BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033898
         (109 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1D9U|A Chain A, Bacteriophage Lambda Lysozyme Complexed With A
          Chitohexasacharide
 pdb|1D9U|B Chain B, Bacteriophage Lambda Lysozyme Complexed With A
          Chitohexasacharide
 pdb|3D3D|A Chain A, Bacteriophage Lambda Lysozyme Complexed With A
          Chitohexasaccharide
 pdb|3D3D|B Chain B, Bacteriophage Lambda Lysozyme Complexed With A
          Chitohexasaccharide
          Length = 154

 Score = 28.5 bits (62), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 20/39 (51%), Gaps = 6/39 (15%)

Query: 38 LTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQN 76
          L W E  DNG+Q TRN  +  +V   L+      TDY +
Sbjct: 15 LAWSEGTDNGRQKTRNHGYDVIVGGELF------TDYSD 47


>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In
           Complex With The Agonist 4-Ahcp
 pdb|2WKY|B Chain B, Crystal Structure Of The Ligand-Binding Core Of Glur5 In
           Complex With The Agonist 4-Ahcp
          Length = 258

 Score = 26.9 bits (58), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 30  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 89
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 65  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 113

Query: 90  VVAKFP 95
                P
Sbjct: 114 YRKGTP 119


>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In
           Complex With Glutamate At 2.1 Angstrom Resolution
 pdb|3C31|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Lithium At 1.49 Angstrom Resolution
 pdb|3C31|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Lithium At 1.49 Angstrom Resolution
 pdb|3C32|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Sodium At 1.72 Angstrom Resolution
 pdb|3C32|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Sodium At 1.72 Angstrom Resolution
 pdb|3C33|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Potassium At 1.78 Angstrom Resolution
 pdb|3C33|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Potassium At 1.78 Angstrom Resolution
 pdb|3C34|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Rubidium At 1.82 Angstrom Resolution
 pdb|3C34|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Rubidium At 1.82 Angstrom Resolution
 pdb|3C35|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Cesium At 1.97 Angstrom Resolution
 pdb|3C35|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Cesium At 1.97 Angstrom Resolution
 pdb|3C36|A Chain A, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Ammonium Ions At 1.68 Angstrom Resolution
 pdb|3C36|B Chain B, Crystal Structure Of Glur5 Ligand-Binding Core In Complex
           With Ammonium Ions At 1.68 Angstrom Resolution
          Length = 258

 Score = 26.9 bits (58), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 30  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 89
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 65  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 113

Query: 90  VVAKFP 95
                P
Sbjct: 114 YRKGTP 119


>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55
 pdb|3C9C|A Chain A, Structural Basis Of Histone H4 Recognition By P55
          Length = 432

 Score = 26.9 bits (58), Expect = 3.3,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 19/67 (28%)

Query: 22 WKKGTPFADDQGIYNGLTW------W---EQIDNGKQLTRNRKFLTVVPVVLYLIASHTT 72
          WKK TPF  D  + + L W      W       +GK  + +R           ++ +HT+
Sbjct: 30 WKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHR----------LILGTHTS 79

Query: 73 DYQNPML 79
          D QN +L
Sbjct: 80 DEQNHLL 86


>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Ubp310 At 1.74 Angstroms Resolution
 pdb|2F34|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Ubp310 At 1.74 Angstroms Resolution
 pdb|2F35|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core With
           Ubp302 At 1.87 Angstroms Resolution
 pdb|2F35|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core With
           Ubp302 At 1.87 Angstroms Resolution
 pdb|2F36|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Glutamate At 2.1 Angstroms Resolution
 pdb|2F36|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Glutamate At 2.1 Angstroms Resolution
 pdb|2F36|C Chain C, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Glutamate At 2.1 Angstroms Resolution
 pdb|2F36|D Chain D, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           With Glutamate At 2.1 Angstroms Resolution
 pdb|2OJT|A Chain A, Structure And Mechanism Of Kainate Receptor Modulation By
           Anions
 pdb|2OJT|B Chain B, Structure And Mechanism Of Kainate Receptor Modulation By
           Anions
 pdb|2QS1|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp315 At 1.80 Angstroms Resolution
 pdb|2QS1|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp315 At 1.80 Angstroms Resolution
 pdb|2QS2|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp318 At 1.80 Angstroms Resolution
 pdb|2QS2|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp318 At 1.80 Angstroms Resolution
 pdb|2QS3|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp316 At 1.76 Angstroms Resolution
 pdb|2QS3|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ubp316 At 1.76 Angstroms Resolution
 pdb|2QS4|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ly466195 At 1.58 Angstroms Resolution
 pdb|2QS4|B Chain B, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ly466195 At 1.58 Angstroms Resolution
 pdb|2QS4|C Chain C, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ly466195 At 1.58 Angstroms Resolution
 pdb|2QS4|D Chain D, Crystal Structure Of The Glur5 Ligand Binding Core Dimer
           In Complex With Ly466195 At 1.58 Angstroms Resolution
          Length = 258

