanating from cells undergoing pathogen-induced hypersensitive cell death. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].
Probab=84.54  E-value=1.1  Score=21.70  Aligned_cols=25  Identities=32%  Similarity=0.755  Sum_probs=19.1

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      |..|..+|..+  .+  .....|..|+++
T Consensus         1 C~~Cr~~L~yp--~G--A~sVrCa~C~~V   25 (25)
T PF06943_consen    1 CGGCRTLLMYP--RG--APSVRCACCHTV   25 (25)
T ss_pred             CCCCCceEEcC--CC--CCCeECCccCcC
Confidence            67899888887  44  458999999863


No 148
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=84.53  E-value=0.88  Score=32.83  Aligned_cols=15  Identities=20%  Similarity=0.689  Sum_probs=12.0

Q ss_pred             eEEcCCCCCeeeeCC
Q 033869           23 RFSCPACPYVCNMES   37 (110)
Q Consensus        23 ~~~C~~C~y~~~~~~   37 (110)
                      .+.|+.|+.+.....
T Consensus         5 ~~~CPvC~~~F~~~~   19 (214)
T PF09986_consen    5 KITCPVCGKEFKTKK   19 (214)
T ss_pred             ceECCCCCCeeeeeE
Confidence            589999999877654


No 149
>PRK11827 hypothetical protein; Provisional
Probab=84.45  E-value=1.3  Score=25.93  Aligned_cols=31  Identities=19%  Similarity=0.466  Sum_probs=24.9

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -||.|+.-|...  .+  ...+.|..|+-.+++.+
T Consensus        10 aCP~ckg~L~~~--~~--~~~Lic~~~~laYPI~d   40 (60)
T PRK11827         10 ACPVCNGKLWYN--QE--KQELICKLDNLAFPLRD   40 (60)
T ss_pred             ECCCCCCcCeEc--CC--CCeEECCccCeeccccC
Confidence            499999988876  32  34789999999888876


No 150
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=83.77  E-value=0.71  Score=31.15  Aligned_cols=33  Identities=21%  Similarity=0.415  Sum_probs=21.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      -||.|+|-=.--+ ++++...+.|..||...++.
T Consensus        99 lC~~C~sPdT~l~-k~~r~~~l~C~ACGa~~~v~  131 (133)
T TIGR00311        99 ICRECNRPDTRII-KEGRVSLLKCEACGAKAPLR  131 (133)
T ss_pred             ECCCCCCCCcEEE-EeCCeEEEecccCCCCCccC
Confidence            3999998522111 22344567999999987764


No 151
>COG3809 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=83.68  E-value=1  Score=27.81  Aligned_cols=35  Identities=29%  Similarity=0.461  Sum_probs=27.4

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      |.-||.||--|.++  ...+.-+-.|+.|+-++....
T Consensus         1 ~llCP~C~v~l~~~--~rs~vEiD~CPrCrGVWLDrG   35 (88)
T COG3809           1 MLLCPICGVELVMS--VRSGVEIDYCPRCRGVWLDRG   35 (88)
T ss_pred             CcccCcCCceeeee--eecCceeeeCCccccEeecch
Confidence            67899999999888  333456789999998876544


No 152
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=83.61  E-value=0.79  Score=29.84  Aligned_cols=31  Identities=26%  Similarity=0.610  Sum_probs=24.1

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      +.||.||.-.|=-    + +.-++|+.||..+....
T Consensus        10 R~Cp~CG~kFYDL----n-k~PivCP~CG~~~~~~~   40 (108)
T PF09538_consen   10 RTCPSCGAKFYDL----N-KDPIVCPKCGTEFPPEP   40 (108)
T ss_pred             ccCCCCcchhccC----C-CCCccCCCCCCccCccc
Confidence            5799999887755    1 24688999999988763


No 153
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=83.27  E-value=0.8  Score=24.32  Aligned_cols=35  Identities=17%  Similarity=0.260  Sum_probs=19.1

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      .-|..|+..|-|-..=+.....|.|.-|+...++.
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~~w~C~~C~~~N~lp   37 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGKTWICNFCGTKNPLP   37 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTTEEEETTT--EEE--
T ss_pred             cccCCCCCEECCcceEcCCCCEEECcCCCCcCCCC
Confidence            35899999998863233445699999999876654


No 154
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=82.95  E-value=0.78  Score=25.60  Aligned_cols=23  Identities=22%  Similarity=0.677  Sum_probs=19.3

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      ..|-.|+-.+.+.        .-.||.|||.
T Consensus        15 ~ICrkC~ARnp~~--------A~~CRKCg~~   37 (48)
T PRK04136         15 KICMRCNARNPWR--------ATKCRKCGYK   37 (48)
T ss_pred             cchhcccCCCCcc--------ccccccCCCC
Confidence            4789999999998        5579999984


No 155
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=82.79  E-value=0.85  Score=30.94  Aligned_cols=33  Identities=24%  Similarity=0.444  Sum_probs=22.3

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      -||+|+|.=.-- -++++...+.|..||...++.
T Consensus       104 lC~~C~spdT~l-~k~~r~~~l~C~ACGa~~~V~  136 (138)
T PRK03988        104 ICPECGSPDTKL-IKEGRIWVLKCEACGAETPVK  136 (138)
T ss_pred             ECCCCCCCCcEE-EEcCCeEEEEcccCCCCCcCC
Confidence            499999852211 123456789999999887654


No 156
>PRK09521 exosome complex RNA-binding protein Csl4; Provisional
Probab=82.38  E-value=1.4  Score=31.00  Aligned_cols=28  Identities=25%  Similarity=0.634  Sum_probs=23.2

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      +|+.||..|.|.  .   ...+.|+.|+..+..
T Consensus       151 ~~~~~g~~~~~~--~---~~~~~c~~~~~~e~r  178 (189)
T PRK09521        151 MCSRCRTPLVKK--G---ENELKCPNCGNIETR  178 (189)
T ss_pred             EccccCCceEEC--C---CCEEECCCCCCEEee
Confidence            699999999887  2   258999999988774


No 157
>COG2176 PolC DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]
Probab=82.33  E-value=1.6  Score=39.14  Aligned_cols=17  Identities=29%  Similarity=0.940  Sum_probs=13.9

Q ss_pred             CceEEcCCCCCeeeeCC
Q 033869           21 PSRFSCPACPYVCNMES   37 (110)
Q Consensus        21 ~~~~~C~~C~y~~~~~~   37 (110)
                      ...|.|+.|.|.+-.++
T Consensus       912 ~PHY~Cp~Cky~Ef~~d  928 (1444)
T COG2176         912 PPHYLCPECKYSEFIDD  928 (1444)
T ss_pred             CccccCCCCceeeeecC
Confidence            34799999999987765


No 158
>PF06839 zf-GRF:  GRF zinc finger;  InterPro: IPR010666 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This presumed zinc-binding domain is found in a variety of DNA-binding proteins. It seems likely that this domain is involved in nucleic acid binding. It is named GRF after three conserved residues in the centre of the alignment of the domain. This zinc finger may be related to IPR000380 from INTERPRO. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=82.11  E-value=3.9  Score=22.06  Aligned_cols=30  Identities=33%  Similarity=0.727  Sum_probs=18.9

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceEEEEecCC
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSIFYMCANK  102 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~  102 (110)
                      .|+ || ..++-+++. +..+.+=-+||.|.+.
T Consensus         2 ~C~-Cg-~~~~~~~s~-k~~~N~GR~Fy~C~~~   31 (45)
T PF06839_consen    2 KCP-CG-EPAVRRTSK-KTGPNPGRRFYKCPNY   31 (45)
T ss_pred             CCC-CC-CEeEEEEEe-CCCCCCCCcceECCCC
Confidence            366 66 445544443 2466677799999863


No 159
>PRK05582 DNA topoisomerase I; Validated
Probab=82.11  E-value=2.7  Score=35.15  Aligned_cols=32  Identities=31%  Similarity=0.723  Sum_probs=18.1

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecC-CCCCc
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCAN-KNCKH  106 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~-~~C~~  106 (110)
                      ...||+|+.. +..     |....+ ..|+.|.+ +.|++
T Consensus       611 ~~~CP~C~~~-l~l-----~k~k~g-k~f~~Cs~~p~C~~  643 (650)
T PRK05582        611 GVKCPKCGGQ-IVE-----RKSKKG-RKFYGCSRYPECDF  643 (650)
T ss_pred             CCCCCCCCCc-eEE-----EcCCCC-ceeeccCCCCCCCc
Confidence            4679999864 221     222223 25888865 34764


No 160
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=81.80  E-value=1.2  Score=30.88  Aligned_cols=39  Identities=26%  Similarity=0.481  Sum_probs=17.7

Q ss_pred             ccCCCCCCCceEEEEeccCCCC--CCceEEEEecCCCCCccccC
Q 033869           69 VTCPACKHGKAVYHELQTRSAD--EPMSIFYMCANKNCKHRWNE  110 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaD--E~~T~fY~C~~~~C~~~wre  110 (110)
                      ..||.||+....-. +.+.--.  |=.-.-|.|.+  ||++.+|
T Consensus         2 s~Cp~C~~~~~~~~-~~~~IP~F~evii~sf~C~~--CGyk~~e   42 (161)
T PF03367_consen    2 SLCPNCGENGTTRI-LLTDIPYFKEVIIMSFECEH--CGYKNNE   42 (161)
T ss_dssp             EE-TTTSSCCEEEE-EEEEETTTEEEEEEEEE-TT--T--EEEE
T ss_pred             CcCCCCCCCcEEEE-EEEcCCCCceEEEEEeECCC--CCCEeee
Confidence            36888887643221 2222211  22334478888  8887653


No 161
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=81.67  E-value=0.49  Score=27.09  Aligned_cols=21  Identities=38%  Similarity=0.921  Sum_probs=14.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      .||.||.+-.+.         .+|..|||.
T Consensus        28 ~c~~cg~~~~~H---------~vc~~cG~y   48 (56)
T PF01783_consen   28 KCPNCGEPKLPH---------RVCPSCGYY   48 (56)
T ss_dssp             ESSSSSSEESTT---------SBCTTTBBS
T ss_pred             eeccCCCEeccc---------EeeCCCCeE
Confidence            588888655443         568888764


No 162
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=81.62  E-value=1  Score=34.23  Aligned_cols=30  Identities=23%  Similarity=0.597  Sum_probs=20.5

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      ..||+||+- .+-+|.  ....++|..||++-.
T Consensus        12 ~~Cp~Cg~~-~iv~d~--~~Ge~vC~~CG~Vl~   41 (310)
T PRK00423         12 LVCPECGSD-KLIYDY--ERGEIVCADCGLVIE   41 (310)
T ss_pred             CcCcCCCCC-CeeEEC--CCCeEeecccCCccc
Confidence            479999973 222222  356999999999643


No 163
>PF01599 Ribosomal_S27:  Ribosomal protein S27a;  InterPro: IPR002906 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family of ribosomal proteins consists mainly of the 40S ribosomal protein S27a which is synthesized as a C-terminal extension of ubiquitin (CEP) (IPR000626 from INTERPRO). The S27a domain compromises the C-terminal half of the protein. The synthesis of ribosomal proteins as extensions of ubiquitin promotes their incorporation into nascent ribosomes by a transient metabolic stabilisation and is required for efficient ribosome biogenesis []. The ribosomal extension protein S27a contains a basic region that is proposed to form a zinc finger; its fusion gene is proposed as a mechanism to maintain a fixed ratio between ubiquitin necessary for degrading proteins and ribosomes a source of proteins [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 2K4X_A 3U5C_f 3U5G_f 2XZN_9 2XZM_9.
Probab=81.50  E-value=0.93  Score=25.24  Aligned_cols=27  Identities=30%  Similarity=0.784  Sum_probs=16.8

Q ss_pred             CCCc--CCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            2 EFCP--TCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         2 ~FCp--~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      +.||  +||.-...-    .+..++.|-.|+|+
T Consensus        19 k~CP~~~CG~GvFMA----~H~dR~~CGKCg~T   47 (47)
T PF01599_consen   19 KECPSPRCGAGVFMA----EHKDRHYCGKCGYT   47 (47)
T ss_dssp             EE-TSTTTTSSSEEE----E-SSEEEETTTSS-
T ss_pred             hcCCCcccCCceEee----ecCCCccCCCcccC
Confidence            3688  999843332    23459999999974


No 164
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=81.23  E-value=0.75  Score=24.66  Aligned_cols=10  Identities=30%  Similarity=0.906  Sum_probs=5.1

Q ss_pred             ceEEcCCCCC
Q 033869           22 SRFSCPACPY   31 (110)
Q Consensus        22 ~~~~C~~C~y   31 (110)
                      ....|+.||-
T Consensus        25 ~~~~CP~Cg~   34 (42)
T PF09723_consen   25 DPVPCPECGS   34 (42)
T ss_pred             CCCcCCCCCC
Confidence            3455555554


No 165
>PRK00415 rps27e 30S ribosomal protein S27e; Reviewed
Probab=81.22  E-value=1  Score=26.29  Aligned_cols=30  Identities=27%  Similarity=0.678  Sum_probs=22.9

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      .+++||.|++...+|--.|+         --.|..  ||..
T Consensus        10 ~~VkCp~C~n~q~vFsha~t---------~V~C~~--Cg~~   39 (59)
T PRK00415         10 LKVKCPDCGNEQVVFSHAST---------VVRCLV--CGKT   39 (59)
T ss_pred             EEEECCCCCCeEEEEecCCc---------EEECcc--cCCC
Confidence            47899999999999966542         257877  8764


No 166
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=81.17  E-value=0.87  Score=36.25  Aligned_cols=30  Identities=27%  Similarity=0.661  Sum_probs=24.2

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -||.||.-|...    .+. -|.|+.||+...-+.
T Consensus       352 ~Cp~Cg~~m~S~----G~~-g~rC~kCg~~~~~~~  381 (421)
T COG1571         352 VCPRCGGRMKSA----GRN-GFRCKKCGTRARETL  381 (421)
T ss_pred             CCCccCCchhhc----CCC-CcccccccccCCccc
Confidence            599999999877    223 899999999876554


No 167
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=81.14  E-value=0.79  Score=31.02  Aligned_cols=22  Identities=32%  Similarity=0.701  Sum_probs=19.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      =|++||++..|+        +-.|+.|+..
T Consensus        31 kC~~CG~v~~PP--------r~~Cp~C~~~   52 (140)
T COG1545          31 KCKKCGRVYFPP--------RAYCPKCGSE   52 (140)
T ss_pred             EcCCCCeEEcCC--------cccCCCCCCC
Confidence            399999999999        7789999987


No 168
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=81.12  E-value=1  Score=33.50  Aligned_cols=35  Identities=29%  Similarity=0.663  Sum_probs=14.8

Q ss_pred             CCCcCCCCC-cccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            2 EFCPTCGTM-LQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         2 ~FCp~C~nl-L~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      .+||.||+. |.--+ .....--|.|..|+-..+.++
T Consensus        32 ~yCP~Cg~~~L~~f~-NN~PVaDF~C~~C~eeyELKS   67 (254)
T PF06044_consen   32 MYCPNCGSKPLSKFE-NNRPVADFYCPNCNEEYELKS   67 (254)
T ss_dssp             ---TTT--SS-EE---------EEE-TTT--EEEEEE
T ss_pred             CcCCCCCChhHhhcc-CCCccceeECCCCchHHhhhh
Confidence            489999998 54431 233466799999999887665


No 169
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=80.84  E-value=1.8  Score=32.43  Aligned_cols=36  Identities=22%  Similarity=0.485  Sum_probs=17.6

Q ss_pred             cccCCCCCCC-ceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           68 EVTCPACKHG-KAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        68 ~~~CpkCg~~-~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      .-.||-||.. .+.......+   +|. +|..|.-  |++.|+
T Consensus       172 ~g~CPvCGs~P~~s~l~~~~~---~G~-R~L~Cs~--C~t~W~  208 (290)
T PF04216_consen  172 RGYCPVCGSPPVLSVLRGGER---EGK-RYLHCSL--CGTEWR  208 (290)
T ss_dssp             -SS-TTT---EEEEEEE---------E-EEEEETT--T--EEE
T ss_pred             CCcCCCCCCcCceEEEecCCC---Ccc-EEEEcCC--CCCeee
Confidence            4699999976 3333222211   476 9999998  999996


No 170
>PHA02998 RNA polymerase subunit; Provisional
Probab=80.56  E-value=1.5  Score=31.22  Aligned_cols=34  Identities=21%  Similarity=0.421  Sum_probs=21.8

Q ss_pred             CCcCCCCC------cccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTM------LQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nl------L~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      =||.||+-      |..+...+.....|.|..||+.+...
T Consensus       145 ~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG~~wkpp  184 (195)
T PHA02998        145 PCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCKKHFKPP  184 (195)
T ss_pred             CCCCCCCCceEEEEEeeccCCCCceEEEEcCCCCCccCCc
Confidence            38899874      44442222335678999999876544


No 171
>PRK03954 ribonuclease P protein component 4; Validated
Probab=80.11  E-value=1.4  Score=29.26  Aligned_cols=33  Identities=15%  Similarity=0.447  Sum_probs=23.7

Q ss_pred             CCCcCCCCCcccccCCC----C---CCceEEcCCCCCeee
Q 033869            2 EFCPTCGTMLQYELPHM----D---RPSRFSCPACPYVCN   34 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~----~---~~~~~~C~~C~y~~~   34 (110)
                      .||..|+++|.|-....    .   ..+.+.|-.||++.-
T Consensus        65 ~~CK~C~t~LiPG~n~~vRi~~~~~~~vvitCl~CG~~kR  104 (121)
T PRK03954         65 RYCKRCHSFLVPGVNARVRLRQKRMPHVVITCLECGHIMR  104 (121)
T ss_pred             HHhhcCCCeeecCCceEEEEecCCcceEEEECccCCCEEe
Confidence            48999999999852211    1   137889999998754


No 172
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=80.03  E-value=0.76  Score=29.96  Aligned_cols=23  Identities=22%  Similarity=0.706  Sum_probs=14.5

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      +|+.||..-.+.      ...+.|+.||-
T Consensus        72 ~C~~Cg~~~~~~------~~~~~CP~Cgs   94 (113)
T PRK12380         72 WCWDCSQVVEIH------QHDAQCPHCHG   94 (113)
T ss_pred             EcccCCCEEecC------CcCccCcCCCC
Confidence            577888555444      23556888883


No 173
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=79.76  E-value=2.4  Score=24.78  Aligned_cols=32  Identities=25%  Similarity=0.667  Sum_probs=26.1

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      .-||.|..-|...  ++  +..+.|+.|+-.+++.+
T Consensus         9 LaCP~~kg~L~~~--~~--~~~L~c~~~~~aYpI~d   40 (60)
T COG2835           9 LACPVCKGPLVYD--EE--KQELICPRCKLAYPIRD   40 (60)
T ss_pred             eeccCcCCcceEe--cc--CCEEEecccCceeeccc
Confidence            3599999999888  33  33999999999888876


No 174
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=79.65  E-value=1.8  Score=34.21  Aligned_cols=28  Identities=18%  Similarity=0.685  Sum_probs=20.7

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      ||+|+-+...+  +-..+....|++||..-
T Consensus        16 C~~Cd~l~~~~--~l~~g~~a~CpRCg~~L   43 (403)
T TIGR00155        16 CSQCDMLVALP--RIESGQKAACPRCGTTL   43 (403)
T ss_pred             CCCCCCccccc--CCCCCCeeECCCCCCCC
Confidence            89999887665  33345578899999864


No 175
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=79.56  E-value=0.45  Score=27.39  Aligned_cols=30  Identities=30%  Similarity=0.713  Sum_probs=18.2

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      .+++||.|++...+|-..|+        + -.|..  |+..
T Consensus         6 m~VkCp~C~~~q~vFSha~t--------~-V~C~~--Cg~~   35 (55)
T PF01667_consen    6 MDVKCPGCYNIQTVFSHAQT--------V-VKCVV--CGTV   35 (55)
T ss_dssp             EEEE-TTT-SEEEEETT-SS----------EE-SS--STSE
T ss_pred             EEEECCCCCCeeEEEecCCe--------E-EEccc--CCCE
Confidence            37899999999999955443        2 46777  7653


No 176
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=79.49  E-value=1.5  Score=25.09  Aligned_cols=27  Identities=26%  Similarity=0.655  Sum_probs=21.5

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      -|+.||--|.+.      ....+|+.||..+..
T Consensus         7 ~C~~Cg~~~~~~------dDiVvCp~CgapyHR   33 (54)
T PF14446_consen    7 KCPVCGKKFKDG------DDIVVCPECGAPYHR   33 (54)
T ss_pred             cChhhCCcccCC------CCEEECCCCCCcccH
Confidence            389999888877      349999999976554


No 177
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=79.46  E-value=0.84  Score=29.82  Aligned_cols=23  Identities=26%  Similarity=0.654  Sum_probs=14.6

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      +|+.||..-.+.      ...+.|+.||-
T Consensus        72 ~C~~Cg~~~~~~------~~~~~CP~Cgs   94 (115)
T TIGR00100        72 ECEDCSEEVSPE------IDLYRCPKCHG   94 (115)
T ss_pred             EcccCCCEEecC------CcCccCcCCcC
Confidence            577787555554      22567888874


No 178
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=79.42  E-value=0.63  Score=31.57  Aligned_cols=30  Identities=23%  Similarity=0.714  Sum_probs=19.6

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEE-----EEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIF-----YMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~f-----Y~C~~~~C~~~  107 (110)
                      .--.||+||.   .|      +++|.+...     |.|.+  ||..
T Consensus        98 ~~Y~Cp~C~~---~y------~~~ea~~~~d~~~~f~Cp~--Cg~~  132 (147)
T smart00531       98 AYYKCPNCQS---KY------TFLEANQLLDMDGTFTCPR--CGEE  132 (147)
T ss_pred             cEEECcCCCC---Ee------eHHHHHHhcCCCCcEECCC--CCCE
Confidence            4568999983   22      233444444     99999  9875


No 179
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=79.38  E-value=2  Score=24.08  Aligned_cols=8  Identities=50%  Similarity=1.356  Sum_probs=4.3

Q ss_pred             ccCCCCCC
Q 033869           69 VTCPACKH   76 (110)
Q Consensus        69 ~~CpkCg~   76 (110)
                      .+|++|||
T Consensus        29 W~C~~Cgh   36 (55)
T PF14311_consen   29 WKCPKCGH   36 (55)
T ss_pred             EECCCCCC
Confidence            45555554


No 180
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=79.00  E-value=1.8  Score=29.88  Aligned_cols=33  Identities=24%  Similarity=0.352  Sum_probs=19.1

Q ss_pred             CCcCCCCCc----ccccCCCC--CCceEEcCCCCCeeee
Q 033869            3 FCPTCGTML----QYELPHMD--RPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL----~~~~~~~~--~~~~~~C~~C~y~~~~   35 (110)
                      =||.||+--    ....-+++  ..-.+.|++||+....
T Consensus         2 ~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~f~~   40 (154)
T PRK00464          2 RCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKRFTT   40 (154)
T ss_pred             cCCCCCCCCCEeEeccccCCCCceeeeeeccccCCcceE
Confidence            499999632    22111111  1224899999997654


No 181
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=78.95  E-value=1.7  Score=27.53  Aligned_cols=30  Identities=20%  Similarity=0.460  Sum_probs=21.2

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      ..||.||..=.-+    ....+|.|+.|+++.--
T Consensus        36 y~CpfCgk~~vkR----~a~GIW~C~~C~~~~AG   65 (91)
T TIGR00280        36 YVCPFCGKKTVKR----GSTGIWTCRKCGAKFAG   65 (91)
T ss_pred             ccCCCCCCCceEE----EeeEEEEcCCCCCEEeC
Confidence            4799998654333    22569999999997643


No 182
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=78.49  E-value=2.1  Score=25.80  Aligned_cols=24  Identities=29%  Similarity=0.847  Sum_probs=16.9

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      -||.|.+-|.+.      ...|.|..|+..
T Consensus         3 ~CP~C~~~L~~~------~~~~~C~~C~~~   26 (70)
T PF07191_consen    3 TCPKCQQELEWQ------GGHYHCEACQKD   26 (70)
T ss_dssp             B-SSS-SBEEEE------TTEEEETTT--E
T ss_pred             cCCCCCCccEEe------CCEEECcccccc
Confidence            499999999998      259999999864


No 183
>COG5415 Predicted integral membrane metal-binding protein [General function prediction only]
Probab=78.43  E-value=0.99  Score=32.94  Aligned_cols=36  Identities=33%  Similarity=1.000  Sum_probs=25.1

Q ss_pred             CCCCcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           64 GPQTEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        64 ~~~~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      .|.-...||+|.|+..-|     |-|.-+.. =|+|.+  |+|.
T Consensus       188 ~~~~alIC~~C~hhngl~-----~~~ek~~~-efiC~~--Cn~~  223 (251)
T COG5415         188 SPFKALICPQCHHHNGLY-----RLAEKPII-EFICPH--CNHK  223 (251)
T ss_pred             Cchhhhcccccccccccc-----ccccccch-heeccc--chhh
Confidence            555677999999876554     34444444 588999  9874


