Citrus Sinensis ID: 033869


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMMEGPQTEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWNE
ccccccccccccccccccccccEEEccccccEEECcccEEEEEEccccccccccEECccccccccccCECccccccccEEEEEEcccccccccEEEEEccccccccCCcc
MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMESRVK****************TQDAMMEGPQTEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRW**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFCPTCGTMLQYELPHMDRPSRFSCPACPYVCNMESRVKIKRKQPLSKKEIQPIFTQDAMMEGPQTEVTCPACKHGKAVYHELQTRSADEPMSIFYMCANKNCKHRWNE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerase III subunit RPC10 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts induce type I interferon and NF- Kappa-B through the RIG-I pathway.probableQ2M2S7
DNA-directed RNA polymerase subunit M DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.probableQ58548
DNA-directed RNA polymerase III subunit RPC10 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs. Involved in Pol III transcription reinitiation and RNA cleavage during transcription termination.probableQ04307

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H0G, chain I
Confidence level:very confident
Coverage over the Query: 1-110
View the alignment between query and template
View the model in PyMOL