 Score = 26.6 bits (57), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 30  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 89
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 65  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 113

Query: 90  VVAKFP 95
                P
Sbjct: 114 YRKGTP 119


>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand-
           Binding Core In Complex With (S)-Glutamate
 pdb|1YCJ|B Chain B, Crystal Structure Of The Kainate Receptor Glur5 Ligand-
           Binding Core In Complex With (S)-Glutamate
 pdb|1VSO|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Iglur5 In
           Complex With The Antagonist (S)-Atpo At 1.85 A
           Resolution
 pdb|2PBW|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Iglur5 In
           Complex With The Partial Agonist Domoic Acid At 2.5 A
           Resolution
 pdb|2PBW|B Chain B, Crystal Structure Of The Ligand-Binding Core Of Iglur5 In
           Complex With The Partial Agonist Domoic Acid At 2.5 A
           Resolution
 pdb|3GBA|A Chain A, X-Ray Structure Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Dysiherbaine At 1.35a Resolution
 pdb|3GBA|B Chain B, X-Ray Structure Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Dysiherbaine At 1.35a Resolution
 pdb|3GBA|C Chain C, X-Ray Structure Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Dysiherbaine At 1.35a Resolution
 pdb|3GBA|D Chain D, X-Ray Structure Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Dysiherbaine At 1.35a Resolution
 pdb|3GBB|A Chain A, X-Ray Strucutre Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Msviii-19 At 2.10a Resolution
 pdb|3GBB|B Chain B, X-Ray Strucutre Of Iglur5 Ligand-Binding Core (S1s2) In
           Complex With Msviii-19 At 2.10a Resolution
 pdb|3S2V|A Chain A, Crystal Structure Of The Ligand Binding Domain Of Gluk1 In
           Complex With An Antagonist
           (S)-1-(2'-Amino-2'-Carboxyethyl)-3-[(2-
           Carboxythien-3-Yl)methyl]thieno[3,4-D]pyrimidin-2,
           4-Dione At 2.5 A Resolution
 pdb|3S2V|B Chain B, Crystal Structure Of The Ligand Binding Domain Of Gluk1 In
           Complex With An Antagonist
           (S)-1-(2'-Amino-2'-Carboxyethyl)-3-[(2-
           Carboxythien-3-Yl)methyl]thieno[3,4-D]pyrimidin-2,
           4-Dione At 2.5 A Resolution
 pdb|4E0X|A Chain A, Crystal Structure Of The Kainate Receptor Gluk1
           Ligand-Binding Domain In Complex With Kainate In The
           Absence Of Glycerol
 pdb|4E0X|B Chain B, Crystal Structure Of The Kainate Receptor Gluk1
           Ligand-Binding Domain In Complex With Kainate In The
           Absence Of Glycerol
 pdb|4DLD|A Chain A, Crystal Structure Of The Gluk1 Ligand-Binding Domain
           (S1s2) In Complex With The Antagonist
           (S)-2-Amino-3-(2-(2-Carboxyethyl)-5-Chloro-4-
           Nitrophenyl)propionic Acid At 2.0 A Resolution
 pdb|4DLD|B Chain B, Crystal Structure Of The Gluk1 Ligand-Binding Domain
           (S1s2) In Complex With The Antagonist
           (S)-2-Amino-3-(2-(2-Carboxyethyl)-5-Chloro-4-
           Nitrophenyl)propionic Acid At 2.0 A Resolution
          Length = 257