No 184
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=78.00  E-value=1.3  Score=37.13  Aligned_cols=11  Identities=55%  Similarity=1.271  Sum_probs=9.1

Q ss_pred             CCCcCCCCCcc
Q 033869            2 EFCPTCGTMLQ   12 (110)
Q Consensus         2 ~FCp~C~nlL~   12 (110)
                      +||+.||.-|.
T Consensus        16 kFC~~CG~~l~   26 (645)
T PRK14559         16 RFCQKCGTSLT   26 (645)
T ss_pred             ccccccCCCCC
Confidence            68999998875


No 185
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=77.97  E-value=2.2  Score=23.95  Aligned_cols=30  Identities=20%  Similarity=0.628  Sum_probs=20.9

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      |-.||..+...    .....+.|+.||+......
T Consensus         9 C~~Cg~~~~~~----~~~~~irCp~Cg~rIl~K~   38 (49)
T COG1996           9 CARCGREVELD----QETRGIRCPYCGSRILVKE   38 (49)
T ss_pred             hhhcCCeeehh----hccCceeCCCCCcEEEEec
Confidence            77888888432    2345889999999765544


No 186
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=77.91  E-value=1.4  Score=31.55  Aligned_cols=34  Identities=24%  Similarity=0.390  Sum_probs=23.7

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -|+.|+|.=.-- -++++...+.|..||...+++.
T Consensus       100 ~C~~C~~pdT~l-~k~~~~~~l~C~aCGa~~~v~~  133 (201)
T PRK12336        100 ICSECGLPDTRL-VKEDRVLMLRCDACGAHRPVKK  133 (201)
T ss_pred             ECCCCCCCCcEE-EEcCCeEEEEcccCCCCccccc
Confidence            499999852111 1234566789999999988775


No 187
>COG0333 RpmF Ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=77.89  E-value=1.8  Score=25.04  Aligned_cols=25  Identities=28%  Similarity=0.705  Sum_probs=17.6

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      |..||.||.+..+-         -+|..|||-..
T Consensus        27 ~~~c~~cG~~~l~H---------rvc~~cg~Y~g   51 (57)
T COG0333          27 LSVCPNCGEYKLPH---------RVCLKCGYYKG   51 (57)
T ss_pred             ceeccCCCCcccCc---------eEcCCCCCccC
Confidence            45788888877664         46888887543


No 188
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=77.61  E-value=2.2  Score=26.93  Aligned_cols=30  Identities=23%  Similarity=0.556  Sum_probs=20.7

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      .+||.||..=.-+    ....+|.|+.|+++.--
T Consensus        37 y~CpfCgk~~vkR----~a~GIW~C~~C~~~~AG   66 (90)
T PTZ00255         37 YFCPFCGKHAVKR----QAVGIWRCKGCKKTVAG   66 (90)
T ss_pred             ccCCCCCCCceee----eeeEEEEcCCCCCEEeC
Confidence            3799998643333    12469999999997643


No 189
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=77.49  E-value=5.4  Score=22.56  Aligned_cols=34  Identities=21%  Similarity=0.554  Sum_probs=21.0

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      +.||-||.......+  ...-+.++..+-.|.+  ||.
T Consensus         4 kPCPFCG~~~~~~~~--~~~~~~~~~~~V~C~~--Cga   37 (61)
T PF14354_consen    4 KPCPFCGSADVLIRQ--DEGFDYGMYYYVECTD--CGA   37 (61)
T ss_pred             cCCCCCCCcceEeec--ccCCCCCCEEEEEcCC--CCC
Confidence            479999776655543  3333344445555988  975


No 190
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=76.55  E-value=2.4  Score=28.67  Aligned_cols=32  Identities=22%  Similarity=0.508  Sum_probs=21.2

Q ss_pred             CCCcCCCCCcccccCCC-----------CCCceEEcCCCCCee
Q 033869            2 EFCPTCGTMLQYELPHM-----------DRPSRFSCPACPYVC   33 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~-----------~~~~~~~C~~C~y~~   33 (110)
                      .-|+.||..|.+-...+           ...-.+.|+.||..+
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~~f~~C~~C~kiy  134 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYDEFWRCPGCGKIY  134 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCCeEEECCCCCCEe
Confidence            35999999886642111           123479999999764


No 191
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=75.42  E-value=2.7  Score=33.41  Aligned_cols=27  Identities=22%  Similarity=0.830  Sum_probs=17.1

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      ||+|+.+...+  ....+....|++||..
T Consensus        13 C~~Cd~l~~~~--~l~~g~~a~CpRCg~~   39 (419)
T PRK15103         13 CPQCDMLVALP--RLEHGQKAACPRCGTT   39 (419)
T ss_pred             CCCCCceeecC--CCCCCCeeECCCCCCC
Confidence            77887776554  3233446778888775


No 192
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=75.10  E-value=2.7  Score=22.58  Aligned_cols=13  Identities=38%  Similarity=0.828  Sum_probs=9.3

Q ss_pred             CCCcCCCCCcccc
Q 033869            2 EFCPTCGTMLQYE   14 (110)
Q Consensus         2 ~FCp~C~nlL~~~   14 (110)
                      ..||.||.-|..-
T Consensus         3 ~~C~~Cg~~l~~i   15 (47)
T PF13005_consen    3 RACPDCGGELKEI   15 (47)
T ss_pred             CcCCCCCceeeEC
Confidence            4688888877743


No 193
>smart00778 Prim_Zn_Ribbon Zinc-binding domain of primase-helicase. This region represents the zinc binding domain. It is found in the N-terminal region of the bacteriophage P4 alpha protein, which is a multifunctional protein with origin recognition, helicase and primase activities.
Probab=74.99  E-value=3.9  Score=21.52  Aligned_cols=28  Identities=25%  Similarity=0.738  Sum_probs=17.3

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      ||.||.-=-.+-+.......+.|+.|+.
T Consensus         6 CP~CGG~DrFr~~d~~g~G~~~C~~Cg~   33 (37)
T smart00778        6 CPNCGGSDRFRFDDKDGRGTWFCSVCGA   33 (37)
T ss_pred             CCCCCCccccccccCCCCcCEEeCCCCC
Confidence            8888874322212223456899999974


No 194
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=74.98  E-value=1.2  Score=29.15  Aligned_cols=25  Identities=16%  Similarity=0.378  Sum_probs=16.0

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      +|+.||+...+.  .   ...+.|+.||-.
T Consensus        73 ~C~~Cg~~~~~~--~---~~~~~CP~Cgs~   97 (117)
T PRK00564         73 ECKDCSHVFKPN--A---LDYGVCEKCHSK   97 (117)
T ss_pred             EhhhCCCccccC--C---ccCCcCcCCCCC
Confidence            688899665554  1   123459999853


No 195
>COG2824 PhnA Uncharacterized Zn-ribbon-containing protein involved in phosphonate metabolism [Inorganic ion transport and metabolism]
Probab=74.17  E-value=2.9  Score=27.29  Aligned_cols=29  Identities=31%  Similarity=0.816  Sum_probs=23.3

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      |.-||.|++-....  .   ...|.|+.|.+++.
T Consensus         3 lp~cp~c~sEytYe--d---~~~~~cpec~~ew~   31 (112)
T COG2824           3 LPPCPKCNSEYTYE--D---GGQLICPECAHEWN   31 (112)
T ss_pred             CCCCCccCCceEEe--c---CceEeCchhccccc
Confidence            45699999988877  2   34999999999876


No 196
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed
Probab=74.07  E-value=2.6  Score=34.24  Aligned_cols=34  Identities=21%  Similarity=0.583  Sum_probs=24.8

Q ss_pred             CCCcCCCCCccccc---CCCCCCceEEcCCCCCeeeeC
Q 033869            2 EFCPTCGTMLQYEL---PHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         2 ~FCp~C~nlL~~~~---~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      .+||+||.++....   |.+.....|.|. ||+...++
T Consensus       176 pic~~cg~~~~~~~~~~d~~~~~v~y~~~-cG~~~~~~  212 (510)
T PRK00750        176 PICPKCGKVLTTPVISYDAEAGTVTYDCE-CGHEGEVP  212 (510)
T ss_pred             eeCCCCCccceEEEEEEeCCCCEEEEEcC-CCCEEEEe
Confidence            57999999998664   333444678886 99987654


No 197
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=73.77  E-value=2.7  Score=26.55  Aligned_cols=30  Identities=20%  Similarity=0.439  Sum_probs=20.9

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      ..||.||..=.-+    ....+|.|+.|++..--
T Consensus        37 y~CpfCgk~~vkR----~a~GIW~C~~C~~~~AG   66 (90)
T PRK03976         37 HVCPVCGRPKVKR----VGTGIWECRKCGAKFAG   66 (90)
T ss_pred             ccCCCCCCCceEE----EEEEEEEcCCCCCEEeC
Confidence            3799997554443    22459999999997643


No 198
>PF12677 DUF3797:  Domain of unknown function (DUF3797);  InterPro: IPR024256 This presumed domain is functionally uncharacterised. This domain family is found in bacteria and viruses, and is approximately 50 amino acids in length. There is a conserved CGN sequence motif.
Probab=73.71  E-value=1.9  Score=24.18  Aligned_cols=12  Identities=33%  Similarity=0.863  Sum_probs=9.5

Q ss_pred             cccCCCCCCCce
Q 033869           68 EVTCPACKHGKA   79 (110)
Q Consensus        68 ~~~CpkCg~~~a   79 (110)
                      -..||+||+++.
T Consensus        13 Y~~Cp~CGN~~v   24 (49)
T PF12677_consen   13 YCKCPKCGNDKV   24 (49)
T ss_pred             hccCcccCCcEe
Confidence            468999999654


No 199
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=72.90  E-value=3.5  Score=26.61  Aligned_cols=33  Identities=21%  Similarity=0.441  Sum_probs=22.9

Q ss_pred             CcCCCCCcccc--cCCCCCCceEEcCCCCCeeeeC
Q 033869            4 CPTCGTMLQYE--LPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         4 Cp~C~nlL~~~--~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      ||.||......  .++........|.+||-.....
T Consensus        25 Cp~Cghe~vs~ctvkk~~~~g~~~Cg~CGls~e~e   59 (104)
T COG4888          25 CPRCGHEKVSSCTVKKTVNIGTAVCGNCGLSFECE   59 (104)
T ss_pred             cCccCCeeeeEEEEEecCceeEEEcccCcceEEEe
Confidence            88998876551  2245567788999999766544


No 200
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=72.42  E-value=2.7  Score=30.22  Aligned_cols=33  Identities=24%  Similarity=0.489  Sum_probs=20.6

Q ss_pred             CCcCCCCCcccc-cC-CCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYE-LP-HMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~-~~-~~~~~~~~~C~~C~y~~~~   35 (110)
                      -||.||..=.+. .- .......+.|..||+.+++
T Consensus         8 ~Cp~Cg~eev~hEVik~~g~~~lvrC~eCG~V~~~   42 (201)
T COG1326           8 ECPSCGSEEVSHEVIKERGREPLVRCEECGTVHPA   42 (201)
T ss_pred             ECCCCCcchhhHHHHHhcCCceEEEccCCCcEeec
Confidence            499999332211 00 1133578999999999843


No 201
>PF05502 Dynactin_p62:  Dynactin p62 family;  InterPro: IPR008603 Dynactin is a multi-subunit complex and a required cofactor for most, or all, o f the cellular processes powered by the microtubule-based motor cytoplasmic dyn ein. p62 binds directly to the Arp1 subunit of dynactin [, ].
Probab=72.40  E-value=11  Score=30.53  Aligned_cols=35  Identities=17%  Similarity=0.459  Sum_probs=23.7

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      +.||+.|..+--+.--.. ....+.|++|-...+..
T Consensus         5 L~fC~~C~~irc~~c~~~-Ei~~~yCp~CL~~~p~~   39 (483)
T PF05502_consen    5 LYFCEHCHKIRCPRCVSE-EIDSYYCPNCLFEVPSS   39 (483)
T ss_pred             ceecccccccCChhhccc-ccceeECccccccCChh
Confidence            469999998876652222 25688999998655443


No 202
>PF06044 DRP:  Dam-replacing family;  InterPro: IPR010324 Dam-replacing protein (DRP) is a restriction endonuclease that is flanked by pseudo-transposable small repeat elements. The replacement of Dam-methylase by DRP allows phase variation through slippage-like mechanisms in several pathogenic isolates of Neisseria meningitidis [].; PDB: 4ESJ_A.
Probab=71.99  E-value=2.3  Score=31.63  Aligned_cols=33  Identities=27%  Similarity=0.682  Sum_probs=11.6

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCccc
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      +.-||.||+....=|..=..+||      |.|.+  |+..+
T Consensus        31 n~yCP~Cg~~~L~~f~NN~PVaD------F~C~~--C~eey   63 (254)
T PF06044_consen   31 NMYCPNCGSKPLSKFENNRPVAD------FYCPN--CNEEY   63 (254)
T ss_dssp             H---TTT--SS-EE--------E------EE-TT--T--EE
T ss_pred             CCcCCCCCChhHhhccCCCccce------eECCC--CchHH
Confidence            56899999986555544444444      67988  98764


No 203
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=71.93  E-value=1.8  Score=28.25  Aligned_cols=24  Identities=25%  Similarity=0.635  Sum_probs=13.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      +|+.||..-...     ....+.|+.||-
T Consensus        72 ~C~~Cg~~~~~~-----~~~~~~CP~Cgs   95 (114)
T PRK03681         72 WCETCQQYVTLL-----TQRVRRCPQCHG   95 (114)
T ss_pred             EcccCCCeeecC-----CccCCcCcCcCC
Confidence            577888544333     112366888884


No 204
>PRK09710 lar restriction alleviation and modification protein; Reviewed
Probab=71.71  E-value=8.7  Score=22.72  Aligned_cols=32  Identities=19%  Similarity=0.377  Sum_probs=22.0

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCccc
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      -+.||-||.+.+..-..       +-.-+++|..  |+-.|
T Consensus         6 lKPCPFCG~~~~~v~~~-------~g~~~v~C~~--CgA~~   37 (64)
T PRK09710          6 VKPCPFCGCPSVTVKAI-------SGYYRAKCNG--CESRT   37 (64)
T ss_pred             ccCCCCCCCceeEEEec-------CceEEEEcCC--CCcCc
Confidence            36899999988766431       3355678877  97654


No 205
>PLN00209 ribosomal protein S27; Provisional
Probab=71.62  E-value=2.5  Score=26.46  Aligned_cols=30  Identities=27%  Similarity=0.656  Sum_probs=23.1

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      .+++||.|++...+|-.+|+         --.|..  ||..
T Consensus        35 m~VkCp~C~n~q~VFShA~t---------~V~C~~--Cg~~   64 (86)
T PLN00209         35 MDVKCQGCFNITTVFSHSQT---------VVVCGS--CQTV   64 (86)
T ss_pred             EEEECCCCCCeeEEEecCce---------EEEccc--cCCE
Confidence            48999999999999966553         256777  8754


No 206
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=70.65  E-value=7.2  Score=25.94  Aligned_cols=30  Identities=27%  Similarity=0.552  Sum_probs=24.7

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      +.||.|++.+..+...       +-++|-.|..  ||.+
T Consensus        94 VlC~~C~spdT~l~k~-------~r~~~l~C~a--CGa~  123 (125)
T PF01873_consen   94 VLCPECGSPDTELIKE-------GRLIFLKCKA--CGAS  123 (125)
T ss_dssp             SSCTSTSSSSEEEEEE-------TTCCEEEETT--TSCE
T ss_pred             EEcCCCCCCccEEEEc-------CCEEEEEecc--cCCc
Confidence            6999999999877543       5678999999  9975


No 207
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=70.41  E-value=3.1  Score=27.92  Aligned_cols=31  Identities=16%  Similarity=0.172  Sum_probs=24.0

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      +-||.||.-.|=-     ++.-.+|+.||..++...
T Consensus        10 r~Cp~cg~kFYDL-----nk~p~vcP~cg~~~~~~~   40 (129)
T TIGR02300        10 RICPNTGSKFYDL-----NRRPAVSPYTGEQFPPEE   40 (129)
T ss_pred             ccCCCcCcccccc-----CCCCccCCCcCCccCcch
Confidence            4699999887765     235789999999887663


No 208
>PTZ00083 40S ribosomal protein S27; Provisional
Probab=70.39  E-value=2.8  Score=26.16  Aligned_cols=30  Identities=30%  Similarity=0.822  Sum_probs=23.2

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      .+++||.|++...+|-.+|+         --.|..  ||..
T Consensus        34 m~VkCp~C~n~q~VFShA~t---------~V~C~~--Cg~~   63 (85)
T PTZ00083         34 MDVKCPGCSQITTVFSHAQT---------VVLCGG--CSSQ   63 (85)
T ss_pred             EEEECCCCCCeeEEEecCce---------EEEccc--cCCE
Confidence            48999999999999976653         256777  8754


No 209
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=70.12  E-value=7.3  Score=26.22  Aligned_cols=30  Identities=20%  Similarity=0.486  Sum_probs=23.4

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      +.||.||+.+..+.-       ++-..|-.|..  ||.+
T Consensus        98 VlC~~C~sPdT~l~k-------~~r~~~l~C~A--CGa~  127 (133)
T TIGR00311        98 VICRECNRPDTRIIK-------EGRVSLLKCEA--CGAK  127 (133)
T ss_pred             EECCCCCCCCcEEEE-------eCCeEEEeccc--CCCC
Confidence            699999999977642       24566779999  9975


No 210
>PF08273 Prim_Zn_Ribbon:  Zinc-binding domain of primase-helicase;  InterPro: IPR013237 This entry is represented by bacteriophage T7 Gp4. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry represents a zinc binding domain found in the N-terminal region of the bacteriophage T7 Gp4 and P4 alpha protein. P4 is a multifunctional protein with origin recognition, helicase and primase activities [, , ].; GO: 0003896 DNA primase activity, 0004386 helicase activity, 0008270 zinc ion binding; PDB: 1NUI_B.
Probab=69.63  E-value=4  Score=21.83  Aligned_cols=28  Identities=25%  Similarity=0.697  Sum_probs=13.4

Q ss_pred             CcCCCCCcccc-cCCCCCCceEEcCCCCC
Q 033869            4 CPTCGTMLQYE-LPHMDRPSRFSCPACPY   31 (110)
Q Consensus         4 Cp~C~nlL~~~-~~~~~~~~~~~C~~C~y   31 (110)
                      ||.||.--..+ -+.......+.|+.|+.
T Consensus         6 CP~CGG~DrFri~~d~~~~G~~~C~~C~~   34 (40)
T PF08273_consen    6 CPICGGKDRFRIFDDKDGRGTWICRQCGG   34 (40)
T ss_dssp             -TTTT-TTTEEEETT----S-EEETTTTB
T ss_pred             CCCCcCccccccCcCcccCCCEECCCCCC
Confidence            88998653332 11123357999999954


No 211
>PF01921 tRNA-synt_1f:  tRNA synthetases class I (K);  InterPro: IPR002904 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Lysyl-tRNA synthetase (6.1.1.6 from EC) is an alpha 2 homodimer that belong to both class I and class II. In eubacteria and eukaryota lysyl-tRNA synthetases belong to class II in the same family as aspartyl tRNA synthetase. The class Ic lysyl-tRNA synthetase family is present in archaea and in a number of bacterial groups that include the alphaproteobacteria and spirochaetes[]. A refined crystal structures shows that the active site of LysU is shaped to position the substrates for the nucleophilic attack of the lysine carboxylate on the ATP alpha-phosphate. No residues are directly involved in catalysis, but a number of highly conserved amino acids and three metal ions coordinate the substrates and stabilise the pentavalent transition state. A loop close to the catalytic pocket, disordered in the lysine-bound structure, becomes ordered upon adenine binding [].; GO: 0000166 nucleotide binding, 0004824 lysine-tRNA ligase activity, 0005524 ATP binding, 0006430 lysyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1IRX_A.
Probab=69.39  E-value=1.2  Score=34.85  Aligned_cols=36  Identities=17%  Similarity=0.453  Sum_probs=20.3

Q ss_pred             CCCcCCCCCccccc---CCCCCCceEEcCCCCCeeeeCC
Q 033869            2 EFCPTCGTMLQYEL---PHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         2 ~FCp~C~nlL~~~~---~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      .+|++||.++..+.   |.+.....|.|+.||++..++-
T Consensus       175 piC~~cGri~tt~v~~~d~~~~~v~Y~c~~cG~~g~~~i  213 (360)
T PF01921_consen  175 PICEKCGRIDTTEVTEYDPEGGTVTYRCEECGHEGEVDI  213 (360)
T ss_dssp             EEETTTEE--EEEEEEE--SSSEEEEE--TTS---EEET
T ss_pred             eeccccCCcccceeeEeecCCCEEEEEecCCCCEEEEec
Confidence            47999999876542   2345678999999999876543


No 212
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=68.80  E-value=2.6  Score=29.50  Aligned_cols=31  Identities=23%  Similarity=0.539  Sum_probs=20.6

Q ss_pred             CCcCCCCCcccccCCC------------CCCceEEcCCCCCeee
Q 033869            3 FCPTCGTMLQYELPHM------------DRPSRFSCPACPYVCN   34 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~------------~~~~~~~C~~C~y~~~   34 (110)
                      =||+||..|..-. ++            .....+.|..||..+=
T Consensus        99 RCp~CN~~L~~vs-~eev~~~Vp~~~~~~~~~f~~C~~CgkiYW  141 (165)
T COG1656          99 RCPECNGELEKVS-REEVKEKVPEKVYRNYEEFYRCPKCGKIYW  141 (165)
T ss_pred             cCcccCCEeccCc-HHHHhhccchhhhhcccceeECCCCccccc
Confidence            3999998876541 11            1234678999997654


No 213
>PHA02942 putative transposase; Provisional
Probab=68.71  E-value=4.3  Score=31.84  Aligned_cols=29  Identities=28%  Similarity=0.731  Sum_probs=20.8

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCccc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      +-..||.|||...   .        .....|.|.+  ||+.+
T Consensus       324 TSq~Cs~CG~~~~---~--------l~~r~f~C~~--CG~~~  352 (383)
T PHA02942        324 SSVSCPKCGHKMV---E--------IAHRYFHCPS--CGYEN  352 (383)
T ss_pred             CCccCCCCCCccC---c--------CCCCEEECCC--CCCEe
Confidence            5678999999642   0        1123799999  99975


No 214
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones]
Probab=68.07  E-value=12  Score=29.23  Aligned_cols=24  Identities=29%  Similarity=0.724  Sum_probs=15.5

Q ss_pred             cCCCCCcccccCCCCCCceEEcCC-CCCe
Q 033869            5 PTCGTMLQYELPHMDRPSRFSCPA-CPYV   32 (110)
Q Consensus         5 p~C~nlL~~~~~~~~~~~~~~C~~-C~y~   32 (110)
                      |-||.=|.++  .+.  -...|.. |||.
T Consensus       321 pgCG~gll~E--PD~--rkvtC~~gCgf~  345 (446)
T KOG0006|consen  321 PGCGAGLLPE--PDQ--RKVTCEGGCGFA  345 (446)
T ss_pred             CCCCcccccC--CCC--CcccCCCCchhH
Confidence            4688878777  332  2566776 7764


No 215
>PRK01110 rpmF 50S ribosomal protein L32; Validated
Probab=68.04  E-value=3.1  Score=24.21  Aligned_cols=22  Identities=18%  Similarity=0.073  Sum_probs=14.8

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      ..||.||.+..|.         -+|. |||-.
T Consensus        28 ~~c~~cg~~~~pH---------~vc~-cG~Y~   49 (60)
T PRK01110         28 SVDKTTGEYHLPH---------HVSP-KGYYK   49 (60)
T ss_pred             eEcCCCCceeccc---------eecC-CcccC
Confidence            3588888877765         3477 88643


No 216
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=67.28  E-value=2.8  Score=23.04  Aligned_cols=25  Identities=32%  Similarity=0.660  Sum_probs=15.5

Q ss_pred             CCcCCCC---CcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGT---MLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~n---lL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      .|++||.   +|.+.  .+  .....|+.||.
T Consensus         7 ~C~~Cg~~fe~~~~~--~~--~~~~~CP~Cg~   34 (52)
T TIGR02605         7 RCTACGHRFEVLQKM--SD--DPLATCPECGG   34 (52)
T ss_pred             EeCCCCCEeEEEEec--CC--CCCCCCCCCCC
Confidence            5888888   34332  11  34567888886


No 217
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=66.97  E-value=5.1  Score=30.35  Aligned_cols=31  Identities=23%  Similarity=0.465  Sum_probs=22.1

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      .=||+||+.-...   +.....++|..||-+-..
T Consensus         2 ~~CpeCg~~~~~~---d~~~ge~VC~~CG~Vi~~   32 (285)
T COG1405           2 MSCPECGSTNIIT---DYERGEIVCADCGLVLED   32 (285)
T ss_pred             CCCCCCCCcccee---eccCCeEEeccCCEEecc
Confidence            5699999993333   222569999999986543


No 218
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=66.03  E-value=10  Score=25.66  Aligned_cols=30  Identities=23%  Similarity=0.506  Sum_probs=24.5

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      +.||.||+.+..+--       ++-+.|-.|..  ||..
T Consensus       103 VlC~~C~spdT~l~k-------~~r~~~l~C~A--CGa~  132 (138)
T PRK03988        103 VICPECGSPDTKLIK-------EGRIWVLKCEA--CGAE  132 (138)
T ss_pred             EECCCCCCCCcEEEE-------cCCeEEEEccc--CCCC
Confidence            699999999977632       35689999999  9975


No 219
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete. This model represents the lysyl-tRNA synthetases that are class I amino-acyl tRNA synthetases. It includes archaeal and spirochete examples of the enzyme. All other known examples are class IIc amino-acyl tRNA synthetases and seem to form a separate orthologous set.
Probab=65.84  E-value=5.5  Score=32.56  Aligned_cols=34  Identities=21%  Similarity=0.439  Sum_probs=24.0

Q ss_pred             CCCcCCCCCcccccCCC-CCCceEEcCCCCCeeeeC
Q 033869            2 EFCPTCGTMLQYELPHM-DRPSRFSCPACPYVCNME   36 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~-~~~~~~~C~~C~y~~~~~   36 (110)
                      .+||+||.++.+-.+-+ .....|.|. ||+...++
T Consensus       169 pic~~cGrv~~~~~~~~~~~~v~Y~c~-cG~~g~~~  203 (515)
T TIGR00467       169 VFCENCGRDTTTVNNYDNEYSIEYSCE-CGNQESVD  203 (515)
T ss_pred             eecCCcCccCceEEEecCCceEEEEcC-CCCEEEEe
Confidence            57999999998643222 115789995 99987654


No 220
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=65.25  E-value=1.6  Score=26.18  Aligned_cols=13  Identities=62%  Similarity=1.183  Sum_probs=8.7

Q ss_pred             CCCcCCCCCcccc
Q 033869            2 EFCPTCGTMLQYE   14 (110)
Q Consensus         2 ~FCp~C~nlL~~~   14 (110)
                      .||+.||+-|...
T Consensus        49 ~FC~~CGs~l~~~   61 (92)
T PF04828_consen   49 YFCPTCGSPLFSE   61 (92)
T ss_dssp             EEETTT--EEEEE
T ss_pred             cccCCCCCeeecc
Confidence            3899999988864


No 221
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=64.52  E-value=3  Score=27.80  Aligned_cols=13  Identities=54%  Similarity=1.303  Sum_probs=12.1

Q ss_pred             CCCcCCCCCcccc
Q 033869            2 EFCPTCGTMLQYE   14 (110)
Q Consensus         2 ~FCp~C~nlL~~~   14 (110)
                      .||+.||+-|+-+
T Consensus        70 ~FC~~CGs~l~~~   82 (133)
T COG3791          70 GFCPTCGSPLFWR   82 (133)
T ss_pred             eecccCCCceEEe
Confidence            5999999999998


No 222
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=64.35  E-value=5.7  Score=29.21  Aligned_cols=26  Identities=31%  Similarity=0.736  Sum_probs=20.4

Q ss_pred             CCcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCccc
Q 033869           66 QTEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        66 ~~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      .+-..||.||+               -...-|.|.+  ||+.+
T Consensus       307 ~tS~~C~~cg~---------------~~~r~~~C~~--cg~~~  332 (364)
T COG0675         307 YTSKTCPCCGH---------------LSGRLFKCPR--CGFVH  332 (364)
T ss_pred             CCcccccccCC---------------ccceeEECCC--CCCee
Confidence            46689999999               1246699999  99875


No 223
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=64.29  E-value=1.8  Score=24.81  Aligned_cols=32  Identities=22%  Similarity=0.437  Sum_probs=23.5

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      -|..||.+|.--  +...-+...|+.|.-.....
T Consensus         6 RC~~CnKlLa~a--~~~~yle~KCPrCK~vN~~~   37 (60)
T COG4416           6 RCAKCNKLLAEA--EGQAYLEKKCPRCKEVNEFY   37 (60)
T ss_pred             ehHHHhHHHHhc--ccceeeeecCCccceeeeee
Confidence            378899988766  44446788999998765543


No 224
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=63.71  E-value=1.6  Score=35.07  Aligned_cols=25  Identities=32%  Similarity=0.871  Sum_probs=19.8

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      .|||.|+|-..+.  +    -+-.||.||-+
T Consensus       181 ~~CP~Ca~~F~l~--r----RrHHCRLCG~V  205 (505)
T KOG1842|consen  181 QFCPECANSFGLT--R----RRHHCRLCGRV  205 (505)
T ss_pred             cccccccchhhhH--H----HhhhhhhcchH
Confidence            5999999988776  2    26789999875


No 225
>PF01921 tRNA-synt_1f:  tRNA synthetases class I (K);  InterPro: IPR002904 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Lysyl-tRNA synthetase (6.1.1.6 from EC) is an alpha 2 homodimer that belong to both class I and class II. In eubacteria and eukaryota lysyl-tRNA synthetases belong to class II in the same family as aspartyl tRNA synthetase. The class Ic lysyl-tRNA synthetase family is present in archaea and in a number of bacterial groups that include the alphaproteobacteria and spirochaetes[]. A refined crystal structures shows that the active site of LysU is shaped to position the substrates for the nucleophilic attack of the lysine carboxylate on the ATP alpha-phosphate. No residues are directly involved in catalysis, but a number of highly conserved amino acids and three metal ions coordinate the substrates and stabilise the pentavalent transition state. A loop close to the catalytic pocket, disordered in the lysine-bound structure, becomes ordered upon adenine binding [].; GO: 0000166 nucleotide binding, 0004824 lysine-tRNA ligase activity, 0005524 ATP binding, 0006430 lysyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1IRX_A.
Probab=63.31  E-value=6.9  Score=30.67  Aligned_cols=35  Identities=23%  Similarity=0.445  Sum_probs=20.6

Q ss_pred             CcccCCCCCC-CceEEEEeccCCCC-CCceEEEEecCCCCCccc
Q 033869           67 TEVTCPACKH-GKAVYHELQTRSAD-EPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        67 ~~~~CpkCg~-~~a~~~~~Q~RsaD-E~~T~fY~C~~~~C~~~w  108 (110)
                      ....|++||. ....-.     +-| ++-|+.|+|..  |||+-
T Consensus       173 f~piC~~cGri~tt~v~-----~~d~~~~~v~Y~c~~--cG~~g  209 (360)
T PF01921_consen  173 FLPICEKCGRIDTTEVT-----EYDPEGGTVTYRCEE--CGHEG  209 (360)
T ss_dssp             EEEEETTTEE--EEEEE-----EE--SSSEEEEE--T--TS---
T ss_pred             eeeeccccCCcccceee-----EeecCCCEEEEEecC--CCCEE
Confidence            3668999998 444332     233 67899999977  99963


No 226
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=62.93  E-value=1.6  Score=30.78  Aligned_cols=30  Identities=27%  Similarity=0.645  Sum_probs=22.8

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      .--.||+||   ..|      +.+|+|..-|.|..  ||..
T Consensus       116 ~~Y~Cp~C~---~ry------tf~eA~~~~F~Cp~--Cg~~  145 (178)
T PRK06266        116 MFFFCPNCH---IRF------TFDEAMEYGFRCPQ--CGEM  145 (178)
T ss_pred             CEEECCCCC---cEE------eHHHHhhcCCcCCC--CCCC
Confidence            346899998   334      55677888999999  9864


No 227
>PRK12495 hypothetical protein; Provisional
Probab=62.74  E-value=6.6  Score=28.77  Aligned_cols=27  Identities=22%  Similarity=0.588  Sum_probs=21.3

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      .+|+.||.-|.-.      .....|..|+....
T Consensus        43 ~hC~~CG~PIpa~------pG~~~Cp~CQ~~~~   69 (226)
T PRK12495         43 AHCDECGDPIFRH------DGQEFCPTCQQPVT   69 (226)
T ss_pred             hhcccccCcccCC------CCeeECCCCCCccc
Confidence            4899999999833      34889999997644


No 228
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase. Members of this protein family, from both bacteria and eukaryotes, are the enzyme 3-hydroxyanthranilate 3,4-dioxygenase. This enzyme acts on the tryptophan metabolite 3-hydroxyanthranilate and produces 2-amino-3-carboxymuconate semialdehyde, which can rearrange spontaneously to quinolinic acid and feed into nicotinamide biosynthesis, or undergo further enzymatic degradation.
Probab=62.62  E-value=7.2  Score=27.11  Aligned_cols=15  Identities=20%  Similarity=0.379  Sum_probs=11.7

Q ss_pred             CCCceEEcCCCCCee
Q 033869           19 DRPSRFSCPACPYVC   33 (110)
Q Consensus        19 ~~~~~~~C~~C~y~~   33 (110)
                      ..+++|.|.+|+..-
T Consensus       110 ~d~~~wyc~~c~~~~  124 (159)
T TIGR03037       110 LDGFQWFCPQCGHKL  124 (159)
T ss_pred             CcceEEECCCCCCeE
Confidence            458899999997643


No 229
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=62.04  E-value=6.4  Score=23.04  Aligned_cols=17  Identities=18%  Similarity=0.546  Sum_probs=14.1

Q ss_pred             CceEEcCCCCCeeeeCC
Q 033869           21 PSRFSCPACPYVCNMES   37 (110)
Q Consensus        21 ~~~~~C~~C~y~~~~~~   37 (110)
                      ...+.|+.||..+++.+
T Consensus        51 eg~L~Cp~c~r~YPI~d   67 (68)
T PF03966_consen   51 EGELICPECGREYPIRD   67 (68)
T ss_dssp             TTEEEETTTTEEEEEET
T ss_pred             CCEEEcCCCCCEEeCCC
Confidence            45899999999988754


No 230
>PF08882 Acetone_carb_G:  Acetone carboxylase gamma subunit;  InterPro: IPR014979 Acetone carboxylase is the key enzyme of bacterial acetone metabolism, catalysing the condensation of acetone and CO2 to form acetoacetate [] according to the following reaction:  CH3COCH3 + CO2 + ATP = CH3COCH2COO- + AMP + 2P(i) + H+   It has the subunit composition: (alpha(2)beta(2)gamma(2) multimers of 85kDa, 78kDa, and 20kDa subunits). It is expressed to high levels (17 to 25% of soluble protein) in cells grown with acetone as the carbon source but are not present at detectable levels in cells grown with other carbon sources []. Acetone carboxylase may enable Helicobacter pylori to survive off acetone in the stomach of humans and other mammals where it is the etiological agent of peptic ulcer disease []. This entry represents the family of gamma subunit-related acetone carboxylase proteins.
Probab=61.73  E-value=3.3  Score=27.16  Aligned_cols=12  Identities=58%  Similarity=1.411  Sum_probs=10.3

Q ss_pred             CCcCCCCCcccc
Q 033869            3 FCPTCGTMLQYE   14 (110)
Q Consensus         3 FCp~C~nlL~~~   14 (110)
                      +||.||.||..+
T Consensus        76 yCP~Cgt~levE   87 (112)
T PF08882_consen   76 YCPGCGTQLEVE   87 (112)
T ss_pred             ECCCCcceeEEc
Confidence            789999998877


No 231
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=61.16  E-value=1.3  Score=23.10  Aligned_cols=8  Identities=38%  Similarity=1.169  Sum_probs=3.6

Q ss_pred             EcCCCCCe
Q 033869           25 SCPACPYV   32 (110)
Q Consensus        25 ~C~~C~y~   32 (110)
                      .|+.||.+
T Consensus         3 ~C~~Cg~~   10 (36)
T PF05191_consen    3 ICPKCGRI   10 (36)
T ss_dssp             EETTTTEE
T ss_pred             CcCCCCCc
Confidence            44444433


No 232
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=61.11  E-value=6.4  Score=30.12  Aligned_cols=38  Identities=18%  Similarity=0.553  Sum_probs=25.6

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      ...||-||..-. .-.++....++| -+|..|.-  |++.|+
T Consensus       184 ~~~CPvCGs~P~-~s~~~~~~~~~G-~RyL~Csl--C~teW~  221 (305)
T TIGR01562       184 RTLCPACGSPPV-ASMVRQGGKETG-LRYLSCSL--CATEWH  221 (305)
T ss_pred             CCcCCCCCChhh-hhhhcccCCCCC-ceEEEcCC--CCCccc
Confidence            348999997542 111222233566 68899998  999996


No 233
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=61.10  E-value=7.2  Score=30.48  Aligned_cols=23  Identities=30%  Similarity=0.553  Sum_probs=18.7

Q ss_pred             cccCCCCCCCceEEEEe--ccCCCC
Q 033869           68 EVTCPACKHGKAVYHEL--QTRSAD   90 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~--Q~RsaD   90 (110)
                      ...||.|+.....||.+  |.|+.-
T Consensus       129 ~~~Cp~C~r~~~~y~eAivQvR~~~  153 (355)
T COG1499         129 RTLCPRCSRFTGGYYEAIVQVRAKG  153 (355)
T ss_pred             EeEChhhhccccceeEEEEEEEecc
Confidence            56999999988888865  988764


No 234
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=60.56  E-value=4.2  Score=28.85  Aligned_cols=13  Identities=31%  Similarity=0.633  Sum_probs=11.4

Q ss_pred             CCCcCCCCCcccc
Q 033869            2 EFCPTCGTMLQYE   14 (110)
Q Consensus         2 ~FCp~C~nlL~~~   14 (110)
                      .||+.||+-|+..
T Consensus        90 ~FC~~CGS~L~~~  102 (182)
T TIGR02820        90 HACKGCGTHMYGR  102 (182)
T ss_pred             ecCCCCCCccccc
Confidence            4999999999876


No 235
>cd00674 LysRS_core_class_I catalytic core domain of  class I lysyl tRNA synthetase. Class I lysyl tRNA synthetase (LysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.
Probab=60.11  E-value=7.4  Score=30.30  Aligned_cols=34  Identities=18%  Similarity=0.464  Sum_probs=21.3

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      ..-.||+||--.   ..+ +.-..+.-|+.|.|.   |||.
T Consensus       168 ~~p~c~~cg~~~---~~v-~~~d~~~~~v~y~c~---cG~~  201 (353)
T cd00674         168 FMPYCEKCGKDT---TTV-EAYDAKAGTVTYKCE---CGHE  201 (353)
T ss_pred             eeeecCCcCcce---eEE-EEEeCCCCeEEEEcC---CCCE
Confidence            356899999322   111 112234569999994   9985


No 236
>TIGR01405 polC_Gram_pos DNA polymerase III, alpha chain, Gram-positive type. The N-terminal region of about 200 amino acids is rich in low-complexity sequence, poorly alignable, and not included n this model.
Probab=59.88  E-value=6.5  Score=35.43  Aligned_cols=17  Identities=29%  Similarity=0.880  Sum_probs=13.4

Q ss_pred             CceEEcCCCCCeeeeCC
Q 033869           21 PSRFSCPACPYVCNMES   37 (110)
Q Consensus        21 ~~~~~C~~C~y~~~~~~   37 (110)
                      ...|.|++|.|.+-.++
T Consensus       681 ~phy~c~~c~~~ef~~~  697 (1213)
T TIGR01405       681 PPHYLCPNCKYSEFITD  697 (1213)
T ss_pred             cccccCccccccccccc
Confidence            34799999999877655


No 237
>PF02132 RecR:  RecR protein;  InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []. It may act with RecF and RecO.  RecR's structure consists of a N-terminal helix-hairpin-helix (HhH) motif, followed by a Cys4 zinc-finger motif, a Toprim domain and a Walker B motif []. This entry represents the C4-type zinc finger.; PDB: 1VDD_D 2V1C_B.
Probab=59.87  E-value=2.4  Score=22.53  Aligned_cols=10  Identities=40%  Similarity=1.291  Sum_probs=4.7

Q ss_pred             CCCcCCCCCc
Q 033869            2 EFCPTCGTML   11 (110)
Q Consensus         2 ~FCp~C~nlL   11 (110)
                      +||+.|||+=
T Consensus        18 ~~C~~C~nls   27 (41)
T PF02132_consen   18 KFCSICGNLS   27 (41)
T ss_dssp             EE-SSS--EE
T ss_pred             CccCCCCCcC
Confidence            5778887763


No 238
>PF11672 DUF3268:  Protein of unknown function (DUF3268);  InterPro: IPR021686 This entry is represented by Listeria phage P100, Gp150. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=59.45  E-value=9.9  Score=24.50  Aligned_cols=33  Identities=24%  Similarity=0.603  Sum_probs=18.7

Q ss_pred             ccCCCCCCCceEEEEe-c--cCCCCCCceEEEEecCCCCC
Q 033869           69 VTCPACKHGKAVYHEL-Q--TRSADEPMSIFYMCANKNCK  105 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~-Q--~RsaDE~~T~fY~C~~~~C~  105 (110)
                      ..||-||.. +.+-.. .  -++.|++. .+|+|..  |+
T Consensus         3 ~~CpYCg~~-~~l~~~~~iYg~~~~~~~-~~y~C~~--C~   38 (102)
T PF11672_consen    3 IICPYCGGP-AELVDGSEIYGHRYDDGP-YLYVCTP--CD   38 (102)
T ss_pred             cccCCCCCe-eEEcccchhcCccCCCCc-eeEECCC--CC
Confidence            579999972 111110 0  14555554 4599999  95


No 239
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=59.08  E-value=4.5  Score=28.90  Aligned_cols=14  Identities=21%  Similarity=0.619  Sum_probs=12.1

Q ss_pred             CCCcCCCCCccccc
Q 033869            2 EFCPTCGTMLQYEL   15 (110)
Q Consensus         2 ~FCp~C~nlL~~~~   15 (110)
                      .||+.||+-|+...
T Consensus        94 ~FC~~CGS~L~~~~  107 (191)
T PRK05417         94 HACKECGVHMYGRI  107 (191)
T ss_pred             eeCCCCCCcccccc
Confidence            49999999998873


No 240
>PRK00448 polC DNA polymerase III PolC; Validated
Probab=59.00  E-value=6.9  Score=35.89  Aligned_cols=17  Identities=29%  Similarity=0.884  Sum_probs=13.5

Q ss_pred             CceEEcCCCCCeeeeCC
Q 033869           21 PSRFSCPACPYVCNMES   37 (110)
Q Consensus        21 ~~~~~C~~C~y~~~~~~   37 (110)
                      ...|.|++|.|.+-.++
T Consensus       906 ~phy~C~~C~~~ef~~~  922 (1437)
T PRK00448        906 PPHYVCPNCKYSEFFTD  922 (1437)
T ss_pred             CccccCccccccccccc
Confidence            34799999999877655


No 241
>PF00628 PHD:  PHD-finger;  InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the PHD (homeodomain) zinc finger domain [,], which is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in chromatin-mediated transcriptional regulation. The PHD finger motif is reminiscent of, but distinct from the C3HC4 type RING finger. The function of this domain is not yet known but in analogy with the LIM domain it could be involved in protein-protein interaction and be important for the assembly or activity of multicomponent complexes involved in transcriptional activation or repression. Alternatively, the interactions could be intra-molecular and be important in maintaining the structural integrity of the protein. In similarity to the RING finger and the LIM domain, the PHD finger is thought to bind two zinc ions. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0005515 protein binding; PDB: 3ZVY_A 2LGG_A 3SOW_A 3SOU_B 3ASL_A 3ASK_A 3ZVZ_B 3T6R_A 2LGK_A 3SOX_B ....
Probab=58.37  E-value=16  Score=19.65  Aligned_cols=26  Identities=27%  Similarity=0.816  Sum_probs=18.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      ||+-|+.   ..    .....+.|..|+.....
T Consensus         1 ~C~vC~~---~~----~~~~~i~C~~C~~~~H~   26 (51)
T PF00628_consen    1 YCPVCGQ---SD----DDGDMIQCDSCNRWYHQ   26 (51)
T ss_dssp             EBTTTTS---SC----TTSSEEEBSTTSCEEET
T ss_pred             eCcCCCC---cC----CCCCeEEcCCCChhhCc
Confidence            6888888   22    23579999999965543


No 242
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional
Probab=58.15  E-value=8.8  Score=27.18  Aligned_cols=15  Identities=13%  Similarity=0.268  Sum_probs=11.7

Q ss_pred             CCCceEEcCCCCCee
Q 033869           19 DRPSRFSCPACPYVC   33 (110)
Q Consensus        19 ~~~~~~~C~~C~y~~   33 (110)
                      ...++|.|.+|+..-
T Consensus       116 ~d~~~wyc~~c~~~~  130 (177)
T PRK13264        116 LDGFQWYCDECNHKV  130 (177)
T ss_pred             ccceEEECCCCCCeE
Confidence            457899999998643


No 243
>PF08063 PADR1:  PADR1 (NUC008) domain;  InterPro: IPR012982 This domain is found in poly(ADP-ribose)-synthetases []. The function of this domain is unknown.; GO: 0003950 NAD+ ADP-ribosyltransferase activity, 0005634 nucleus; PDB: 2JVN_A 4DQY_E 2RIQ_A.
Probab=58.07  E-value=3.6  Score=23.46  Aligned_cols=19  Identities=32%  Similarity=0.880  Sum_probs=11.8

Q ss_pred             CCcCCCC-CcccccCCCCCCceEEcC
Q 033869            3 FCPTCGT-MLQYELPHMDRPSRFSCP   27 (110)
Q Consensus         3 FCp~C~n-lL~~~~~~~~~~~~~~C~   27 (110)
                      =||+|++ .|+..      ...|.|.
T Consensus        16 ~Cp~C~~~~l~~~------~~~Y~C~   35 (55)
T PF08063_consen   16 PCPKCKGGQLYFD------GSGYKCT   35 (55)
T ss_dssp             --SSSSE-EEEEE------TTEEEEE
T ss_pred             CCCCCCCCeEEec------CCccEeC
Confidence            4899998 56665      2278875


No 244
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete. This model represents the lysyl-tRNA synthetases that are class I amino-acyl tRNA synthetases. It includes archaeal and spirochete examples of the enzyme. All other known examples are class IIc amino-acyl tRNA synthetases and seem to form a separate orthologous set.
Probab=57.99  E-value=11  Score=30.79  Aligned_cols=33  Identities=24%  Similarity=0.520  Sum_probs=21.6

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      ..-.||+||.-....  . ...++.  |+-|.|.   |||.
T Consensus       167 ~~pic~~cGrv~~~~--~-~~~~~~--~v~Y~c~---cG~~  199 (515)
T TIGR00467       167 ISVFCENCGRDTTTV--N-NYDNEY--SIEYSCE---CGNQ  199 (515)
T ss_pred             eeeecCCcCccCceE--E-EecCCc--eEEEEcC---CCCE
Confidence            466899999863311  1 233333  8999995   9985


No 245
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=57.28  E-value=3.9  Score=27.68  Aligned_cols=21  Identities=29%  Similarity=0.858  Sum_probs=16.5

Q ss_pred             CCCCCCceEEEEecCCCCCcccc
Q 033869           87 RSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        87 RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      |-..|....||.|.+  |+.+|.
T Consensus        90 ~l~~e~~~~~Y~Cp~--C~~~y~  110 (147)
T smart00531       90 KLEDETNNAYYKCPN--CQSKYT  110 (147)
T ss_pred             HHhcccCCcEEECcC--CCCEee
Confidence            444566778999999  999885


No 246
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=57.05  E-value=20  Score=23.33  Aligned_cols=30  Identities=27%  Similarity=0.585  Sum_probs=23.5

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      +.|+.||+.+..+-..       +-+.|-.|..  ||.+
T Consensus        81 VlC~~C~spdT~l~k~-------~r~~~l~C~a--CGa~  110 (110)
T smart00653       81 VLCPECGSPDTELIKE-------NRLFFLKCEA--CGAR  110 (110)
T ss_pred             EECCCCCCCCcEEEEe-------CCeEEEEccc--cCCC
Confidence            6999999998766432       4578889998  9864


No 247
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=56.15  E-value=1.4  Score=28.64  Aligned_cols=23  Identities=35%  Similarity=0.849  Sum_probs=10.2

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      +|..||.-..+.      ...+.|+.||-
T Consensus        72 ~C~~Cg~~~~~~------~~~~~CP~Cgs   94 (113)
T PF01155_consen   72 RCRDCGHEFEPD------EFDFSCPRCGS   94 (113)
T ss_dssp             EETTTS-EEECH------HCCHH-SSSSS
T ss_pred             ECCCCCCEEecC------CCCCCCcCCcC
Confidence            355555555544      11244565554


No 248
>PRK14973 DNA topoisomerase I; Provisional
Probab=55.56  E-value=6.8  Score=34.36  Aligned_cols=33  Identities=21%  Similarity=0.460  Sum_probs=24.1

Q ss_pred             CCcCCCC--CcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGT--MLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~n--lL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -||+||.  ++..+  .+..+..+.|+.|.|.+....
T Consensus       637 ~Cp~CG~p~~~~~r--~Gr~g~fl~CP~C~~~~~~~~  671 (936)
T PRK14973        637 VCPIHHLNHVRLIR--KGARPWDIGCPLCSHIESNTE  671 (936)
T ss_pred             CCCCCCCCceEEee--cCCCcccccCccccchhhccc
Confidence            4999997  56656  555566788999999776543


No 249
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=55.54  E-value=18  Score=25.82  Aligned_cols=30  Identities=20%  Similarity=0.489  Sum_probs=24.2

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      +.|+.||+.+..+.-       ++-+.|-.|..  ||..
T Consensus        99 V~C~~C~~pdT~l~k-------~~~~~~l~C~a--CGa~  128 (201)
T PRK12336         99 VICSECGLPDTRLVK-------EDRVLMLRCDA--CGAH  128 (201)
T ss_pred             EECCCCCCCCcEEEE-------cCCeEEEEccc--CCCC
Confidence            799999999977742       25688899999  9875


No 250
>COG3877 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=55.49  E-value=9.7  Score=24.92  Aligned_cols=23  Identities=30%  Similarity=0.818  Sum_probs=19.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      =||.||.-|..-        .+.|++|+.+.
T Consensus         8 ~cPvcg~~~iVT--------eL~c~~~etTV   30 (122)
T COG3877           8 RCPVCGRKLIVT--------ELKCSNCETTV   30 (122)
T ss_pred             CCCcccccceeE--------EEecCCCCceE
Confidence            489999888777        89999999753


No 251
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=55.38  E-value=7  Score=25.36  Aligned_cols=20  Identities=35%  Similarity=0.693  Sum_probs=15.5

Q ss_pred             cCCCCCCCceEEEEeccCCC
Q 033869           70 TCPACKHGKAVYHELQTRSA   89 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~Rsa   89 (110)
                      =||+||.+.-.|.-.-.|.|
T Consensus        22 GCp~CG~nkF~yv~~e~rpa   41 (112)
T COG3364          22 GCPKCGCNKFLYVPEEKRPA   41 (112)
T ss_pred             cCccccchheEecccccccc
Confidence            49999999988876655554


No 252
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=54.78  E-value=11  Score=20.47  Aligned_cols=28  Identities=25%  Similarity=0.782  Sum_probs=19.0

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      .+|..|+.+|...     ...-|.|..|++...
T Consensus        12 ~~C~~C~~~i~g~-----~~~g~~C~~C~~~~H   39 (53)
T PF00130_consen   12 TYCDVCGKFIWGL-----GKQGYRCSWCGLVCH   39 (53)
T ss_dssp             EB-TTSSSBECSS-----SSCEEEETTTT-EEE
T ss_pred             CCCcccCcccCCC-----CCCeEEECCCCChHh
Confidence            4799999999322     235899999998654


No 253
>PF10005 DUF2248:  Uncharacterized protein conserved in bacteria (DUF2248);  InterPro: IPR011201 This is a family of uncharacterised bacterial proteins.
Probab=54.35  E-value=6.5  Score=30.61  Aligned_cols=25  Identities=28%  Similarity=0.836  Sum_probs=20.4

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      |+.||+.|+.+        .-.|-+||..-...
T Consensus         2 C~~Cg~~v~Fe--------Nt~C~~Cg~~LGf~   26 (343)
T PF10005_consen    2 CPNCGQPVFFE--------NTRCLSCGSALGFD   26 (343)
T ss_pred             CCCCCCcceeC--------CCccccCCccccCC
Confidence            99999999999        45799999865443


No 254
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=54.21  E-value=13  Score=25.33  Aligned_cols=18  Identities=33%  Similarity=0.575  Sum_probs=14.6

Q ss_pred             CCCCcccCCCCCC-CceEE
Q 033869           64 GPQTEVTCPACKH-GKAVY   81 (110)
Q Consensus        64 ~~~~~~~CpkCg~-~~a~~   81 (110)
                      ..|+++.|.+||. -..+|
T Consensus        88 m~RtEv~C~~Cg~HLGHVF  106 (142)
T PRK00222         88 MVRTEVRCANCDSHLGHVF  106 (142)
T ss_pred             ceEEEEEeCCCCCccCccc
Confidence            5678999999995 47777


No 255
>COG4647 AcxC Acetone carboxylase, gamma subunit [Secondary metabolites biosynthesis, transport, and catabolism]
Probab=53.86  E-value=5.4  Score=27.06  Aligned_cols=12  Identities=42%  Similarity=1.182  Sum_probs=10.8

Q ss_pred             CCcCCCCCcccc
Q 033869            3 FCPTCGTMLQYE   14 (110)
Q Consensus         3 FCp~C~nlL~~~   14 (110)
                      |||+||-|+..+
T Consensus       122 icpecg~l~eve  133 (165)
T COG4647         122 ICPECGILHEVE  133 (165)
T ss_pred             hCccccceeeec
Confidence            899999999887


No 256
>cd02673 Peptidase_C19Q A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=53.71  E-value=13  Score=27.16  Aligned_cols=16  Identities=25%  Similarity=0.702  Sum_probs=12.5

Q ss_pred             ceEEcCCCCCeeeeCC
Q 033869           22 SRFSCPACPYVCNMES   37 (110)
Q Consensus        22 ~~~~C~~C~y~~~~~~   37 (110)
                      ..+.|..|+++....+
T Consensus        80 s~i~C~~C~~~s~~~e   95 (245)
T cd02673          80 SSYVCIGCSFEENVSD   95 (245)
T ss_pred             eEEEecCCCCeeeecc
Confidence            4689999998876554


No 257
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=53.29  E-value=11  Score=25.09  Aligned_cols=39  Identities=28%  Similarity=0.536  Sum_probs=26.6

Q ss_pred             CCCCcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           64 GPQTEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        64 ~~~~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      .......||.|+..- +.-.-..+..    -.=|.|..  |+..|.
T Consensus        26 ~~~~~~~cP~C~s~~-~~k~g~~~~~----~qRyrC~~--C~~tf~   64 (129)
T COG3677          26 MQITKVNCPRCKSSN-VVKIGGIRRG----HQRYKCKS--CGSTFT   64 (129)
T ss_pred             hhcccCcCCCCCccc-eeeECCcccc----ccccccCC--cCccee
Confidence            445678999999877 4444443332    33499999  998875


No 258
>PRK05978 hypothetical protein; Provisional
Probab=53.27  E-value=6.9  Score=26.90  Aligned_cols=31  Identities=29%  Similarity=0.574  Sum_probs=20.4

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCccc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      ..-+||+||..+++=-         -.++-=.|..  ||..+
T Consensus        32 l~grCP~CG~G~LF~g---------~Lkv~~~C~~--CG~~~   62 (148)
T PRK05978         32 FRGRCPACGEGKLFRA---------FLKPVDHCAA--CGEDF   62 (148)
T ss_pred             HcCcCCCCCCCccccc---------ccccCCCccc--cCCcc
Confidence            3679999999887421         2334456777  77654


No 259
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=53.05  E-value=7.4  Score=26.75  Aligned_cols=13  Identities=31%  Similarity=0.927  Sum_probs=6.1

Q ss_pred             eEEEEecCCCCCccc
Q 033869           94 SIFYMCANKNCKHRW  108 (110)
Q Consensus        94 T~fY~C~~~~C~~~w  108 (110)
                      ..||.|.+  |+.+|
T Consensus       107 ~~~Y~Cp~--c~~r~  119 (158)
T TIGR00373       107 NMFFICPN--MCVRF  119 (158)
T ss_pred             CCeEECCC--CCcEe
Confidence            34455544  44444


No 260
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=53.00  E-value=10  Score=25.81  Aligned_cols=26  Identities=23%  Similarity=0.621  Sum_probs=20.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      -||.|+.-|...  .   ...|.|..|+...
T Consensus        36 aC~~C~kkv~~~--~---~~~~~C~~C~~~~   61 (166)
T cd04476          36 ACPGCNKKVVEE--G---NGTYRCEKCNKSV   61 (166)
T ss_pred             cccccCcccEeC--C---CCcEECCCCCCcC
Confidence            599999988765  2   1589999999764


No 261
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=52.87  E-value=13  Score=25.18  Aligned_cols=18  Identities=39%  Similarity=0.652  Sum_probs=14.7

Q ss_pred             CCCCcccCCCCC-CCceEE
Q 033869           64 GPQTEVTCPACK-HGKAVY   81 (110)
Q Consensus        64 ~~~~~~~CpkCg-~~~a~~   81 (110)
                      ..++++.|.+|| |-..+|
T Consensus        85 m~RtEv~C~~Cg~HLGHVF  103 (134)
T TIGR00357        85 MIRTEVRCRNCDAHLGHVF  103 (134)
T ss_pred             cEEEEEEecCCCCccCccc
Confidence            567999999999 457777


No 262
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only]
Probab=52.51  E-value=4.1  Score=27.99  Aligned_cols=21  Identities=33%  Similarity=0.936  Sum_probs=14.0

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      .||.-||   +++        .|.|-+||...
T Consensus       119 ~fCaVCG---~~S--------~ysC~~CG~ky  139 (156)
T KOG3362|consen  119 KFCAVCG---YDS--------KYSCVNCGTKY  139 (156)
T ss_pred             hhhhhcC---CCc--------hhHHHhcCCce
Confidence            4777787   344        67788887643


No 263
>KOG1812 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=52.15  E-value=8.5  Score=30.28  Aligned_cols=25  Identities=24%  Similarity=0.717  Sum_probs=20.2

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      =||.|+.++...    .+-+.+.|| ||+.
T Consensus       308 ~CpkC~~~ie~~----~GCnhm~Cr-C~~~  332 (384)
T KOG1812|consen  308 QCPKCKFMIELS----EGCNHMTCR-CGHQ  332 (384)
T ss_pred             cCcccceeeeec----CCcceEEee-cccc
Confidence            499999998665    337899999 9974


No 264
>COG1552 RPL40A Ribosomal protein L40E [Translation, ribosomal structure and biogenesis]
Probab=51.82  E-value=2.6  Score=23.61  Aligned_cols=23  Identities=22%  Similarity=0.430  Sum_probs=16.7

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      |-.||-...+.        .-.||.|+|...
T Consensus        17 C~rC~Arnp~~--------A~kCRkC~~k~L   39 (50)
T COG1552          17 CRRCYARNPPR--------ATKCRKCGYKNL   39 (50)
T ss_pred             HHHhcCCCCcc--------hhHHhhccCCCc
Confidence            66777777666        557999998643


No 265
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=51.68  E-value=10  Score=30.21  Aligned_cols=31  Identities=23%  Similarity=0.666  Sum_probs=23.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      -||+|+-+...+  .-+....-.|+.||.+-..
T Consensus        20 ~C~eCd~~~~~P--~l~~~q~A~CPRC~~~l~~   50 (418)
T COG2995          20 LCPECDMLVSLP--RLDSGQSAYCPRCGHTLTR   50 (418)
T ss_pred             cCCCCCceeccc--cCCCCCcccCCCCCCcccc
Confidence            599999887777  5455668899999986443


No 266
>TIGR01051 topA_bact DNA topoisomerase I, bacterial. This model describes DNA topoisomerase I among the members of bacteria. DNA topoisomerase I transiently cleaves one DNA strand and thus relaxes negatively supercoiled DNA during replication, transcription and recombination events.
Probab=51.13  E-value=12  Score=31.03  Aligned_cols=31  Identities=26%  Similarity=0.577  Sum_probs=19.7

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecC-CCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCAN-KNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~-~~C~~~  107 (110)
                      ..||+||+. +     ..|+...|  .||.|.+ +.|++.
T Consensus       575 ~~CP~Cg~~-~-----~~~~~~~g--kf~gCs~y~~C~~~  606 (610)
T TIGR01051       575 QDCPLCGRP-M-----VVKLGKYG--PFLACSNFPECKYT  606 (610)
T ss_pred             CCCCCCCCe-e-----EEEecCCC--ceeeCCCCCCCCCC
Confidence            579999974 2     22333334  4899987 667654


No 267
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=50.91  E-value=8.3  Score=22.16  Aligned_cols=22  Identities=32%  Similarity=0.798  Sum_probs=13.7

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      |+.|+.||..=. +         -.|+.||-.
T Consensus         5 mr~C~~CgvYTL-k---------~~CP~CG~~   26 (56)
T PRK13130          5 IRKCPKCGVYTL-K---------EICPVCGGK   26 (56)
T ss_pred             ceECCCCCCEEc-c---------ccCcCCCCC
Confidence            567888875422 2         357888854


No 268
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=50.76  E-value=8  Score=19.23  Aligned_cols=18  Identities=33%  Similarity=1.169  Sum_probs=10.5

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      +|.-||+   ..        .|.|+.|+.
T Consensus         4 ~C~vC~~---~~--------kY~Cp~C~~   21 (30)
T PF04438_consen    4 LCSVCGN---PA--------KYRCPRCGA   21 (30)
T ss_dssp             EETSSSS---EE--------SEE-TTT--
T ss_pred             CCccCcC---CC--------EEECCCcCC
Confidence            5677776   33        688888875


No 269
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=50.73  E-value=11  Score=21.64  Aligned_cols=25  Identities=32%  Similarity=0.833  Sum_probs=18.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      +||-|+.-+..       ...|.|+.||....
T Consensus         1 ~Cpv~~~~~~~-------~v~~~Cp~cGipth   25 (55)
T PF13824_consen    1 LCPVCKKDLPA-------HVNFECPDCGIPTH   25 (55)
T ss_pred             CCCCCcccccc-------ccCCcCCCCCCcCc
Confidence            68888877622       35899999997644


No 270
>cd00029 C1 Protein kinase C conserved region 1 (C1) . Cysteine-rich zinc binding domain. Some members of this domain family bind phorbol esters and diacylglycerol, some are reported to bind RasGTP. May occur in tandem arrangement. Diacylglycerol (DAG) is a second messenger, released by activation of Phospholipase D. Phorbol Esters (PE) can act as analogues of DAG and mimic its downstream effects in, for example, tumor promotion. Protein Kinases C are activated by DAG/PE, this activation is mediated by their N-terminal conserved region (C1). DAG/PE binding may be phospholipid dependent. C1 domains may also mediate DAG/PE signals in chimaerins (a family of Rac GTPase activating proteins), RasGRPs (exchange factors for Ras/Rap1), and Munc13 isoforms (scaffolding proteins involved in exocytosis).
Probab=50.07  E-value=13  Score=19.59  Aligned_cols=28  Identities=21%  Similarity=0.554  Sum_probs=20.5

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      .||.-|+..|...     ...-+.|+.|++...
T Consensus        12 ~~C~~C~~~i~~~-----~~~~~~C~~C~~~~H   39 (50)
T cd00029          12 TFCDVCRKSIWGL-----FKQGLRCSWCKVKCH   39 (50)
T ss_pred             CChhhcchhhhcc-----ccceeEcCCCCCchh
Confidence            4899999988753     134788999998643


No 271
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=49.68  E-value=21  Score=23.65  Aligned_cols=18  Identities=33%  Similarity=0.724  Sum_probs=14.8

Q ss_pred             CCCCcccCCCCCC-CceEE
Q 033869           64 GPQTEVTCPACKH-GKAVY   81 (110)
Q Consensus        64 ~~~~~~~CpkCg~-~~a~~   81 (110)
                      ..|+++.|.+||. -..+|
T Consensus        75 ~~RtEv~C~~C~~HLGHVF   93 (119)
T PRK05508         75 GRRTEIVCANCGGHLGHVF   93 (119)
T ss_pred             CcEEEEEeCCCCCccCccc
Confidence            5689999999994 57777


No 272
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=49.03  E-value=11  Score=24.93  Aligned_cols=22  Identities=32%  Similarity=0.925  Sum_probs=13.3

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      |..|+.-..+.      .+.+.|+.||-
T Consensus        73 C~~C~~~~~~e------~~~~~CP~C~s   94 (115)
T COG0375          73 CLDCGQEVELE------ELDYRCPKCGS   94 (115)
T ss_pred             eccCCCeecch------hheeECCCCCC
Confidence            66676555554      33555888874


No 273
>KOG3799 consensus Rab3 effector RIM1 and related proteins, contain Rab3a binding domain [Intracellular trafficking, secretion, and vesicular transport]
Probab=48.87  E-value=8.6  Score=26.29  Aligned_cols=31  Identities=19%  Similarity=0.577  Sum_probs=24.5

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      .+||..||.-..++    .+..+|+|..|.....+
T Consensus        89 ~r~CARCGGrv~lr----sNKv~wvcnlc~k~q~i  119 (169)
T KOG3799|consen   89 TRFCARCGGRVSLR----SNKVMWVCNLCRKQQEI  119 (169)
T ss_pred             hhHHHhcCCeeeec----cCceEEeccCCcHHHHH
Confidence            36999999998888    33569999999976554


No 274
>PF11331 DUF3133:  Protein of unknown function (DUF3133);  InterPro: IPR021480  This eukaryotic family of proteins has no known function. 
Probab=48.77  E-value=15  Score=20.28  Aligned_cols=31  Identities=26%  Similarity=0.582  Sum_probs=22.3

Q ss_pred             CCcCCCCCcccccCCC---CCCceEEcCCCCCee
Q 033869            3 FCPTCGTMLQYELPHM---DRPSRFSCPACPYVC   33 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~---~~~~~~~C~~C~y~~   33 (110)
                      .|..|.++|..+.+..   .+...+.|-.|..+.
T Consensus         8 ~C~~C~~lLqlP~~~~~~~k~~~klrCGaCs~vl   41 (46)
T PF11331_consen    8 VCSSCFELLQLPAKFSLSKKNQQKLRCGACSEVL   41 (46)
T ss_pred             ECccHHHHHcCCCccCCCccceeEEeCCCCceeE
Confidence            5899999999884443   224578899888643


No 275
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=48.67  E-value=16  Score=24.56  Aligned_cols=30  Identities=23%  Similarity=0.524  Sum_probs=19.9

Q ss_pred             cccCCCCCCC-ceEEEEeccCCCCCCceEEE
Q 033869           68 EVTCPACKHG-KAVYHELQTRSADEPMSIFY   97 (110)
Q Consensus        68 ~~~CpkCg~~-~a~~~~~Q~RsaDE~~T~fY   97 (110)
                      ...||+||.. ++.+..+-.+-.=+..|+.|
T Consensus        43 r~~Cp~C~~~~~~E~vels~~G~V~t~Tv~~   73 (140)
T COG1545          43 RAYCPKCGSETELEWVELSGEGKVETYTVVY   73 (140)
T ss_pred             cccCCCCCCCCceEEEEeCCCeEEEEEEEEe
Confidence            4469999987 66777765555444555555


No 276
>PF04194 PDCD2_C:  Programmed cell death protein 2, C-terminal putative domain ;  InterPro: IPR007320  PDCD2 is localized predominantly in the cytosol of cells situated at the opposite pole of the germinal centre from the centroblasts as well as in cells in the mantle zone. It has been shown to interact with BCL6, an evolutionarily conserved Kruppel-type zinc finger protein that functions as a strong transcriptional repressor and is required for germinal centre development. The rat homologue, Rp8, is associated with programmed cell death in thymocytes.; GO: 0005737 cytoplasm
Probab=48.64  E-value=20  Score=24.71  Aligned_cols=35  Identities=20%  Similarity=0.491  Sum_probs=24.0

Q ss_pred             ccCCCCCCCceEEEEe------ccCCC-------CCCceEEEEecCCCC
Q 033869           69 VTCPACKHGKAVYHEL------QTRSA-------DEPMSIFYMCANKNC  104 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~------Q~Rsa-------DE~~T~fY~C~~~~C  104 (110)
                      -.|+.||..+..=||+      .++..       |=|.-+.|+|.+ .|
T Consensus        98 p~C~~Cg~~R~FEfQlmP~li~~L~~~~~~~~~~dwgtv~VyTCs~-sC  145 (164)
T PF04194_consen   98 PKCENCGSPRVFEFQLMPQLIYYLEVDDEGSDSMDWGTVLVYTCSA-SC  145 (164)
T ss_pred             CCCccCCCccEEEEEechHHHHHhhccccCCCCceeeEEEEEEehH-Hc
Confidence            3799999988865555      22222       445678999984 57


No 277
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=48.36  E-value=7  Score=20.78  Aligned_cols=12  Identities=25%  Similarity=0.642  Sum_probs=9.1

Q ss_pred             ccCCCCCCCceE
Q 033869           69 VTCPACKHGKAV   80 (110)
Q Consensus        69 ~~CpkCg~~~a~   80 (110)
                      ..||.||....+
T Consensus         3 ~~Cp~Cg~~~~~   14 (47)
T PF14690_consen    3 PRCPHCGSPSVH   14 (47)
T ss_pred             ccCCCcCCCceE
Confidence            479999987644


No 278
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=47.96  E-value=21  Score=18.49  Aligned_cols=8  Identities=38%  Similarity=1.310  Sum_probs=4.8

Q ss_pred             ccCCCCCC
Q 033869           69 VTCPACKH   76 (110)
Q Consensus        69 ~~CpkCg~   76 (110)
                      ..|+.||.
T Consensus        33 ~~C~~CGE   40 (46)
T TIGR03831        33 LVCPQCGE   40 (46)
T ss_pred             cccccCCC
Confidence            35666664


No 279
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=47.80  E-value=11  Score=30.27  Aligned_cols=29  Identities=28%  Similarity=0.592  Sum_probs=22.2

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      +-.||.||..        +.||  |.. -|.|.+  ||++.+
T Consensus       350 ~p~Cp~Cg~~--------m~S~--G~~-g~rC~k--Cg~~~~  378 (421)
T COG1571         350 NPVCPRCGGR--------MKSA--GRN-GFRCKK--CGTRAR  378 (421)
T ss_pred             CCCCCccCCc--------hhhc--CCC-Cccccc--ccccCC
Confidence            4589999974        4566  444 899999  999875


No 280
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=47.06  E-value=23  Score=22.60  Aligned_cols=6  Identities=67%  Similarity=1.663  Sum_probs=2.7

Q ss_pred             cCCCCC
Q 033869           70 TCPACK   75 (110)
Q Consensus        70 ~CpkCg   75 (110)
                      .||.||
T Consensus        33 ~C~~CG   38 (127)
T TIGR03830        33 YCPACG   38 (127)
T ss_pred             ECCCCC
Confidence            444444


No 281
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=47.05  E-value=9.3  Score=25.21  Aligned_cols=28  Identities=21%  Similarity=0.521  Sum_probs=15.0

Q ss_pred             CCcCCCCCcccccCCC-CCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHM-DRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~-~~~~~~~C~~C~y   31 (110)
                      +| .||..-.+..... .....+.|+.||-
T Consensus        72 ~C-~Cg~~~~~~~~~~~~~~~~~~CP~Cgs  100 (124)
T PRK00762         72 EC-ECGYEGVVDEDEIDHYAAVIECPVCGN  100 (124)
T ss_pred             Ee-eCcCcccccccchhccccCCcCcCCCC
Confidence            68 8986644431111 1112367999983


No 282
>KOG1311 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=47.01  E-value=8.3  Score=28.80  Aligned_cols=29  Identities=17%  Similarity=0.374  Sum_probs=21.9

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      +.||..|+..-+|+        ...|+.|+.-...-+
T Consensus       113 ~~~C~~C~~~rPpR--------s~HCsvC~~CV~rfD  141 (299)
T KOG1311|consen  113 WKYCDTCQLYRPPR--------SSHCSVCNNCVLRFD  141 (299)
T ss_pred             eEEcCcCcccCCCC--------cccchhhcccccccC
Confidence            46899999887776        678999998655433


No 283
>KOG2767 consensus Translation initiation factor 5 (eIF-5) [Translation, ribosomal structure and biogenesis]
Probab=46.88  E-value=8.4  Score=30.26  Aligned_cols=31  Identities=26%  Similarity=0.595  Sum_probs=25.9

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      +.||.|++++..++-..      -+|+-+.|..  ||++
T Consensus        97 VlC~~C~NPETel~itk------~q~i~~~CkA--CG~r  127 (400)
T KOG2767|consen   97 VLCPSCENPETELIITK------KQTISLKCKA--CGFR  127 (400)
T ss_pred             eeCcCCCCCceeEEecc------cchhhhHHHH--cCCc
Confidence            68999999998886642      4889999999  9986


No 284
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=45.88  E-value=13  Score=16.76  Aligned_cols=11  Identities=36%  Similarity=1.289  Sum_probs=6.9

Q ss_pred             EEcCCCCCeee
Q 033869           24 FSCPACPYVCN   34 (110)
Q Consensus        24 ~~C~~C~y~~~   34 (110)
                      |.|+.|+|...
T Consensus         1 y~C~~C~y~t~   11 (24)
T PF13909_consen    1 YKCPHCSYSTS   11 (24)
T ss_dssp             EE-SSSS-EES
T ss_pred             CCCCCCCCcCC
Confidence            67999998754


No 285
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=45.85  E-value=11  Score=26.48  Aligned_cols=19  Identities=32%  Similarity=0.964  Sum_probs=15.2

Q ss_pred             CCCCceEEEEecCCCCCcccc
Q 033869           89 ADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        89 aDE~~T~fY~C~~~~C~~~wr  109 (110)
                      ..|.-..||.|.+  |+.+|.
T Consensus       110 ~~e~~~~~Y~Cp~--C~~ryt  128 (178)
T PRK06266        110 EEEENNMFFFCPN--CHIRFT  128 (178)
T ss_pred             hhccCCCEEECCC--CCcEEe
Confidence            3455678999999  999885


No 286
>smart00109 C1 Protein kinase C conserved region 1 (C1) domains (Cysteine-rich domains). Some bind phorbol esters and diacylglycerol. Some bind RasGTP. Zinc-binding domains.
Probab=45.75  E-value=14  Score=19.31  Aligned_cols=26  Identities=19%  Similarity=0.505  Sum_probs=19.6

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      .||.-|+..|...  .    ..+.|+.|++..
T Consensus        12 ~~C~~C~~~i~~~--~----~~~~C~~C~~~~   37 (49)
T smart00109       12 TKCCVCRKSIWGS--F----QGLRCSWCKVKC   37 (49)
T ss_pred             CCccccccccCcC--C----CCcCCCCCCchH
Confidence            5899999988764  1    257899998754


No 287
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=44.94  E-value=12  Score=28.15  Aligned_cols=61  Identities=21%  Similarity=0.420  Sum_probs=31.9

Q ss_pred             ceEEcCCCCCeeeeCCc-eEEEEecccCccccccccccccccCCCCCcccCCCCCCCceEEEEec
Q 033869           22 SRFSCPACPYVCNMESR-VKIKRKQPLSKKEIQPIFTQDAMMEGPQTEVTCPACKHGKAVYHELQ   85 (110)
Q Consensus        22 ~~~~C~~C~y~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~CpkCg~~~a~~~~~Q   85 (110)
                      -+|+|..|.+.+-..-+ .+-|++-.--++..+.|.. +..  .......||+|+|.=--|-|+-
T Consensus       111 rqFaC~~Cd~~WwRrvp~rKeVSRCr~C~~rYDPVP~-dkm--wG~aef~C~~C~h~F~G~~qm~  172 (278)
T PF15135_consen  111 RQFACSSCDHMWWRRVPQRKEVSRCRKCRKRYDPVPC-DKM--WGIAEFHCPKCRHNFRGFAQMG  172 (278)
T ss_pred             eeeeccccchHHHhccCcccccccccccccccCCCcc-ccc--cceeeeecccccccchhhhhcC
Confidence            47999999987543221 0122222222233333332 111  3445778999998755554443


No 288
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=44.85  E-value=14  Score=28.04  Aligned_cols=18  Identities=28%  Similarity=0.482  Sum_probs=11.1

Q ss_pred             ccCCCCCCceEEEEecCCCCCccc
Q 033869           85 QTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        85 Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      ||-|.++    -|.|..  |+..|
T Consensus       236 QTHS~~K----~~qC~~--C~KsF  253 (279)
T KOG2462|consen  236 QTHSDVK----KHQCPR--CGKSF  253 (279)
T ss_pred             HhhcCCc----cccCcc--hhhHH
Confidence            5666555    367776  76655


No 289
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=44.84  E-value=16  Score=21.42  Aligned_cols=25  Identities=20%  Similarity=0.503  Sum_probs=17.9

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      =|.+|+.++...          .|++||.....++
T Consensus         5 AC~~C~~i~~~~----------~CP~Cgs~~~T~~   29 (61)
T PRK08351          5 ACRHCHYITTED----------RCPVCGSRDLSDE   29 (61)
T ss_pred             hhhhCCcccCCC----------cCCCCcCCccccc
Confidence            588999888322          4999998765444


No 290
>PF14952 zf-tcix:  Putative treble-clef, zinc-finger, Zn-binding
Probab=44.83  E-value=10  Score=20.72  Aligned_cols=27  Identities=37%  Similarity=0.826  Sum_probs=17.1

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      .+||+||---.      +|+        ..|.|..|++.++
T Consensus        12 rkCp~CGt~NG------~R~--------~~CKN~~C~~~~~   38 (44)
T PF14952_consen   12 RKCPKCGTYNG------TRG--------LSCKNKSCPQVFN   38 (44)
T ss_pred             ccCCcCcCccC------ccc--------ccccCCccchhhh
Confidence            58999995321      232        4677777776654


No 291
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=44.77  E-value=7.4  Score=21.85  Aligned_cols=29  Identities=21%  Similarity=0.385  Sum_probs=17.0

Q ss_pred             CCcCCCCCcccccCCC--CCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHM--DRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~--~~~~~~~C~~C~y   31 (110)
                      -|.-|+-.|.+..-..  .......|++||.
T Consensus        24 ~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgR   54 (56)
T PF02591_consen   24 TCSGCHMELPPQELNEIRKGDEIVFCPNCGR   54 (56)
T ss_pred             ccCCCCEEcCHHHHHHHHcCCCeEECcCCCc
Confidence            3666776666652221  2245788888874


No 292
>PRK12366 replication factor A; Reviewed
Probab=44.09  E-value=13  Score=31.13  Aligned_cols=24  Identities=25%  Similarity=0.724  Sum_probs=19.0

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      =||.|+.-|...      ...|.|+.|+..
T Consensus       534 aCp~CnkKv~~~------~g~~~C~~c~~~  557 (637)
T PRK12366        534 LCPNCRKRVEEV------DGEYICEFCGEV  557 (637)
T ss_pred             cccccCeEeEcC------CCcEECCCCCCC
Confidence            499999987532      358999999987


No 293
>PF08646 Rep_fac-A_C:  Replication factor-A C terminal domain;  InterPro: IPR013955 Replication factor A (RP-A) binds and subsequently stabilises single-stranded DNA intermediates and thus prevents complementary DNA from reannealing. It also plays an essential role in several cellular processes in DNA metabolism including replication, recombination and repair of DNA []. Replication factor-A protein is also known as Replication protein A 70 kDa DNA-binding subunit.  This entry is found at the C terminus of Replication factor A.; PDB: 1L1O_F 3U50_C.
Probab=43.55  E-value=18  Score=24.06  Aligned_cols=25  Identities=20%  Similarity=0.692  Sum_probs=16.9

Q ss_pred             Cc--CCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            4 CP--TCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp--~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      ||  .|+.-+...  .   ...|.|..|+...
T Consensus        21 C~~~~C~kKv~~~--~---~~~y~C~~C~~~~   47 (146)
T PF08646_consen   21 CPNEKCNKKVTEN--G---DGSYRCEKCNKTV   47 (146)
T ss_dssp             -TSTTTS-B-EEE--T---TTEEEETTTTEEE
T ss_pred             CCCccCCCEeecC--C---CcEEECCCCCCcC
Confidence            89  999977766  2   2479999999764


No 294
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=43.40  E-value=22  Score=23.15  Aligned_cols=16  Identities=19%  Similarity=0.692  Sum_probs=11.9

Q ss_pred             cccCCCCCCC-ceEEEE
Q 033869           68 EVTCPACKHG-KAVYHE   83 (110)
Q Consensus        68 ~~~CpkCg~~-~a~~~~   83 (110)
                      ...||+||.+ +++|.-
T Consensus        49 ~t~CP~Cg~~~e~~fvv   65 (115)
T COG1885          49 STSCPKCGEPFESAFVV   65 (115)
T ss_pred             cccCCCCCCccceeEEE
Confidence            3589999965 777754


No 295
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=42.99  E-value=18  Score=21.36  Aligned_cols=27  Identities=22%  Similarity=0.481  Sum_probs=19.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -|-.|..++...        .-.|+.||-.....+
T Consensus         6 AC~~Ck~l~~~d--------~e~CP~Cgs~~~te~   32 (64)
T COG2093           6 ACKNCKRLTPED--------TEICPVCGSTDLTEE   32 (64)
T ss_pred             HHhhccccCCCC--------CccCCCCCCcccchh
Confidence            477788777665        446999998766555


No 296
>smart00532 LIGANc Ligase N family.
Probab=42.65  E-value=18  Score=29.06  Aligned_cols=26  Identities=38%  Similarity=0.906  Sum_probs=18.1

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCC--CCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPA--CPY   31 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~--C~y   31 (110)
                      .+||.||+.|...+  +  ...+.|.+  |.-
T Consensus       400 ~~CP~C~s~l~~~~--~--~~~~~C~n~~C~a  427 (441)
T smart00532      400 THCPSCGSELVREE--G--EVDIRCPNPLCPA  427 (441)
T ss_pred             CCCCCCCCEeEecC--C--ceEEEeCCCCCHH
Confidence            58999999997652  2  34778874  653


No 297
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=42.14  E-value=20  Score=17.35  Aligned_cols=12  Identities=17%  Similarity=0.606  Sum_probs=5.6

Q ss_pred             ceEEcCCCCCee
Q 033869           22 SRFSCPACPYVC   33 (110)
Q Consensus        22 ~~~~C~~C~y~~   33 (110)
                      ..|.|..|+|.-
T Consensus        14 ~~Y~C~~Cdf~l   25 (30)
T PF07649_consen   14 WFYRCSECDFDL   25 (30)
T ss_dssp             -EEE-TTT----
T ss_pred             ceEECccCCCcc
Confidence            589999998853


No 298
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=42.05  E-value=24  Score=27.12  Aligned_cols=36  Identities=19%  Similarity=0.618  Sum_probs=25.1

Q ss_pred             cccCCCCCCCc-eEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           68 EVTCPACKHGK-AVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        68 ~~~CpkCg~~~-a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      ...||-||..- +..  +.. ..++|. +|..|.-  |++.|+
T Consensus       187 ~~~CPvCGs~P~~s~--v~~-~~~~G~-RyL~Csl--C~teW~  223 (309)
T PRK03564        187 RQFCPVCGSMPVSSV--VQI-GTTQGL-RYLHCNL--CESEWH  223 (309)
T ss_pred             CCCCCCCCCcchhhe--eec-cCCCCc-eEEEcCC--CCCccc
Confidence            57899999754 332  222 234555 8999999  999996


No 299
>PRK08402 replication factor A; Reviewed
Probab=41.75  E-value=18  Score=28.31  Aligned_cols=26  Identities=27%  Similarity=0.721  Sum_probs=19.2

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      =||.|+.-+...  .  ....|.|+.||-.
T Consensus       214 aCp~CnKkv~~~--~--~~~~~~Ce~~~~v  239 (355)
T PRK08402        214 ACPECRRKVDYD--P--ATDTWICPEHGEV  239 (355)
T ss_pred             cCCCCCeEEEEe--c--CCCCEeCCCCCCc
Confidence            499999988754  1  2348999999854


No 300
>PRK04023 DNA polymerase II large subunit; Validated
Probab=41.29  E-value=19  Score=32.06  Aligned_cols=14  Identities=21%  Similarity=0.168  Sum_probs=8.4

Q ss_pred             EEcCCCCCeeeeCC
Q 033869           24 FSCPACPYVCNMES   37 (110)
Q Consensus        24 ~~C~~C~y~~~~~~   37 (110)
                      +.|++||..-....
T Consensus       664 y~CPKCG~El~~~s  677 (1121)
T PRK04023        664 DECEKCGREPTPYS  677 (1121)
T ss_pred             CcCCCCCCCCCccc
Confidence            45777777655443


No 301
>PRK07218 replication factor A; Provisional
Probab=41.14  E-value=14  Score=29.61  Aligned_cols=25  Identities=28%  Similarity=0.628  Sum_probs=19.1

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      =||+|+..|.          .+.|+.||..++...
T Consensus       299 rCP~C~r~v~----------~~~C~~hG~ve~~~d  323 (423)
T PRK07218        299 RCPECGRVIQ----------KGQCRSHGAVEGEDD  323 (423)
T ss_pred             cCcCcccccc----------CCcCCCCCCcCCeee
Confidence            4999999882          268999998766544


No 302
>PRK07561 DNA topoisomerase I subunit omega; Validated
Probab=41.01  E-value=32  Score=29.95  Aligned_cols=23  Identities=26%  Similarity=0.551  Sum_probs=16.0

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCP   27 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~   27 (110)
                      =||.||.-|..+  .+..+..+.|.
T Consensus       589 ~CP~Cg~~l~~r--~gr~G~Fl~Cs  611 (859)
T PRK07561        589 DCPTCGRGMGIR--TGKTGVFLGCS  611 (859)
T ss_pred             cCcccCCcceEE--ecCCCCeeecc
Confidence            489998777766  44445678886


No 303
>TIGR01057 topA_arch DNA topoisomerase I, archaeal. This model describes topoisomerase I from archaea. These enzymes are involved in the control of DNA topology. DNA topoisomerase I belongs to the type I topoisomerases, which are ATP-independent.
Probab=40.91  E-value=21  Score=29.68  Aligned_cols=26  Identities=31%  Similarity=0.576  Sum_probs=15.4

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecC
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCAN  101 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~  101 (110)
                      ...||+||++ +.     .|...-+  .||-|.+
T Consensus       589 ~~~CPkCg~~-l~-----~~~~k~g--~f~gCs~  614 (618)
T TIGR01057       589 VGKCPKCGGK-LV-----SKYAKKG--RFVGCSN  614 (618)
T ss_pred             cCCCCcCCCe-ee-----eeecCCc--cEEECCC
Confidence            3579999974 11     1212212  5999976


No 304
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=40.74  E-value=12  Score=24.92  Aligned_cols=18  Identities=33%  Similarity=0.595  Sum_probs=14.6

Q ss_pred             CCCCcccCCCCCCC-ceEE
Q 033869           64 GPQTEVTCPACKHG-KAVY   81 (110)
Q Consensus        64 ~~~~~~~CpkCg~~-~a~~   81 (110)
                      ..++++.|.+||.+ ..+|
T Consensus        82 ~~R~Ev~C~~Cg~HLGHVF  100 (124)
T PF01641_consen   82 MVRTEVRCARCGSHLGHVF  100 (124)
T ss_dssp             SEEEEEEETTTCCEEEEEE
T ss_pred             ceEEEEEecCCCCccccEe
Confidence            56789999999955 6666


No 305
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=40.61  E-value=18  Score=18.14  Aligned_cols=11  Identities=27%  Similarity=0.658  Sum_probs=9.0

Q ss_pred             EEEEecCCCCCcc
Q 033869           95 IFYMCANKNCKHR  107 (110)
Q Consensus        95 ~fY~C~~~~C~~~  107 (110)
                      -||.|..  ||+.
T Consensus         3 ~~ykC~~--CGni   13 (34)
T cd00974           3 EVYKCEI--CGNI   13 (34)
T ss_pred             cEEEcCC--CCcE
Confidence            4899998  9874


No 306
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=40.45  E-value=16  Score=16.94  Aligned_cols=11  Identities=27%  Similarity=0.700  Sum_probs=4.8

Q ss_pred             CcCCCCCcccc
Q 033869            4 CPTCGTMLQYE   14 (110)
Q Consensus         4 Cp~C~nlL~~~   14 (110)
                      |+.|+.+=.+.
T Consensus         5 C~~C~~~N~~~   15 (26)
T smart00547        5 CPACTFLNFAS   15 (26)
T ss_pred             CCCCCCcChhh
Confidence            44454443333


No 307
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=40.21  E-value=20  Score=24.17  Aligned_cols=20  Identities=25%  Similarity=0.532  Sum_probs=14.6

Q ss_pred             cCCCCCCCceEEEEeccCCC
Q 033869           70 TCPACKHGKAVYHELQTRSA   89 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~Rsa   89 (110)
                      =||.||.+.-.|.....+..
T Consensus        21 GCP~CGg~kF~yv~~~~~~~   40 (131)
T PF09845_consen   21 GCPECGGNKFQYVPEEKDAE   40 (131)
T ss_pred             cCcccCCcceEEcCCCcccc
Confidence            49999999988866544433


No 308
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=40.11  E-value=19  Score=18.04  Aligned_cols=11  Identities=27%  Similarity=0.700  Sum_probs=9.1

Q ss_pred             EEEEecCCCCCcc
Q 033869           95 IFYMCANKNCKHR  107 (110)
Q Consensus        95 ~fY~C~~~~C~~~  107 (110)
                      .||.|..  ||+.
T Consensus         6 ~~ykC~~--Cgni   16 (34)
T TIGR00319         6 QVYKCEV--CGNI   16 (34)
T ss_pred             cEEEcCC--CCcE
Confidence            4999999  9874


No 309
>COG3880 Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]
Probab=39.07  E-value=22  Score=25.11  Aligned_cols=33  Identities=21%  Similarity=0.593  Sum_probs=26.1

Q ss_pred             cCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           70 TCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      .|.+|+.+.|.+.-.|+-+++  -+.+|+|.+  |-.
T Consensus         2 iCq~CqqnpAti~~tkI~~~~--k~e~~vCe~--Ca~   34 (176)
T COG3880           2 ICQNCQQNPATIHFTKIINGE--KIELYVCET--CAK   34 (176)
T ss_pred             cchhhcCCcceEEEEEeecCC--eeEeehhhc--CCC
Confidence            699999999998887775553  455999998  854


No 310
>cd02674 Peptidase_C19R A subfamily of peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=38.91  E-value=77  Score=21.97  Aligned_cols=17  Identities=24%  Similarity=0.466  Sum_probs=12.7

Q ss_pred             CceEEcCCCCCeeeeCC
Q 033869           21 PSRFSCPACPYVCNMES   37 (110)
Q Consensus        21 ~~~~~C~~C~y~~~~~~   37 (110)
                      .....|..|++.....+
T Consensus        49 ~~~~~C~~C~~~~~~~e   65 (230)
T cd02674          49 KSRLTCLTCGKTSTTFE   65 (230)
T ss_pred             eCcEEcCCCcCCcceec
Confidence            45789999998766544


No 311
>PF05180 zf-DNL:  DNL zinc finger;  InterPro: IPR007853 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNL-type zinc finger is found in Tim15, a zinc finger protein essential for protein import into mitochondria. Mitochondrial functions rely on the correct transport of resident proteins synthesized in the cytosol to mitochondria. Protein import into mitochondria is mediated by membrane protein complexes, protein translocators, in the outer and inner mitochondrial membranes, in cooperation with their assistant proteins in the cytosol, intermembrane space and matrix. Proteins destined to the mitochondrial matrix cross the outer membrane with the aid of the outer membrane translocator, the tOM40 complex, and then the inner membrane with the aid of the inner membrane translocator, the TIM23 complex, and mitochondrial motor and chaperone (MMC) proteins including mitochondrial heat- shock protein 70 (mtHsp70), and translocase in the inner mitochondrial membrane (Tim)15. Tim15 is also known as zinc finger motif (Zim)17 or mtHsp70 escort protein (Hep)1. Tim15 contains a zinc-finger motif (CXXC and CXXC) of ~100 residues, which has been named DNL after a short C-terminal motif of D(N/H)L [, , ]. The DNL-type zinc finger is an L-shaped molecule. The two CXXC motifs are located at the end of the L, and are sandwiched by two- stranded antiparallel beta-sheets. Two short alpha-helices constitute another leg of the L. The outer (convex) face of the L has a large acidic groove, which is lined with five acidic residues, whereas the inner (concave) face of the L has two positively charged residues, next to the CXXC motifs []. This entry represents the DNL-type zinc finger.; GO: 0008270 zinc ion binding; PDB: 2E2Z_A.
Probab=38.89  E-value=12  Score=22.27  Aligned_cols=33  Identities=27%  Similarity=0.488  Sum_probs=20.8

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      ..|..|++..+.-+..|   |-+-=+++-.|.+  |..
T Consensus         5 FTC~~C~~Rs~~~~sk~---aY~~GvViv~C~g--C~~   37 (66)
T PF05180_consen    5 FTCNKCGTRSAKMFSKQ---AYHKGVVIVQCPG--CKN   37 (66)
T ss_dssp             EEETTTTEEEEEEEEHH---HHHTSEEEEE-TT--S--
T ss_pred             EEcCCCCCccceeeCHH---HHhCCeEEEECCC--Ccc
Confidence            46888888777666654   4444458888877  864


No 312
>PRK14810 formamidopyrimidine-DNA glycosylase; Provisional
Probab=38.82  E-value=40  Score=25.09  Aligned_cols=30  Identities=27%  Similarity=0.443  Sum_probs=17.9

Q ss_pred             CCcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCC
Q 033869           66 QTEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCK  105 (110)
Q Consensus        66 ~~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~  105 (110)
                      +....||+||..=..-.+ .-|+       -|.|.+  |.
T Consensus       242 R~g~pCprCG~~I~~~~~-~gR~-------t~~CP~--CQ  271 (272)
T PRK14810        242 RTGEPCLNCKTPIRRVVV-AGRS-------SHYCPH--CQ  271 (272)
T ss_pred             CCCCcCCCCCCeeEEEEE-CCCc-------cEECcC--Cc
Confidence            346799999964322222 2233       377888  85


No 313
>PRK07220 DNA topoisomerase I; Validated
Probab=38.42  E-value=28  Score=29.72  Aligned_cols=31  Identities=23%  Similarity=0.562  Sum_probs=17.8

Q ss_pred             CCcCCCC-CcccccCCCCCCceEEcCCCCCeee
Q 033869            3 FCPTCGT-MLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         3 FCp~C~n-lL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      -||+||. ++... ..+.....+.|+.|.|...
T Consensus       637 ~Cp~Cg~~~~k~~-~~g~~~~~~~Cp~C~~~~~  668 (740)
T PRK07220        637 VCEAHGLNHIRII-NGGKRPWDLGCPQCNFIEW  668 (740)
T ss_pred             CCCCCCCceEEEE-ecCCccceeeCCCCCCccc
Confidence            4999986 33322 1111122679999998543


No 314
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed
Probab=38.31  E-value=39  Score=27.58  Aligned_cols=36  Identities=22%  Similarity=0.361  Sum_probs=22.5

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCccc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRW  108 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~w  108 (110)
                      ..-.||+||.-.-+-..   .--.+.-||.|.|.   |||..
T Consensus       174 ~~pic~~cg~~~~~~~~---~~d~~~~~v~y~~~---cG~~~  209 (510)
T PRK00750        174 FLPICPKCGKVLTTPVI---SYDAEAGTVTYDCE---CGHEG  209 (510)
T ss_pred             eeeeCCCCCccceEEEE---EEeCCCCEEEEEcC---CCCEE
Confidence            36689999985432221   11223458999985   99864


No 315
>smart00401 ZnF_GATA zinc finger binding to DNA consensus sequence [AT]GATA[AG].
Probab=37.73  E-value=21  Score=19.83  Aligned_cols=34  Identities=15%  Similarity=0.387  Sum_probs=21.8

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      ...|..|+-.+.-.|    |....|.  -..|-.  |+-.|+
T Consensus         3 ~~~C~~C~~~~T~~W----R~g~~g~--~~LCna--Cgl~~~   36 (52)
T smart00401        3 GRSCSNCGTTETPLW----RRGPSGN--KTLCNA--CGLYYK   36 (52)
T ss_pred             CCCcCCCCCCCCCcc----ccCCCCC--CcEeec--ccHHHH
Confidence            457999997766444    6766666  234555  776664


No 316
>PRK08579 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=37.30  E-value=17  Score=30.55  Aligned_cols=22  Identities=27%  Similarity=0.673  Sum_probs=16.5

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      .+|++||..+  .      +..+.|+.||.
T Consensus       569 ~~C~~CG~~~--~------g~~~~CP~CGs  590 (625)
T PRK08579        569 TVCNKCGRST--T------GLYTRCPRCGS  590 (625)
T ss_pred             ccCCCCCCcc--C------CCCCcCcCCCC
Confidence            4799999844  2      23689999996


No 317
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=36.86  E-value=16  Score=22.85  Aligned_cols=31  Identities=26%  Similarity=0.327  Sum_probs=18.7

Q ss_pred             CCcCCCCCcccccCCC---CCCceEEcCCCCCee
Q 033869            3 FCPTCGTMLQYELPHM---DRPSRFSCPACPYVC   33 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~---~~~~~~~C~~C~y~~   33 (110)
                      +|+.|+..|...+.=.   ---+.-.|+.|+...
T Consensus        35 ~C~~C~~~L~~~~lIPi~S~l~lrGrCr~C~~~I   68 (92)
T PF06750_consen   35 HCPHCGHPLSWWDLIPILSYLLLRGRCRYCGAPI   68 (92)
T ss_pred             cCcCCCCcCcccccchHHHHHHhCCCCcccCCCC
Confidence            7888888888761110   002345788888643


No 318
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=36.85  E-value=22  Score=15.61  Aligned_cols=11  Identities=27%  Similarity=0.929  Sum_probs=7.0

Q ss_pred             EEecCCCCCcccc
Q 033869           97 YMCANKNCKHRWN  109 (110)
Q Consensus        97 Y~C~~~~C~~~wr  109 (110)
                      |+|..  |+..++
T Consensus         1 y~C~~--C~~~f~   11 (23)
T PF00096_consen    1 YKCPI--CGKSFS   11 (23)
T ss_dssp             EEETT--TTEEES
T ss_pred             CCCCC--CCCccC
Confidence            66766  776554


No 319
>PRK01103 formamidopyrimidine/5-formyluracil/ 5-hydroxymethyluracil DNA glycosylase; Validated
Probab=36.76  E-value=55  Score=24.29  Aligned_cols=30  Identities=20%  Similarity=0.525  Sum_probs=18.7

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      ....||+||..=.. ..+--|++       |-|..  |..
T Consensus       244 ~g~pC~~Cg~~I~~-~~~~gR~t-------~~CP~--CQ~  273 (274)
T PRK01103        244 EGEPCRRCGTPIEK-IKQGGRST-------FFCPR--CQK  273 (274)
T ss_pred             CCCCCCCCCCeeEE-EEECCCCc-------EECcC--CCC
Confidence            45789999976433 33323433       77888  864


No 320
>PF06573 Churchill:  Churchill protein;  InterPro: IPR009508 This family consists of several eukaryotic Churchill proteins. This protein contains a novel zinc binding region that mediates FGF signalling during neural development. The slow induction by FGF of a transcription factor (Churchill) in the neural plate in turn induces expression of Sip1 (Smad interacting protein-1), which inhibits mesodermal genes and sensitizes cells to later neural inducing factors [].; GO: 0008270 zinc ion binding, 0007275 multicellular organismal development, 0045893 positive regulation of transcription, DNA-dependent; PDB: 2JOX_A.
Probab=36.68  E-value=33  Score=22.38  Aligned_cols=10  Identities=30%  Similarity=0.870  Sum_probs=6.5

Q ss_pred             cccCCCCCCC
Q 033869           68 EVTCPACKHG   77 (110)
Q Consensus        68 ~~~CpkCg~~   77 (110)
                      +..|++|+|-
T Consensus        58 ~HvC~nC~Hv   67 (112)
T PF06573_consen   58 DHVCKNCHHV   67 (112)
T ss_dssp             EEEETTT--E
T ss_pred             eeccCccceE
Confidence            7889999983


No 321
>PF10825 DUF2752:  Protein of unknown function (DUF2752);  InterPro: IPR021215  This family is conserved in bacteria. Many members are annotated as being putative membrane proteins. 
Probab=36.02  E-value=2.4  Score=23.85  Aligned_cols=19  Identities=32%  Similarity=0.677  Sum_probs=14.1

Q ss_pred             CcccCCCCCCCceEEEEec
Q 033869           67 TEVTCPACKHGKAVYHELQ   85 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q   85 (110)
                      +...||-||-.+|....+|
T Consensus         8 tG~~CPgCG~tRa~~~ll~   26 (52)
T PF10825_consen    8 TGIPCPGCGMTRAFIALLH   26 (52)
T ss_pred             hCCCCCCCcHHHHHHHHHC
Confidence            5678999998887655443


No 322
>PRK14811 formamidopyrimidine-DNA glycosylase; Provisional
Probab=35.72  E-value=51  Score=24.53  Aligned_cols=30  Identities=20%  Similarity=0.486  Sum_probs=19.1

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      ....||+||..=..... .-|++       |.|..  |..
T Consensus       234 ~g~pC~~Cg~~I~~~~~-~gR~t-------y~Cp~--CQ~  263 (269)
T PRK14811        234 EGQPCPRCGTPIEKIVV-GGRGT-------HFCPQ--CQP  263 (269)
T ss_pred             CcCCCCcCCCeeEEEEE-CCCCc-------EECCC--CcC
Confidence            35789999976443322 22443       77988  865


No 323
>PF14369 zf-RING_3:  zinc-finger
Probab=35.55  E-value=30  Score=17.73  Aligned_cols=27  Identities=22%  Similarity=0.608  Sum_probs=17.1

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      -||=.|+....+..+..   ....|+.|+-
T Consensus         3 ywCh~C~~~V~~~~~~~---~~~~CP~C~~   29 (35)
T PF14369_consen    3 YWCHQCNRFVRIAPSPD---SDVACPRCHG   29 (35)
T ss_pred             EeCccCCCEeEeCcCCC---CCcCCcCCCC
Confidence            37888888877752222   1236999974


No 324
>PHA02325 hypothetical protein
Probab=35.38  E-value=43  Score=19.91  Aligned_cols=23  Identities=17%  Similarity=0.434  Sum_probs=14.0

Q ss_pred             cccCCCCCC---CceEEEEeccCCCC
Q 033869           68 EVTCPACKH---GKAVYHELQTRSAD   90 (110)
Q Consensus        68 ~~~CpkCg~---~~a~~~~~Q~RsaD   90 (110)
                      .+.||+||.   +.-.||.---|-++
T Consensus         3 ~k~CPkC~A~WldgqhYWsgTgk~g~   28 (72)
T PHA02325          3 TKICPKCGARWLDGQHYWSGTGKKGN   28 (72)
T ss_pred             ccccCccCCEeEcceeeeccCCCcCC
Confidence            468999996   35556654334333


No 325
>COG1601 GCD7 Translation initiation factor 2, beta subunit (eIF-2beta)/eIF-5 N-terminal domain [Translation, ribosomal structure and biogenesis]
Probab=34.97  E-value=8.3  Score=26.59  Aligned_cols=33  Identities=21%  Similarity=0.441  Sum_probs=23.9

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      -|+.||++=..-.-. .+.+.++|..||-..++.
T Consensus       107 ~C~~c~s~dt~l~~~-~R~~~l~c~acGa~~pv~  139 (151)
T COG1601         107 KCKECGSPDTELIKE-ERLLFLKCEACGAIRPVK  139 (151)
T ss_pred             EeccCCCCchhhhhh-hhhHhhHHHHhCCcccch
Confidence            388999886654222 567788999999877765


No 326
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=34.85  E-value=16  Score=20.52  Aligned_cols=30  Identities=23%  Similarity=0.516  Sum_probs=11.0

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      |--|..-|....++.....+|.|+.|+...
T Consensus         2 CfgC~~~~~~~~~~~~~~~~y~C~~C~~~F   31 (51)
T PF07975_consen    2 CFGCQKPFPDGPEKKADSSRYRCPKCKNHF   31 (51)
T ss_dssp             ETTTTEE-TTS-------EEE--TTTT--B
T ss_pred             CccCCCCCCCcccccccCCeEECCCCCCcc
Confidence            334444444432233335789999998643


No 327
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=34.47  E-value=5.7  Score=20.58  Aligned_cols=28  Identities=18%  Similarity=0.208  Sum_probs=12.2

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      |++|-.-+.-+.++--+-....|..||=
T Consensus         2 C~~C~~Ey~~p~~RR~~~~~isC~~CGP   29 (35)
T PF07503_consen    2 CDDCLKEYFDPSNRRFHYQFISCTNCGP   29 (35)
T ss_dssp             -HHHHHHHCSTTSTTTT-TT--BTTCC-
T ss_pred             CHHHHHHHcCCCCCcccCcCccCCCCCC
Confidence            5555544433323333345678888883


No 328
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=34.44  E-value=26  Score=14.99  Aligned_cols=11  Identities=18%  Similarity=0.842  Sum_probs=5.2

Q ss_pred             EEecCCCCCcccc
Q 033869           97 YMCANKNCKHRWN  109 (110)
Q Consensus        97 Y~C~~~~C~~~wr  109 (110)
                      |.|..  |+..++
T Consensus         1 ~~C~~--C~~~~~   11 (24)
T PF13894_consen    1 FQCPI--CGKSFR   11 (24)
T ss_dssp             EE-SS--TS-EES
T ss_pred             CCCcC--CCCcCC
Confidence            56666  666554


No 329
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=34.19  E-value=38  Score=23.09  Aligned_cols=18  Identities=33%  Similarity=0.575  Sum_probs=14.5

Q ss_pred             CCCCcccCCCCCC-CceEE
Q 033869           64 GPQTEVTCPACKH-GKAVY   81 (110)
Q Consensus        64 ~~~~~~~CpkCg~-~~a~~   81 (110)
                      ..|+++.|.+|+. -..||
T Consensus        87 M~RtEVrc~~c~sHLGHVF  105 (140)
T COG0229          87 MVRTEVRCANCDSHLGHVF  105 (140)
T ss_pred             cEEEEEEecCCCCcccccc
Confidence            5578999999994 47777


No 330
>PF09463 Opy2:  Opy2 protein;  InterPro: IPR018571  Opy2p acts as a membrane anchor in the HOG signalling pathway []. This entry represents a conserved N-terminal domain.
Probab=34.15  E-value=42  Score=17.39  Aligned_cols=17  Identities=35%  Similarity=0.788  Sum_probs=13.4

Q ss_pred             cCCCCCCCceEEEEecc
Q 033869           70 TCPACKHGKAVYHELQT   86 (110)
Q Consensus        70 ~CpkCg~~~a~~~~~Q~   86 (110)
                      .||.|+.++.-.++.|+
T Consensus        10 ~CP~C~~ge~C~~t~~t   26 (35)
T PF09463_consen   10 SCPSCPSGEECVLTSQT   26 (35)
T ss_pred             CCCCCCCCCEEEecCCC
Confidence            79999998877766553


No 331
>PF14169 YdjO:  Cold-inducible protein YdjO
Probab=33.55  E-value=36  Score=19.78  Aligned_cols=26  Identities=12%  Similarity=0.448  Sum_probs=16.7

Q ss_pred             EEEEeccCCCCCCceEEEEecCCCCC
Q 033869           80 VYHELQTRSADEPMSIFYMCANKNCK  105 (110)
Q Consensus        80 ~~~~~Q~RsaDE~~T~fY~C~~~~C~  105 (110)
                      +|.-.+.-...+-.|..+.|++-+|.
T Consensus         2 y~~kk~~e~~p~e~t~VW~Ct~e~C~   27 (59)
T PF14169_consen    2 YFRKKNQEEIPEEETKVWECTSEDCN   27 (59)
T ss_pred             CccccCCCCCCceeeeeEEeCCCCCC
Confidence            34344444555557888999887784


No 332
>KOG2767 consensus Translation initiation factor 5 (eIF-5) [Translation, ribosomal structure and biogenesis]
Probab=33.46  E-value=13  Score=29.20  Aligned_cols=32  Identities=25%  Similarity=0.719  Sum_probs=24.5

Q ss_pred             CCcCCCCC---cccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTM---LQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nl---L~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -||.|+|-   |.+.  + .+.+.+.|..|||...++.
T Consensus        98 lC~~C~NPETel~it--k-~q~i~~~CkACG~r~~~d~  132 (400)
T KOG2767|consen   98 LCPSCENPETELIIT--K-KQTISLKCKACGFRSDMDL  132 (400)
T ss_pred             eCcCCCCCceeEEec--c-cchhhhHHHHcCCcccccc
Confidence            49999985   4443  3 5578899999999887765


No 333
>PRK06260 threonine synthase; Validated
Probab=33.24  E-value=25  Score=27.46  Aligned_cols=23  Identities=26%  Similarity=0.712  Sum_probs=17.7

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      .|+.||..+.+.      ...+.|+.||-
T Consensus         5 ~C~~cg~~~~~~------~~~~~Cp~cg~   27 (397)
T PRK06260          5 KCIECGKEYDPD------EIIYTCPECGG   27 (397)
T ss_pred             EECCCCCCCCCC------CccccCCCCCC
Confidence            599999887655      34688999984


No 334
>KOG4537 consensus Zn-ribbon-containing protein implicated in mitosis [Cell cycle control, cell division, chromosome partitioning; Defense mechanisms]
Probab=33.22  E-value=11  Score=26.37  Aligned_cols=26  Identities=23%  Similarity=0.641  Sum_probs=19.9

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      .||.|+.+|.-.  +   .+-..|-.|....
T Consensus        42 ~Cp~C~~Ilm~d--r---~~~~~CVsC~~~~   67 (178)
T KOG4537|consen   42 ICPKCEKILMRD--R---DNPMFCVSCINDL   67 (178)
T ss_pred             hcchHHHHHHhh--c---cCceEEEeeeccc
Confidence            699999997765  3   4578888887654


No 335
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=33.11  E-value=26  Score=18.30  Aligned_cols=12  Identities=33%  Similarity=0.916  Sum_probs=7.1

Q ss_pred             eEEEEecCCCCCcc
Q 033869           94 SIFYMCANKNCKHR  107 (110)
Q Consensus        94 T~fY~C~~~~C~~~  107 (110)
                      .-||.|..  ||+.
T Consensus         4 ~~~YkC~~--CGni   15 (36)
T PF06397_consen    4 GEFYKCEH--CGNI   15 (36)
T ss_dssp             TEEEE-TT--T--E
T ss_pred             ccEEEccC--CCCE
Confidence            46899998  9874


No 336
>TIGR00375 conserved hypothetical protein TIGR00375. The member of this family from Methanococcus jannaschii, MJ0043, is considerably longer and appears to contain an intein N-terminal to the region of homology.
Probab=32.88  E-value=15  Score=28.93  Aligned_cols=27  Identities=26%  Similarity=0.508  Sum_probs=20.8

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      -+|..|+..|.+.+..   ...+.|+ ||..
T Consensus       241 ~~c~~C~~~~~~~~~~---~~~~~Cp-CG~~  267 (374)
T TIGR00375       241 TACEACGEPAVSEDAE---TACANCP-CGGR  267 (374)
T ss_pred             hhhcccCCcCCchhhh---hcCCCCC-CCCc
Confidence            4799999999987322   3468999 9986


No 337
>PRK04351 hypothetical protein; Provisional
Probab=32.59  E-value=33  Score=23.43  Aligned_cols=13  Identities=15%  Similarity=0.485  Sum_probs=8.5

Q ss_pred             CceEEcCCCCCee
Q 033869           21 PSRFSCPACPYVC   33 (110)
Q Consensus        21 ~~~~~C~~C~y~~   33 (110)
                      .-.|.|..||...
T Consensus       110 ~y~Y~C~~Cg~~~  122 (149)
T PRK04351        110 NYLYECQSCGQQY  122 (149)
T ss_pred             eEEEECCCCCCEe
Confidence            3567787787643


No 338
>PRK13945 formamidopyrimidine-DNA glycosylase; Provisional
Probab=32.49  E-value=64  Score=24.12  Aligned_cols=29  Identities=28%  Similarity=0.468  Sum_probs=17.8

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCC
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCK  105 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~  105 (110)
                      ....||+||..=..-.. --|+       -|.|.+  |.
T Consensus       253 ~g~pC~~Cg~~I~~~~~-~gR~-------t~~CP~--CQ  281 (282)
T PRK13945        253 TGKPCRKCGTPIERIKL-AGRS-------THWCPN--CQ  281 (282)
T ss_pred             CcCCCCcCCCeeEEEEE-CCCc-------cEECCC--Cc
Confidence            36799999975433222 2233       377887  85


No 339
>PF01020 Ribosomal_L40e:  Ribosomal L40e family;  InterPro: IPR001975 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the L40 ribosomal protein from both archaea and eukaryotes. Bovine ribosomal protein L40 has been identified as a secondary RNA binding protein []. L40 is fused to a ubiquitin protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 3IZS_p 3IZR_p 2AYJ_A 4A1B_K 4A19_K 4A18_K 4A1D_K.
Probab=32.27  E-value=10  Score=21.52  Aligned_cols=24  Identities=25%  Similarity=0.503  Sum_probs=12.5

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCC--CCCeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPA--CPYVCN   34 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~--C~y~~~   34 (110)
                      -|-.|+.-|.|+        ...||.  ||+...
T Consensus        19 ICrkCyarl~~~--------A~nCRKkkCGhsn~   44 (52)
T PF01020_consen   19 ICRKCYARLPPR--------ATNCRKKKCGHSNN   44 (52)
T ss_dssp             EETTT--EE-TT--------SSS-TSSSCTS-S-
T ss_pred             ecccccCcCCCC--------ccceecccCCCCcc
Confidence            467788888877        445887  887644


No 340
>PRK08329 threonine synthase; Validated
Probab=32.26  E-value=36  Score=26.06  Aligned_cols=24  Identities=25%  Similarity=0.629  Sum_probs=17.4

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      |..|+.||....+.      . .+.| .|+-.
T Consensus         1 ~l~C~~Cg~~~~~~------~-~~~C-~c~~~   24 (347)
T PRK08329          1 MLRCTKCGRTYEEK------F-KLRC-DCGGT   24 (347)
T ss_pred             CcCcCCCCCCcCCC------C-ceec-CCCCc
Confidence            78899999887532      2 3889 69743


No 341
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=32.07  E-value=23  Score=26.41  Aligned_cols=15  Identities=27%  Similarity=0.658  Sum_probs=12.5

Q ss_pred             eEEcCCCCCeeeeCC
Q 033869           23 RFSCPACPYVCNMES   37 (110)
Q Consensus        23 ~~~C~~C~y~~~~~~   37 (110)
                      .+.|+.|+.+.....
T Consensus        19 ~ieCPvC~tkFkkee   33 (267)
T COG1655          19 TIECPVCNTKFKKEE   33 (267)
T ss_pred             eeccCcccchhhhhh
Confidence            789999999877665


No 342
>PRK10445 endonuclease VIII; Provisional
Probab=31.88  E-value=77  Score=23.45  Aligned_cols=29  Identities=28%  Similarity=0.667  Sum_probs=17.4

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCC
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCK  105 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~  105 (110)
                      ....||+||..=. ...+--|+       -|.|.+  |.
T Consensus       234 ~g~~Cp~Cg~~I~-~~~~~gR~-------t~~CP~--CQ  262 (263)
T PRK10445        234 DGEACERCGGIIE-KTTLSSRP-------FYWCPG--CQ  262 (263)
T ss_pred             CCCCCCCCCCEeE-EEEECCCC-------cEECCC--Cc
Confidence            4679999996532 22222233       277887  85


No 343
>PF06200 tify:  tify domain;  InterPro: IPR010399 The tify domain is a 36-amino acid domain only found among Embryophyta (land plants). It has been named after the most conserved amino acid pattern (TIF[F/Y]XG) it contains, but was previously known as the Zim domain. As the use of uppercase characters (TIFY) might imply that the domain is fully conserved across proteins, a lowercase lettering has been chosen in an attempt to highlight the reality of its natural variability.  Based on the domain architecture, tify domain containing proteins can be classified into two groups. Group I is formed by proteins possessing a CCT (CONSTANS, CO-like, and TOC1) domain and a GATA-type zinc finger in addition to the tify domain. Group II contains proteins characterised by the tify domain but lacking a GATA-type zinc finger. Tify domain containing proteins might be involved in developmental processes and some of them have features that are characteristic for transcription factors: a nuclear localisation and the presence of a putative DNA-binding domain []. Some proteins known to contain a tify domain include:   Arabidopsis thaliana Zinc-finger protein expressed in Inflorescence Meristem (ZIM), a putative transcription factor involved in inflorescence and flower development [, ].  A. thaliana ZIM-like proteins (ZML) [].  A. thaliana PEAPOD1 and PEAPOD2 (PPD1 and PPD2) [].   
Probab=31.67  E-value=35  Score=17.77  Aligned_cols=7  Identities=43%  Similarity=1.089  Sum_probs=5.8

Q ss_pred             CCceEEE
Q 033869           91 EPMSIFY   97 (110)
Q Consensus        91 E~~T~fY   97 (110)
                      ..+|+||
T Consensus         6 ~qLTIfY   12 (36)
T PF06200_consen    6 AQLTIFY   12 (36)
T ss_pred             CcEEEEE
Confidence            4699999


No 344
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=31.42  E-value=25  Score=16.51  Aligned_cols=8  Identities=50%  Similarity=1.364  Sum_probs=6.0

Q ss_pred             ccCCCCCC
Q 033869           69 VTCPACKH   76 (110)
Q Consensus        69 ~~CpkCg~   76 (110)
                      +.||.||.
T Consensus         3 ~~C~~CgR   10 (25)
T PF13913_consen    3 VPCPICGR   10 (25)
T ss_pred             CcCCCCCC
Confidence            46888885


No 345
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=30.97  E-value=27  Score=23.46  Aligned_cols=26  Identities=19%  Similarity=0.543  Sum_probs=17.9

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      ++|+.|+....++        ...|+.|+.-...
T Consensus        49 ~~C~~C~~~kp~R--------s~HC~~C~~CV~~   74 (174)
T PF01529_consen   49 KYCSTCKIIKPPR--------SHHCRVCNRCVLR   74 (174)
T ss_pred             EECcccCCcCCCc--------ceecccccccccc
Confidence            4788888776666        6678888765443


No 346
>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis]
Probab=30.83  E-value=78  Score=26.19  Aligned_cols=33  Identities=21%  Similarity=0.383  Sum_probs=22.2

Q ss_pred             CcccCCCCCC-CceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           67 TEVTCPACKH-GKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        67 ~~~~CpkCg~-~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      ..-.||+||. ....-.     +-|..-|+-|.|.   |||.
T Consensus       170 ~~piC~kcGri~~t~v~-----~~d~~~~v~Y~Ce---~Gh~  203 (521)
T COG1384         170 FMPICEKCGRILTTPVI-----EWDGEGTVEYRCE---CGHE  203 (521)
T ss_pred             ccccccccCCcceeEEE-----EecCCceEEEEec---CCcc
Confidence            4568999998 433222     2233479999998   8873


No 347
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=30.77  E-value=59  Score=17.29  Aligned_cols=21  Identities=24%  Similarity=0.558  Sum_probs=14.9

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      .|..|+..+..        .+|.|..|..
T Consensus         2 ~C~~C~~~i~g--------~r~~C~~C~d   22 (46)
T cd02249           2 SCDGCLKPIVG--------VRYHCLVCED   22 (46)
T ss_pred             CCcCCCCCCcC--------CEEECCCCCC
Confidence            57888883322        4999999983


No 348
>PRK08173 DNA topoisomerase III; Validated
Probab=30.77  E-value=36  Score=29.71  Aligned_cols=25  Identities=36%  Similarity=1.014  Sum_probs=17.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      -||.||.-|. .     ....|.|.+|++..
T Consensus       626 ~CP~Cg~~~~-~-----~~~~~~Cs~C~f~~  650 (862)
T PRK08173        626 PCPNCGGVVK-E-----NYRRFACTKCDFSI  650 (862)
T ss_pred             cCCccccccc-c-----cCceeEcCCCCccc
Confidence            4999998652 1     12369999999764


No 349
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=30.68  E-value=21  Score=25.24  Aligned_cols=12  Identities=42%  Similarity=0.897  Sum_probs=10.0

Q ss_pred             CCcCCCCCcccc
Q 033869            3 FCPTCGTMLQYE   14 (110)
Q Consensus         3 FCp~C~nlL~~~   14 (110)
                      =||.||++|...
T Consensus       134 ~Cp~Cg~~L~~~  145 (176)
T COG1675         134 TCPKCGEDLEEY  145 (176)
T ss_pred             CCCCCCchhhhc
Confidence            399999998876


No 350
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=30.60  E-value=54  Score=18.68  Aligned_cols=26  Identities=27%  Similarity=0.562  Sum_probs=12.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCN   34 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~   34 (110)
                      .|..|+.-..+-      .-...|+.||...=
T Consensus        11 ~C~~C~~~F~~~------~rrhhCr~CG~~vC   36 (69)
T PF01363_consen   11 NCMICGKKFSLF------RRRHHCRNCGRVVC   36 (69)
T ss_dssp             B-TTT--B-BSS------S-EEE-TTT--EEE
T ss_pred             cCcCcCCcCCCc------eeeEccCCCCCEEC
Confidence            578888776554      23789999997643


No 351
>KOG2703 consensus C4-type Zn-finger protein [General function prediction only]
Probab=30.46  E-value=42  Score=26.97  Aligned_cols=10  Identities=40%  Similarity=1.132  Sum_probs=5.0

Q ss_pred             cCCCCCCCce
Q 033869           70 TCPACKHGKA   79 (110)
Q Consensus        70 ~CpkCg~~~a   79 (110)
                      .||+|||.-.
T Consensus        70 ~CpHCG~kN~   79 (460)
T KOG2703|consen   70 ECPHCGHKNN   79 (460)
T ss_pred             ecCccCCccc
Confidence            4555555443


No 352
>KOG3092 consensus Casein kinase II, beta subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription]
Probab=30.22  E-value=22  Score=25.80  Aligned_cols=12  Identities=25%  Similarity=0.949  Sum_probs=5.6

Q ss_pred             CCcCCCCCcccc
Q 033869            3 FCPTCGTMLQYE   14 (110)
Q Consensus         3 FCp~C~nlL~~~   14 (110)
                      +||.|.++..|+
T Consensus       136 YCP~C~dvY~P~  147 (216)
T KOG3092|consen  136 YCPSCEDVYIPK  147 (216)
T ss_pred             eCCCcccccccc
Confidence            444444444444


No 353
>TIGR00354 polC DNA polymerase, archaeal type II, large subunit. This model represents the large subunit, DP2, of a two subunit novel Archaeal replicative DNA polymerase first characterized for Pyrococcus furiosus. Structure of DP2 appears to be organized as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit.
Probab=30.16  E-value=26  Score=31.12  Aligned_cols=22  Identities=27%  Similarity=0.711  Sum_probs=17.3

Q ss_pred             cccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcc
Q 033869           68 EVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHR  107 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~  107 (110)
                      ..+||+||+                .|.+..|.+  ||-.
T Consensus       625 ~RKCPkCG~----------------yTlk~rCP~--CG~~  646 (1095)
T TIGR00354       625 IRKCPQCGK----------------ESFWLKCPV--CGEL  646 (1095)
T ss_pred             EEECCCCCc----------------ccccccCCC--CCCc
Confidence            458999987                677888988  8754


No 354
>TIGR00577 fpg formamidopyrimidine-DNA glycosylase (fpg). All proteins in the FPG family with known functions are FAPY-DNA glycosylases that function in base excision repair. Homologous to endonuclease VIII (nei). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=29.76  E-value=82  Score=23.41  Aligned_cols=28  Identities=18%  Similarity=0.477  Sum_probs=17.1

Q ss_pred             CcccCCCCCCCceEEEEeccCCCCCCceEEEEecCCCC
Q 033869           67 TEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNC  104 (110)
Q Consensus        67 ~~~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C  104 (110)
                      ....||+||..=.. ..+--|++       |-|.+  |
T Consensus       244 ~g~pC~~Cg~~I~~-~~~~gR~t-------~~CP~--C  271 (272)
T TIGR00577       244 KGEPCRRCGTPIEK-IKVGGRGT-------HFCPQ--C  271 (272)
T ss_pred             CCCCCCCCCCeeEE-EEECCCCC-------EECCC--C
Confidence            35799999976433 33333433       66877  7


No 355
>PF00320 GATA:  GATA zinc finger;  InterPro: IPR000679 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents GATA-type zinc fingers (Znf). A number of transcription factors (including erythroid-specific transcription factor and nitrogen regulatory proteins), specifically bind the DNA sequence (A/T)GATA(A/G) [] in the regulatory regions of genes. They are consequently termed GATA-binding transcription factors. The interactions occur via highly-conserved Znf domains in which the zinc ion is coordinated by 4 cysteine residues [, ]. NMR studies have shown the core of the Znf to comprise 2 irregular anti-parallel beta-sheets and an alpha-helix, followed by a long loop to the C-terminal end of the finger. The N-terminal part, which includes the helix, is similar in structure, but not sequence, to the N-terminal zinc module of the glucocorticoid receptor DNA-binding domain. The helix and the loop connecting the 2 beta-sheets interact with the major groove of the DNA, while the C-terminal tail wraps around into the minor groove. It is this tail that is the essential determinant of specific binding. Interactions between the Znf and DNA are mainly hydrophobic, explaining the preponderance of thymines in the binding site; a large number of interactions with the phosphate backbone have also been observed []. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contains a single copy of the domain. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0008270 zinc ion binding, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 3GAT_A 2GAT_A 1GAU_A 1GAT_A 1Y0J_A 1GNF_A 2L6Z_A 2L6Y_A 3DFV_D 3DFX_B ....
Probab=29.40  E-value=8.4  Score=19.79  Aligned_cols=31  Identities=19%  Similarity=0.487  Sum_probs=15.0

Q ss_pred             CCCCCCCceEEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           71 CPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        71 CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      |-.|+-.+.    .+-|++..|..+  .|-.  |+-.|+
T Consensus         1 C~~C~tt~t----~~WR~~~~g~~~--LCn~--Cg~~~k   31 (36)
T PF00320_consen    1 CSNCGTTET----PQWRRGPNGNRT--LCNA--CGLYYK   31 (36)
T ss_dssp             -TTT--ST-----SSEEEETTSEE---EEHH--HHHHHH
T ss_pred             CcCCcCCCC----chhhcCCCCCCH--HHHH--HHHHHH
Confidence            556766553    333555544443  7777  776664


No 356
>COG5349 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.30  E-value=23  Score=23.69  Aligned_cols=12  Identities=33%  Similarity=0.952  Sum_probs=10.0

Q ss_pred             cccCCCCCCCce
Q 033869           68 EVTCPACKHGKA   79 (110)
Q Consensus        68 ~~~CpkCg~~~a   79 (110)
                      .-.||+||..+.
T Consensus        21 ~grCP~CGeGrL   32 (126)
T COG5349          21 RGRCPRCGEGRL   32 (126)
T ss_pred             cCCCCCCCCchh
Confidence            569999998765


No 357
>PRK08271 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=28.59  E-value=30  Score=29.13  Aligned_cols=22  Identities=23%  Similarity=0.658  Sum_probs=16.3

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      ..|++||.+.  .      +..+.|+.||.
T Consensus       567 ~iC~~CG~~~--~------g~~~~CP~CGs  588 (623)
T PRK08271        567 TICNDCHHID--K------RTGKRCPICGS  588 (623)
T ss_pred             ccCCCCCCcC--C------CCCcCCcCCCC
Confidence            3699999762  1      24689999996


No 358
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=28.45  E-value=29  Score=20.53  Aligned_cols=21  Identities=19%  Similarity=0.461  Sum_probs=14.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      -|.+|+.+....          .|+.||...
T Consensus         7 AC~~C~~i~~~~----------~Cp~Cgs~~   27 (64)
T PRK06393          7 ACKKCKRLTPEK----------TCPVHGDEK   27 (64)
T ss_pred             hHhhCCcccCCC----------cCCCCCCCc
Confidence            477888777211          789998763


No 359
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only]
Probab=28.38  E-value=23  Score=28.75  Aligned_cols=33  Identities=18%  Similarity=0.196  Sum_probs=23.2

Q ss_pred             CCCCcCCCCCccc-----c---cCCCCCCceEEcCCCCCee
Q 033869            1 MEFCPTCGTMLQY-----E---LPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         1 M~FCp~C~nlL~~-----~---~~~~~~~~~~~C~~C~y~~   33 (110)
                      |.||..|+++..-     .   +-.++....|.|..|.+.-
T Consensus       185 mlqC~~C~~~fHq~Chqp~i~~~l~~D~~~~w~C~~C~~~~  225 (464)
T KOG4323|consen  185 MLQCDKCRQWYHQACHQPLIKDELAGDPFYEWFCDVCNRGP  225 (464)
T ss_pred             eeeecccccHHHHHhccCCCCHhhccCccceEeehhhccch
Confidence            7899999998431     1   1113567789999999853


No 360
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=27.99  E-value=46  Score=18.70  Aligned_cols=29  Identities=21%  Similarity=0.453  Sum_probs=16.4

Q ss_pred             CCcCCCCCcccccCCCCC--CceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDR--PSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~--~~~~~C~~C~y   31 (110)
                      -||.||-.+....|...+  .-.--|..|-.
T Consensus         2 ~CPyCge~~~~~iD~s~~~Q~yiEDC~vCC~   32 (52)
T PF14255_consen    2 QCPYCGEPIEILIDPSAGDQEYIEDCQVCCR   32 (52)
T ss_pred             CCCCCCCeeEEEEecCCCCeeEEeehhhcCC
Confidence            478888766665555433  22334666654


No 361
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=27.89  E-value=26  Score=23.03  Aligned_cols=12  Identities=33%  Similarity=0.941  Sum_probs=9.7

Q ss_pred             CcccCCCCCCCc
Q 033869           67 TEVTCPACKHGK   78 (110)
Q Consensus        67 ~~~~CpkCg~~~   78 (110)
                      +..+||.||+..
T Consensus        68 v~V~CP~C~K~T   79 (114)
T PF11023_consen   68 VQVECPNCGKQT   79 (114)
T ss_pred             eeeECCCCCChH
Confidence            478999999854


No 362
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=27.89  E-value=75  Score=15.35  Aligned_cols=23  Identities=17%  Similarity=0.551  Sum_probs=14.5

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      |.-|+..+...      . .|.|..|++.-
T Consensus         3 C~~C~~~~~~~------~-~Y~C~~c~f~l   25 (30)
T PF03107_consen    3 CDVCRRKIDGF------Y-FYHCSECCFTL   25 (30)
T ss_pred             CCCCCCCcCCC------E-eEEeCCCCCeE
Confidence            55565554443      2 89999888653


No 363
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=27.75  E-value=40  Score=19.21  Aligned_cols=16  Identities=25%  Similarity=0.513  Sum_probs=11.4

Q ss_pred             CceEEcCCCCCeeeeC
Q 033869           21 PSRFSCPACPYVCNME   36 (110)
Q Consensus        21 ~~~~~C~~C~y~~~~~   36 (110)
                      ...|.|-.||+.-=..
T Consensus         9 ~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    9 SNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             SSEEEETTTS-EEETT
T ss_pred             CceEEeCCCCcccccC
Confidence            3489999999976543


No 364
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PRK06599 DNA topoisomerase I; Validated
Probab=27.54  E-value=60  Score=27.42  Aligned_cols=7  Identities=43%  Similarity=1.175  Sum_probs=3.9

Q ss_pred             EcCCCCC
Q 033869           25 SCPACPY   31 (110)
Q Consensus        25 ~C~~C~y   31 (110)
                      .|+.|+.
T Consensus       639 ~Cp~C~~  645 (675)
T PRK06599        639 KCPKCGG  645 (675)
T ss_pred             CCCCCCC
Confidence            4666654


No 366
>PF05495 zf-CHY:  CHY zinc finger;  InterPro: IPR008913 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Pirh2 is an eukaryotic ubiquitin protein ligase, which has been shown to promote p53 degradation in mammals. Pirh2 physically interacts with p53 and promotes ubiquitination of p53 independently of MDM2. Like MDM2, Pirh2 is thought to participate in an autoregulatory feedback loop that controls p53 function. Pirh2 proteins contain three distinct zinc fingers, the CHY-type, the CTCHY-type which is C-terminal to the CHY-type zinc finger and a RING finger. The CHY-type zinc finger has no currently known function []. As well as Pirh2, the CHY-type zinc finger is also found in the following proteins:   Yeast helper of Tim protein 13. Hot13 may have a role in the assembly and recycling of the small Tims, a complex of the mitochondrial intermembrane space that participates in the TIM22 import pathway for assembly of the inner membrane [] Several plant hypothetical proteins that also contain haemerythrin cation binding domains Several protozoan hypothetical proteins that also contain a Myb domain   The solution structure of this zinc finger has been solved and binds 3 zinc atoms as shown in the following schematic representation:   ++---------+-----+ || | | CXHYxxxxxxxxxCCxxxxxCxxCHxxxxxHxxxxxxxxxxxCxxCxxxxxxxxxCxxC | | | | | | | | +-+-----------------+--+ +--+---------+--+ 'C': conserved cysteine involved in the binding of one zinc atom. 'H': conserved histidine involved in the binding of one zinc atom.  More information about these proteins can be found at Protein of the Month: Zinc Fingers []; GO: 0008270 zinc ion binding; PDB: 2DKT_A 2K2C_A.
Probab=27.50  E-value=33  Score=20.28  Aligned_cols=14  Identities=21%  Similarity=0.506  Sum_probs=6.0

Q ss_pred             eEEcCCCCCeeeeC
Q 033869           23 RFSCPACPYVCNME   36 (110)
Q Consensus        23 ~~~C~~C~y~~~~~   36 (110)
                      .+.|..|+.+..++
T Consensus        41 ~v~Cg~C~~~~~~~   54 (71)
T PF05495_consen   41 RVICGKCRTEQPID   54 (71)
T ss_dssp             EEEETTT--EEES-
T ss_pred             CeECCCCCCccChh
Confidence            55555555555443


No 367
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.42  E-value=36  Score=20.17  Aligned_cols=14  Identities=29%  Similarity=0.757  Sum_probs=10.7

Q ss_pred             CCcccCCCCCCCce
Q 033869           66 QTEVTCPACKHGKA   79 (110)
Q Consensus        66 ~~~~~CpkCg~~~a   79 (110)
                      ++.+.||-||..-.
T Consensus         5 ~~~v~CP~Cgkpv~   18 (65)
T COG3024           5 RITVPCPTCGKPVV   18 (65)
T ss_pred             cccccCCCCCCccc
Confidence            35789999998644


No 368
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=27.39  E-value=89  Score=19.63  Aligned_cols=8  Identities=25%  Similarity=1.032  Sum_probs=5.3

Q ss_pred             ccCCCCCC
Q 033869           69 VTCPACKH   76 (110)
Q Consensus        69 ~~CpkCg~   76 (110)
                      ..|+.||-
T Consensus        36 ~~C~~CGe   43 (89)
T TIGR03829        36 ISCSHCGM   43 (89)
T ss_pred             ccccCCCc
Confidence            36777764


No 369
>smart00249 PHD PHD zinc finger. The plant homeodomain (PHD) finger is a C4HC3 zinc-finger-like motif found in nuclear proteins thought to be involved in epigenetics and chromatin-mediated transcriptional regulation. The PHD finger binds two zinc ions using the so-called 'cross-brace' motif and is thus structurally related to the KOG3214 consensus Uncharacterized Zn ribbon-containing protein [Function unknown]
Probab=27.24  E-value=34  Score=22.14  Aligned_cols=30  Identities=20%  Similarity=0.422  Sum_probs=13.9

Q ss_pred             CcCCCCC--cccccCCCCCCceEEcCCCCCee
Q 033869            4 CPTCGTM--LQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         4 Cp~C~nl--L~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      ||.|+-.  +.-..|+........|+-|+-.+
T Consensus        26 ClfcnHek~v~~~~Dk~~~iG~~sC~iC~esF   57 (109)
T KOG3214|consen   26 CLFCNHEKSVSCTLDKKHNIGKASCRICEESF   57 (109)
T ss_pred             cCccccccceeeeehhhcCcceeeeeehhhhh
Confidence            5555532  22223333445556666666443


No 371
>PF06906 DUF1272:  Protein of unknown function (DUF1272);  InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length. This family contains a number of conserved cysteine residues and its function is unknown.
Probab=26.90  E-value=35  Score=19.68  Aligned_cols=10  Identities=30%  Similarity=0.820  Sum_probs=7.9

Q ss_pred             cccCCCCCCC
Q 033869           68 EVTCPACKHG   77 (110)
Q Consensus        68 ~~~CpkCg~~   77 (110)
                      ...||+||.+
T Consensus        41 ~~~CPNCgGe   50 (57)
T PF06906_consen   41 NGVCPNCGGE   50 (57)
T ss_pred             cCcCcCCCCc
Confidence            4579999975


No 372
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=26.63  E-value=60  Score=23.71  Aligned_cols=28  Identities=25%  Similarity=0.532  Sum_probs=20.6

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNME   36 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~   36 (110)
                      .=||.|+.-|...      ...+.|.+ ++..+..
T Consensus         3 ~~CP~C~~~l~~~------~~~~~C~~-~h~fd~a   30 (272)
T PRK11088          3 YQCPLCHQPLTLE------ENSWICPQ-NHQFDCA   30 (272)
T ss_pred             ccCCCCCcchhcC------CCEEEcCC-CCCCccc
Confidence            4699999999654      23699999 6666544


No 373
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=26.54  E-value=67  Score=26.50  Aligned_cols=18  Identities=33%  Similarity=0.320  Sum_probs=15.1

Q ss_pred             CCCCcccCCCCC-CCceEE
Q 033869           64 GPQTEVTCPACK-HGKAVY   81 (110)
Q Consensus        64 ~~~~~~~CpkCg-~~~a~~   81 (110)
                      ..|+++.|.+|| |-..+|
T Consensus       463 ~~R~Ev~c~~c~~HLGHvf  481 (521)
T PRK14018        463 MRRTEVRSRAADSHLGHVF  481 (521)
T ss_pred             ceEEEEEECCCCCcCCccc
Confidence            567899999999 557777


No 374
>KOG0402 consensus 60S ribosomal protein L37 [Translation, ribosomal structure and biogenesis]
Probab=26.39  E-value=34  Score=21.38  Aligned_cols=29  Identities=21%  Similarity=0.449  Sum_probs=20.6

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      +|+.||..-.-+    ....+|.|..|..+..-
T Consensus        38 ~CsfCGK~~vKR----~AvGiW~C~~C~kv~ag   66 (92)
T KOG0402|consen   38 TCSFCGKKTVKR----KAVGIWKCGSCKKVVAG   66 (92)
T ss_pred             hhhhcchhhhhh----hceeEEecCCccceecc
Confidence            688888766555    22568999999876543


No 375
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=26.32  E-value=20  Score=26.61  Aligned_cols=8  Identities=38%  Similarity=0.903  Sum_probs=3.2

Q ss_pred             eEEcCCCC
Q 033869           23 RFSCPACP   30 (110)
Q Consensus        23 ~~~C~~C~   30 (110)
                      ...|+.||
T Consensus       221 iv~CP~Cg  228 (239)
T COG1579         221 IVFCPYCG  228 (239)
T ss_pred             CccCCccc
Confidence            33344443


No 376
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=26.18  E-value=20  Score=24.25  Aligned_cols=26  Identities=31%  Similarity=0.750  Sum_probs=18.5

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      +.-||.||.+....       ..-.|+.|....
T Consensus         3 l~nC~~CgklF~~~-------~~~iCp~C~~~~   28 (137)
T TIGR03826         3 LANCPKCGRLFVKT-------GRDVCPSCYEEE   28 (137)
T ss_pred             Cccccccchhhhhc-------CCccCHHHhHHH
Confidence            45799999976553       234699999753


No 377
>KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=26.04  E-value=13  Score=30.49  Aligned_cols=25  Identities=28%  Similarity=0.798  Sum_probs=18.6

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      -||..||+|||--.-     .-+.|.+|.-
T Consensus       122 TFCDhCGsLLyGl~H-----QGmKC~~C~m  146 (683)
T KOG0696|consen  122 TFCDHCGSLLYGLIH-----QGMKCDTCDM  146 (683)
T ss_pred             chhhhHHHHHHHHHh-----cccccccccc
Confidence            499999999997511     2467888875


No 378
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=25.97  E-value=34  Score=17.90  Aligned_cols=10  Identities=40%  Similarity=1.022  Sum_probs=6.6

Q ss_pred             cCCCCCCCce
Q 033869           70 TCPACKHGKA   79 (110)
Q Consensus        70 ~CpkCg~~~a   79 (110)
                      .||+||....
T Consensus         4 ~CprC~kg~H   13 (36)
T PF14787_consen    4 LCPRCGKGFH   13 (36)
T ss_dssp             C-TTTSSSCS
T ss_pred             cCcccCCCcc
Confidence            6999997543


No 379
>PF06353 DUF1062:  Protein of unknown function (DUF1062);  InterPro: IPR009412 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=25.85  E-value=38  Score=23.03  Aligned_cols=16  Identities=31%  Similarity=0.658  Sum_probs=13.7

Q ss_pred             CceEEcCCCCCeeeeC
Q 033869           21 PSRFSCPACPYVCNME   36 (110)
Q Consensus        21 ~~~~~C~~C~y~~~~~   36 (110)
                      =|+|.|..|+++...+
T Consensus        11 WLIYrC~~C~~TwN~t   26 (142)
T PF06353_consen   11 WLIYRCEKCDYTWNMT   26 (142)
T ss_pred             EEEEEcccCcCccccc
Confidence            3789999999998875


No 380
>PF15499 Peptidase_C98:  Ubiquitin-specific peptidase-like, SUMO isopeptidase
Probab=25.84  E-value=59  Score=24.58  Aligned_cols=12  Identities=25%  Similarity=0.708  Sum_probs=10.0

Q ss_pred             eEEcCCCCCeee
Q 033869           23 RFSCPACPYVCN   34 (110)
Q Consensus        23 ~~~C~~C~y~~~   34 (110)
                      .|.|..|||...
T Consensus       134 eFeC~~Cg~~~~  145 (275)
T PF15499_consen  134 EFECSQCGHKYQ  145 (275)
T ss_pred             EEEccccCChhh
Confidence            589999999754


No 381
>COG2260 Predicted Zn-ribbon RNA-binding protein [Translation, ribosomal structure and biogenesis]
Probab=25.48  E-value=35  Score=19.82  Aligned_cols=12  Identities=25%  Similarity=0.761  Sum_probs=8.9

Q ss_pred             cccCCCCCCCce
Q 033869           68 EVTCPACKHGKA   79 (110)
Q Consensus        68 ~~~CpkCg~~~a   79 (110)
                      .++||.||....
T Consensus        17 ke~Cp~CG~~t~   28 (59)
T COG2260          17 KEKCPVCGGDTK   28 (59)
T ss_pred             cccCCCCCCccc
Confidence            468999997543


No 382
>PHA02611 51 baseplate hub assembly protein; Provisional
Probab=25.15  E-value=54  Score=24.51  Aligned_cols=17  Identities=47%  Similarity=0.935  Sum_probs=13.2

Q ss_pred             cccCCCCCCCceEEEEe
Q 033869           68 EVTCPACKHGKAVYHEL   84 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~   84 (110)
                      .+.||+||+..-+++.+
T Consensus        82 ~~tCp~Cg~e~~v~~~l   98 (249)
T PHA02611         82 TFTCPKCKKEKTVLFNL   98 (249)
T ss_pred             EEECCCCCCceeEEEEe
Confidence            46999999996666555


No 383
>COG0272 Lig NAD-dependent DNA ligase (contains BRCT domain type II) [DNA replication, recombination, and repair]
Probab=25.01  E-value=50  Score=28.11  Aligned_cols=27  Identities=33%  Similarity=0.746  Sum_probs=20.4

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCC---CCCe
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPA---CPYV   32 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~---C~y~   32 (110)
                      .+||.||+-|...++    ...+.|.+   |+-.
T Consensus       405 ~~CP~C~s~l~r~~~----e~~~rC~n~~~C~aq  434 (667)
T COG0272         405 THCPVCGSELVREEG----EVVIRCTNGLNCPAQ  434 (667)
T ss_pred             CCCCCCCCeeEeccC----ceeEecCCCCCChHH
Confidence            489999999988522    34889987   8753


No 384
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only]
Probab=24.85  E-value=29  Score=26.45  Aligned_cols=26  Identities=23%  Similarity=0.557  Sum_probs=19.5

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCeeee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNM   35 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~   35 (110)
                      .||.+|...-+++        .-.|+.|+.-...
T Consensus       110 ~~C~~C~~~KP~R--------S~HC~~Cn~CV~k  135 (309)
T COG5273         110 NFCSTCNIYKPPR--------SHHCSICNRCVLK  135 (309)
T ss_pred             eeccccccccCCC--------Cccchhhcchhhc
Confidence            5899998887777        5678888875443


No 385
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=24.41  E-value=71  Score=16.63  Aligned_cols=11  Identities=27%  Similarity=0.770  Sum_probs=8.5

Q ss_pred             eEEcCCCCCee
Q 033869           23 RFSCPACPYVC   33 (110)
Q Consensus        23 ~~~C~~C~y~~   33 (110)
                      -+.|+.|+...
T Consensus        12 ~f~C~~C~~~F   22 (39)
T smart00154       12 GFKCRHCGNLF   22 (39)
T ss_pred             CeECCccCCcc
Confidence            58899998653


No 386
>KOG2463 consensus Predicted RNA-binding protein Nob1p involved in 26S proteasome assembly [Posttranslational modification, protein turnover, chaperones]
Probab=24.21  E-value=91  Score=24.50  Aligned_cols=17  Identities=24%  Similarity=0.567  Sum_probs=11.7

Q ss_pred             cccCCCCCCCceEEEEe
Q 033869           68 EVTCPACKHGKAVYHEL   84 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~~   84 (110)
                      ...||+|||....=-.+
T Consensus       257 k~FCp~CG~~TL~K~aV  273 (376)
T KOG2463|consen  257 KDFCPSCGHKTLTKCAV  273 (376)
T ss_pred             hhcccccCCCeeeEEEE
Confidence            56899999985443333


No 387
>COG1379 PHP family phosphoesterase with a Zn ribbon [General function prediction only]
Probab=24.18  E-value=20  Score=28.09  Aligned_cols=26  Identities=31%  Similarity=0.686  Sum_probs=19.5

Q ss_pred             CcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            4 CPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         4 Cp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      |..|.....++   +...+.+.|++||-.
T Consensus       249 C~rC~t~y~le---~A~~~~wrCpkCGg~  274 (403)
T COG1379         249 CSRCYTRYSLE---EAKSLRWRCPKCGGK  274 (403)
T ss_pred             HHHhhhccCcc---hhhhhcccCcccccc
Confidence            77888777776   233678999999973


No 388
>COG3529 Predicted nucleic-acid-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=24.07  E-value=23  Score=20.79  Aligned_cols=35  Identities=14%  Similarity=0.325  Sum_probs=21.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -||.|+..=.+.-=.+++.....|-.|||.....+
T Consensus        12 ~CP~C~~~Dtl~mW~En~ve~vECV~CG~~~~~~~   46 (66)
T COG3529          12 VCPACQAQDTLAMWRENNVEIVECVKCGHHMREAD   46 (66)
T ss_pred             CCcccchhhHHHHHHhcCCceEehhhcchHhhhcc
Confidence            38888865322111334566899999999765443


No 389
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=23.54  E-value=51  Score=15.32  Aligned_cols=11  Identities=27%  Similarity=0.972  Sum_probs=7.0

Q ss_pred             EEecCCCCCcccc
Q 033869           97 YMCANKNCKHRWN  109 (110)
Q Consensus        97 Y~C~~~~C~~~wr  109 (110)
                      |.|..  |+.++.
T Consensus        15 ~~C~~--C~k~F~   25 (26)
T PF13465_consen   15 YKCPY--CGKSFS   25 (26)
T ss_dssp             EEESS--SSEEES
T ss_pred             CCCCC--CcCeeC
Confidence            67766  766653


No 390
>PHA02540 61 DNA primase; Provisional
Probab=23.43  E-value=1.1e+02  Score=23.85  Aligned_cols=33  Identities=24%  Similarity=0.525  Sum_probs=25.0

Q ss_pred             CcccCCCCCC-----CceEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           67 TEVTCPACKH-----GKAVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        67 ~~~~CpkCg~-----~~a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      -...||-||.     +++.||-.+.+.     -.||.|=+  ||.
T Consensus        26 ~~~~CPf~~ds~~~~~kpsF~V~p~k~-----~~~yhCFg--CGa   63 (337)
T PHA02540         26 YNFRCPICGDSQKDKNKARGWIYEKKD-----GGVFKCHN--CGY   63 (337)
T ss_pred             EEecCCCCCCccccCcCCcEEEeccCC-----ceEEEecC--CCC
Confidence            4679999997     357888765432     67999988  985


No 391
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=23.07  E-value=60  Score=17.63  Aligned_cols=25  Identities=24%  Similarity=0.639  Sum_probs=17.4

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      ..|+.|+.-+..-      .-...|+.||..
T Consensus         3 ~~C~~C~~~F~~~------~rk~~Cr~Cg~~   27 (57)
T cd00065           3 SSCMGCGKPFTLT------RRRHHCRNCGRI   27 (57)
T ss_pred             CcCcccCccccCC------ccccccCcCcCC
Confidence            4688888766654      125788888875


No 392
>smart00782 PhnA_Zn_Ribbon PhnA Zinc-Ribbon. This protein family includes an uncharacterised member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterised phosphonoacetate hydrolase designated PhnA.
Probab=22.76  E-value=1.1e+02  Score=16.69  Aligned_cols=40  Identities=18%  Similarity=0.386  Sum_probs=22.9

Q ss_pred             CCCcccCCCCCCCc-eEEEEeccCCCCCCceEEEEecCCCCCc
Q 033869           65 PQTEVTCPACKHGK-AVYHELQTRSADEPMSIFYMCANKNCKH  106 (110)
Q Consensus        65 ~~~~~~CpkCg~~~-a~~~~~Q~RsaDE~~T~fY~C~~~~C~~  106 (110)
                      .|.+-+|+=||.++ ...|.+.--+.+..-.-.+.|..  |..
T Consensus         4 ~Rs~~kCELC~a~~~L~vy~Vpp~~~~~~d~~iliC~t--C~~   44 (47)
T smart00782        4 ARCESKCELCGSDSPLVVYAVPPSSDVTADNSVMLCDT--CHS   44 (47)
T ss_pred             HHcCCcccCcCCCCCceEEecCCCCCCCccceeeechH--HHH
Confidence            35677899999754 35556632222222223588877  753


No 393
>cd01675 RNR_III Class III ribonucleotide reductase. Ribonucleotide reductase (RNR) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RNRs are separated into three classes based on their metallocofactor usage. Class I RNRs, found in eukaryotes, bacteria, and bacteriophage, use a diiron-tyrosyl radical. Class II RNRs, found in bacteria, bacteriophage, algae and archaea, use coenzyme B12 (adenosylcobalamin, AdoCbl). Class III RNRs, found in strict or facultative anaerobic bacteria, bacteriophage, and archaea, use an FeS cluster and S-adenosylmethionine to generate a glycyl radical. Many organisms have more than one class of RNR present in their genomes. All three RNRs have a ten-stranded alpha-beta barrel domain that is structurally similar to the domain of PFL (pyruvate formate lyase). The class III enzyme from phage T4 consists of two subunits, this model covers the larger subunit w
Probab=22.65  E-value=58  Score=26.86  Aligned_cols=14  Identities=21%  Similarity=0.565  Sum_probs=8.8

Q ss_pred             ccCCCCCCCceEEE
Q 033869           69 VTCPACKHGKAVYH   82 (110)
Q Consensus        69 ~~CpkCg~~~a~~~   82 (110)
                      ..||+||++....+
T Consensus       533 ~~CP~CGs~~~~~~  546 (555)
T cd01675         533 FKCPKCGSEDVEVI  546 (555)
T ss_pred             CCCcCCCCcCceEE
Confidence            47888876654443


No 394
>smart00746 TRASH metallochaperone-like domain.
Probab=22.62  E-value=66  Score=14.55  Aligned_cols=9  Identities=33%  Similarity=0.962  Sum_probs=5.4

Q ss_pred             CcCCCCCcc
Q 033869            4 CPTCGTMLQ   12 (110)
Q Consensus         4 Cp~C~nlL~   12 (110)
                      |+.||..+.
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            556666655


No 395
>COG4469 CoiA Competence protein CoiA-like family, contains a predicted nuclease    domain [General function prediction only]
Probab=22.56  E-value=38  Score=26.43  Aligned_cols=13  Identities=46%  Similarity=1.145  Sum_probs=11.9

Q ss_pred             CCCcCCCCCcccc
Q 033869            2 EFCPTCGTMLQYE   14 (110)
Q Consensus         2 ~FCp~C~nlL~~~   14 (110)
                      .|||-||+-|.++
T Consensus        26 ffCPaC~~~l~lK   38 (342)
T COG4469          26 FFCPACGSQLILK   38 (342)
T ss_pred             cccCCCCCeeeee
Confidence            3999999999998


No 396
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=22.48  E-value=83  Score=15.97  Aligned_cols=14  Identities=21%  Similarity=0.548  Sum_probs=9.3

Q ss_pred             ceEEcCCCCCeeee
Q 033869           22 SRFSCPACPYVCNM   35 (110)
Q Consensus        22 ~~~~C~~C~y~~~~   35 (110)
                      ..+.|++|+....+
T Consensus         3 ~~~~C~nC~R~v~a   16 (33)
T PF08209_consen    3 PYVECPNCGRPVAA   16 (33)
T ss_dssp             -EEE-TTTSSEEEG
T ss_pred             CeEECCCCcCCcch
Confidence            47899999986544


No 397
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=22.27  E-value=44  Score=17.63  Aligned_cols=8  Identities=50%  Similarity=1.356  Sum_probs=6.5

Q ss_pred             cccCCCCC
Q 033869           68 EVTCPACK   75 (110)
Q Consensus        68 ~~~CpkCg   75 (110)
                      ...|+.||
T Consensus        13 ~~~C~~Cg   20 (41)
T PF13878_consen   13 ATTCPTCG   20 (41)
T ss_pred             CcCCCCCC
Confidence            46899996


No 398
>cd02337 ZZ_CBP Zinc finger, ZZ type. Zinc finger present in CBP/p300 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. CREB-binding protein (CBP) is a large multidomain protein that provides binding sites for transcriptional coactivators, the role of the ZZ domain in CBP/p300 is unclear.
Probab=22.22  E-value=86  Score=16.52  Aligned_cols=9  Identities=33%  Similarity=1.195  Sum_probs=7.5

Q ss_pred             ceEEcCCCC
Q 033869           22 SRFSCPACP   30 (110)
Q Consensus        22 ~~~~C~~C~   30 (110)
                      .+|.|..|+
T Consensus        12 ~r~~C~~C~   20 (41)
T cd02337          12 TRWHCTVCE   20 (41)
T ss_pred             CceECCCCc
Confidence            489999997


No 399
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=22.21  E-value=36  Score=21.61  Aligned_cols=12  Identities=17%  Similarity=0.489  Sum_probs=9.4

Q ss_pred             EEcCCCCCeeee
Q 033869           24 FSCPACPYVCNM   35 (110)
Q Consensus        24 ~~C~~C~y~~~~   35 (110)
                      -.|+.|||+...
T Consensus        59 a~CkkCGfef~~   70 (97)
T COG3357          59 ARCKKCGFEFRD   70 (97)
T ss_pred             hhhcccCccccc
Confidence            369999997654


No 400
>PRK07111 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=22.03  E-value=47  Score=28.50  Aligned_cols=21  Identities=33%  Similarity=0.887  Sum_probs=14.6

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      ..|++||.+   .      ...+.|+.||.
T Consensus       681 ~~C~~CG~~---~------~~~~~CP~CG~  701 (735)
T PRK07111        681 DRCPVCGYL---G------VIEDKCPKCGS  701 (735)
T ss_pred             eecCCCCCC---C------CcCccCcCCCC
Confidence            369999932   2      12489999996


No 401
>COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain [DNA replication, recombination, and repair]
Probab=21.75  E-value=2.8e+02  Score=23.76  Aligned_cols=31  Identities=23%  Similarity=0.507  Sum_probs=21.5

Q ss_pred             CCCCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            1 MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         1 M~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      |.-||.|+.-=+..      ...-.|+.|+..-..++
T Consensus         2 ~~~C~~C~g~G~i~------v~~e~c~vc~gtG~~~~   32 (715)
T COG1107           2 IKKCPECGGKGKIV------VGEEECPVCHGTGFSDD   32 (715)
T ss_pred             CccccccCCCceEe------eeeeecccccccccccc
Confidence            45799999844443      33567999998766644


No 402
>PF12387 Peptidase_C74:  Pestivirus NS2 peptidase;  InterPro: IPR022120  The pestivirus NS2 peptidase is responsible for single cleavage between NS2 and NS3 of the Bovine viral diarrhea virus 1 polyprotein, a cleavage that is correlated with cytopathogenicity []. The peptidase is activated by its interaction with 'J-domain protein interacting with viral protein' - Jiv. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity
Probab=21.59  E-value=47  Score=23.62  Aligned_cols=11  Identities=27%  Similarity=0.715  Sum_probs=8.1

Q ss_pred             cccCCCCCCCc
Q 033869           68 EVTCPACKHGK   78 (110)
Q Consensus        68 ~~~CpkCg~~~   78 (110)
                      ...|||||...
T Consensus       175 g~~CPKCGr~G  185 (200)
T PF12387_consen  175 GGNCPKCGRHG  185 (200)
T ss_pred             CCCCCcccCCC
Confidence            34699999654


No 403
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=21.58  E-value=55  Score=30.03  Aligned_cols=22  Identities=36%  Similarity=0.896  Sum_probs=12.6

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      |||+||.-+.+         .+.|+.||...
T Consensus       681 fCP~CGs~te~---------vy~CPsCGaev  702 (1337)
T PRK14714        681 RCPDCGTHTEP---------VYVCPDCGAEV  702 (1337)
T ss_pred             cCcccCCcCCC---------ceeCccCCCcc
Confidence            67777766533         34566666543


No 404
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=21.51  E-value=54  Score=19.16  Aligned_cols=17  Identities=24%  Similarity=0.454  Sum_probs=12.8

Q ss_pred             CCCcccCCCCCCCceEE
Q 033869           65 PQTEVTCPACKHGKAVY   81 (110)
Q Consensus        65 ~~~~~~CpkCg~~~a~~   81 (110)
                      ..+...||+||+.-++|
T Consensus        55 kd~~H~Cp~C~~~lg~~   71 (73)
T PF10601_consen   55 KDVYHYCPNCGAFLGTY   71 (73)
T ss_pred             cCceEECCCCCCEeEEE
Confidence            34678999999876655


No 405
>PLN00162 transport protein sec23; Provisional
Probab=21.50  E-value=54  Score=28.19  Aligned_cols=35  Identities=20%  Similarity=0.312  Sum_probs=25.8

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      -|..|+..|.|-..=+.+...|.|+-|+...+...
T Consensus        55 RC~~CraylNPf~~~d~~~~~W~C~~C~~~N~~P~   89 (761)
T PLN00162         55 RCRTCRAVLNPYCRVDFQAKIWICPFCFQRNHFPP   89 (761)
T ss_pred             ccCCCcCEECCceEEecCCCEEEccCCCCCCCCch
Confidence            58999999988633334456999999998766543


No 406
>PF02701 zf-Dof:  Dof domain, zinc finger;  InterPro: IPR003851 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry consists of proteins containing a Dof domain, which is a zinc finger DNA-binding domain that shows resemblance to the Cys2 zinc finger, although it has a longer putative loop where an extra Cys residue is conserved []. AOBP, a DNA-binding protein in pumpkin (Cucurbita maxima), contains a 52 amino acid Dof domain, which is highly conserved in several DNA-binding proteins of higher plants. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent
Probab=21.48  E-value=79  Score=18.59  Aligned_cols=35  Identities=23%  Similarity=0.762  Sum_probs=20.3

Q ss_pred             cccCCCCCCCce--EEEEeccCCCCCCceEEEEecCCCCCcccc
Q 033869           68 EVTCPACKHGKA--VYHELQTRSADEPMSIFYMCANKNCKHRWN  109 (110)
Q Consensus        68 ~~~CpkCg~~~a--~~~~~Q~RsaDE~~T~fY~C~~~~C~~~wr  109 (110)
                      ...||+|+....  -||.--  +.  .|-+ |.|..  |.-.|+
T Consensus         5 ~~~CPRC~S~nTKFcYyNNy--~~--~QPR-~~Ck~--C~rywT   41 (63)
T PF02701_consen    5 PLPCPRCDSTNTKFCYYNNY--NL--SQPR-YFCKS--CRRYWT   41 (63)
T ss_pred             CCCCCCcCCCCCEEEeecCC--CC--CCcc-hhhHH--HHHHHH
Confidence            468999997543  344321  11  1222 66877  877775


No 407
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=21.46  E-value=77  Score=21.32  Aligned_cols=13  Identities=23%  Similarity=0.631  Sum_probs=9.5

Q ss_pred             eEEcCCCCCeeee
Q 033869           23 RFSCPACPYVCNM   35 (110)
Q Consensus        23 ~~~C~~C~y~~~~   35 (110)
                      ...|+-|+..-..
T Consensus       105 ~~~CPwCg~~g~~  117 (131)
T PF15616_consen  105 EVTCPWCGNEGSF  117 (131)
T ss_pred             CEECCCCCCeeee
Confidence            7888888876544


No 408
>PF13597 NRDD:  Anaerobic ribonucleoside-triphosphate reductase; PDB: 1HK8_A 1H78_A 1H7A_A 1H79_A 1H7B_A.
Probab=21.43  E-value=52  Score=27.09  Aligned_cols=16  Identities=19%  Similarity=0.407  Sum_probs=7.3

Q ss_pred             cccCCCCCCCceEEEE
Q 033869           68 EVTCPACKHGKAVYHE   83 (110)
Q Consensus        68 ~~~CpkCg~~~a~~~~   83 (110)
                      ...||+||++.+..+.
T Consensus       504 ~~~CP~CGs~~~~~~~  519 (546)
T PF13597_consen  504 GDKCPKCGSENIEVYS  519 (546)
T ss_dssp             EEE-CCC----EEEEB
T ss_pred             CCCCCCCCCcccceEE
Confidence            4479999988765554


No 409
>PF02012 BNR:  BNR/Asp-box repeat;  InterPro: IPR002860 Members of this entry contain multiple BNR (bacterial neuraminidase repeat) repeats or Asp-boxes. The repeats are short, however the repeats are never found closer than 40 residues together suggesting that the repeat is structurally longer. These repeats are found in a variety of non-homologous proteins, including bacterial ribonucleases, sulphite oxidases, reelin, netrins, sialidases, neuraminidases, some lipoprotein receptors, and a variety of glycosyl hydrolases [].; PDB: 2JKB_A 2VW0_A 2VW2_A 2VW1_A 2CN2_D 2CN3_B 2VK7_B 2VK5_A 2VK6_A 2BF6_A ....
Probab=21.41  E-value=32  Score=13.60  Aligned_cols=8  Identities=25%  Similarity=0.144  Sum_probs=4.7

Q ss_pred             CCCCCCce
Q 033869           87 RSADEPMS   94 (110)
Q Consensus        87 RsaDE~~T   94 (110)
                      +|.|.|.|
T Consensus         2 ~S~D~G~T    9 (12)
T PF02012_consen    2 YSTDGGKT    9 (12)
T ss_dssp             EESSTTSS
T ss_pred             EeCCCccc
Confidence            45666655


No 410
>KOG4080 consensus Mitochondrial ribosomal protein L32 [Translation, ribosomal structure and biogenesis]
Probab=21.26  E-value=42  Score=23.66  Aligned_cols=10  Identities=70%  Similarity=1.228  Sum_probs=8.1

Q ss_pred             ccCCCCCCCc
Q 033869           69 VTCPACKHGK   78 (110)
Q Consensus        69 ~~CpkCg~~~   78 (110)
                      ..||.|||-.
T Consensus        94 ~~CP~CGh~k  103 (176)
T KOG4080|consen   94 NTCPACGHIK  103 (176)
T ss_pred             ccCcccCccc
Confidence            5899999843


No 411
>PRK07591 threonine synthase; Validated
Probab=21.17  E-value=55  Score=25.88  Aligned_cols=22  Identities=27%  Similarity=0.641  Sum_probs=15.4

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPY   31 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y   31 (110)
                      .|..||....+.      .. +.|+.||-
T Consensus        20 ~C~~Cg~~~~~~------~~-~~C~~cg~   41 (421)
T PRK07591         20 KCRECGAEYPLG------PI-HVCEECFG   41 (421)
T ss_pred             EeCCCCCcCCCC------CC-ccCCCCCC
Confidence            588888876543      23 88888873


No 412
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=21.07  E-value=51  Score=20.40  Aligned_cols=13  Identities=23%  Similarity=0.613  Sum_probs=9.7

Q ss_pred             CcccCCCCCCCce
Q 033869           67 TEVTCPACKHGKA   79 (110)
Q Consensus        67 ~~~~CpkCg~~~a   79 (110)
                      ...+|+.||.+=.
T Consensus         7 ~~~~C~~CG~d~~   19 (86)
T PF06170_consen    7 VAPRCPHCGLDYS   19 (86)
T ss_pred             CCCcccccCCccc
Confidence            4568999998643


No 413
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=20.86  E-value=1e+02  Score=16.27  Aligned_cols=13  Identities=23%  Similarity=0.345  Sum_probs=10.4

Q ss_pred             eEEcCCCCCeeee
Q 033869           23 RFSCPACPYVCNM   35 (110)
Q Consensus        23 ~~~C~~C~y~~~~   35 (110)
                      .|.|-.|++..-.
T Consensus        11 l~~CL~C~~~~c~   23 (50)
T smart00290       11 LWLCLTCGQVGCG   23 (50)
T ss_pred             eEEecCCCCcccC
Confidence            8899999986543


No 414
>PRK07225 DNA-directed RNA polymerase subunit B'; Validated
Probab=20.71  E-value=49  Score=27.79  Aligned_cols=27  Identities=30%  Similarity=0.779  Sum_probs=18.8

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCe
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYV   32 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~   32 (110)
                      ..|..||.++...  .  ....+.|+.|+..
T Consensus       545 ~vC~~CG~~~~~~--~--~~~~~~C~~C~~~  571 (605)
T PRK07225        545 YVCAKCGMIAIYD--K--KRNRKYCPICGEE  571 (605)
T ss_pred             EeecCcCcceehh--c--ccCceeecccCCC
Confidence            4689999988654  2  1236789999764


No 415
>PRK09263 anaerobic ribonucleoside triphosphate reductase; Provisional
Probab=20.56  E-value=96  Score=26.55  Aligned_cols=28  Identities=29%  Similarity=0.604  Sum_probs=16.4

Q ss_pred             CCCcCCCCCcccccCCCCCCceEEcCCCCCee
Q 033869            2 EFCPTCGTMLQYELPHMDRPSRFSCPACPYVC   33 (110)
Q Consensus         2 ~FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~   33 (110)
                      ..|++||..  -...-.  ...+.|+.||...
T Consensus       642 ~~C~~CG~~--Ge~~~~--~~~~~CP~CG~~~  669 (711)
T PRK09263        642 DECYECGFT--GEFECT--EKGFTCPKCGNHD  669 (711)
T ss_pred             cccCCCCCC--ccccCC--CCCCcCcCCCCCC
Confidence            479999962  110001  1238999999754


No 416
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=20.48  E-value=57  Score=19.31  Aligned_cols=12  Identities=25%  Similarity=0.534  Sum_probs=5.2

Q ss_pred             CCcCCCCCcccc
Q 033869            3 FCPTCGTMLQYE   14 (110)
Q Consensus         3 FCp~C~nlL~~~   14 (110)
                      -|+.|+++|..+
T Consensus         9 rCs~C~~~l~~p   20 (65)
T PF14835_consen    9 RCSICFDILKEP   20 (65)
T ss_dssp             S-SSS-S--SS-
T ss_pred             CCcHHHHHhcCC
Confidence            478888887766


No 417
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=20.44  E-value=79  Score=20.25  Aligned_cols=30  Identities=23%  Similarity=0.604  Sum_probs=22.6

Q ss_pred             CCcCCCCCcccccCCCCCCceEEcCCCCCeeeeCC
Q 033869            3 FCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMES   37 (110)
Q Consensus         3 FCp~C~nlL~~~~~~~~~~~~~~C~~C~y~~~~~~   37 (110)
                      .|.-|+..=|..  +   +..++|.+|+......+
T Consensus        37 aCeiC~~~GY~q--~---g~~lvC~~C~~~~~~~~   66 (102)
T PF10080_consen   37 ACEICGPKGYYQ--E---GDQLVCKNCGVRFNLPT   66 (102)
T ss_pred             eccccCCCceEE--E---CCEEEEecCCCEEehhh
Confidence            588887776665  2   35899999999877654


No 418
>TIGR02827 RNR_anaer_Bdell anaerobic ribonucleoside-triphosphate reductase. Members of this family belong to the class III anaerobic ribonucleoside-triphosphate reductases (RNR). These glycine-radical-containing enzymes are oxygen-sensitive and operate under anaerobic conditions. The genes for this family are pair with genes for an acitivating protein that creates a glycine radical. Members of this family, though related, fall outside the scope of TIGR02487, a functionally equivalent protein set; no genome has members in both familes. Identification as RNR is supported by gene pairing with the activating protein, lack of other anaerobic RNR, and presence of an upstream regulatory element strongly conserved upstream of most RNR operons.
Probab=20.40  E-value=73  Score=26.70  Aligned_cols=14  Identities=29%  Similarity=0.743  Sum_probs=8.9

Q ss_pred             ccCCCCCCCceEEE
Q 033869           69 VTCPACKHGKAVYH   82 (110)
Q Consensus        69 ~~CpkCg~~~a~~~   82 (110)
                      ..||+||+..+..+
T Consensus       547 ~~CP~CGs~~~ev~  560 (586)
T TIGR02827       547 HRCPVCGSANIDYG  560 (586)
T ss_pred             CcCcCCCCccceEE
Confidence            57888886554433


No 419
>PRK06599 DNA topoisomerase I; Validated
Probab=20.23  E-value=82  Score=26.61  Aligned_cols=31  Identities=26%  Similarity=0.581  Sum_probs=17.6

Q ss_pred             ccCCCCCCCceEEEEeccCCCCCCceEEEEecC-CCCCcc
Q 033869           69 VTCPACKHGKAVYHELQTRSADEPMSIFYMCAN-KNCKHR  107 (110)
Q Consensus        69 ~~CpkCg~~~a~~~~~Q~RsaDE~~T~fY~C~~-~~C~~~  107 (110)
                      ..||+||..   ...   |..--+  .|+.|.+ +.|++.
T Consensus       638 ~~Cp~C~~~---~~~---kkgk~g--~f~~Cs~yp~ck~~  669 (675)
T PRK06599        638 EKCPKCGGP---LVL---KKGRYG--KFLACSGYPECKHI  669 (675)
T ss_pred             CCCCCCCCe---eEE---EeCCCC--ceeeCCCCCCCCce
Confidence            379999974   222   332223  4888853 347643


Done!