 Score = 26.6 bits (57), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 30  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 89
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 65  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 113

Query: 90  VVAKFP 95
                P
Sbjct: 114 YRKGTP 119


>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3
 pdb|2YBA|B Chain B, Crystal Structure Of Nurf55 In Complex With Histone H3
 pdb|2YB8|B Chain B, Crystal Structure Of Nurf55 In Complex With Su(Z)12
          Length = 422

 Score = 26.6 bits (57), Expect = 3.5,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 19/67 (28%)

Query: 22 WKKGTPFADDQGIYNGLTW------W---EQIDNGKQLTRNRKFLTVVPVVLYLIASHTT 72
          WKK TPF  D  + + L W      W       +GK  + +R           ++ +HT+
Sbjct: 32 WKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHR----------LILGTHTS 81

Query: 73 DYQNPML 79
          D QN +L
Sbjct: 82 DEQNHLL 88


>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide
          Length = 430

 Score = 26.6 bits (57), Expect = 3.5,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 29/67 (43%), Gaps = 19/67 (28%)

Query: 22 WKKGTPFADDQGIYNGLTW------W---EQIDNGKQLTRNRKFLTVVPVVLYLIASHTT 72
          WKK TPF  D  + + L W      W       +GK  + +R           ++ +HT+
Sbjct: 28 WKKNTPFLYDLVMTHALEWPSLTAQWLPDVTKQDGKDYSVHR----------LILGTHTS 77

Query: 73 DYQNPML 79
          D QN +L
Sbjct: 78 DEQNHLL 84


>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human
           Ionotropic Glutamate Receptor, Glur5, In Complex With
           Glutamate
 pdb|2ZNT|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human
           Ionotropic Glutamate Receptor, Glur5, In Complex With A
           Novel Selective Agonist, Dysiherbaine
 pdb|2ZNU|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human
           Ionotropic Glutamate Receptor, Glur5, In Complex With A
           Novel Selective Agonist, Neodysiherbaine A
 pdb|3FUZ|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With L-Glutamate In
           Space Group P1
 pdb|3FUZ|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With L-Glutamate In
           Space Group P1
 pdb|3FV1|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Dysiherbaine In
           Space Group P1
 pdb|3FV1|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Dysiherbaine In
           Space Group P1
 pdb|3FV2|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Neodysiherbaine A
           In Space Group P1
 pdb|3FV2|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Neodysiherbaine A
           In Space Group P1
 pdb|3FVG|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Msviii-19 In Space
           Group P1
 pdb|3FVG|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With Msviii-19 In Space
           Group P1
 pdb|3FVK|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With
           8-Deoxy-Neodysiherbaine A In Space Group P1
 pdb|3FVK|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With
           8-Deoxy-Neodysiherbaine A In Space Group P1
 pdb|3FVN|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With
           9-Deoxy-Neodysiherbaine A In Space Group P1
 pdb|3FVN|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand- Binding Core In Complex With
           9-Deoxy-Neodysiherbaine A In Space Group P1
 pdb|3FVO|A Chain A, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand-Binding Core In Complex With
           8-Epi-Neodysiherbaine A In Space Group P1
 pdb|3FVO|B Chain B, Crystal Structure Of The Human Glutamate Receptor, Glur5,
           Ligand-Binding Core In Complex With
           8-Epi-Neodysiherbaine A In Space Group P1
          Length = 256

 Score = 26.6 bits (57), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 17/66 (25%), Positives = 29/66 (43%), Gaps = 11/66 (16%)

Query: 30  DDQGIYNGLTWWEQIDNGKQLTRNRKFLTVVPVVLYLIASHTTDYQNPMLFFNTLAVFVL 89
           +D+G +NG+         K+L  +R  L V P+ +  +     D+  P   F TL + +L
Sbjct: 64  NDKGEWNGMV--------KELIDHRADLAVAPLTITYVREKVIDFSKP---FMTLGISIL 112

Query: 90  VVAKFP 95
                P
Sbjct: 113 YRKGTP 118


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.143    0.478 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,151,633
Number of Sequences: 62578
Number of extensions: 116005
Number of successful extensions: 249
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 8
Number of HSP's that attempted gapping in prelim test: 248
Number of HSP's gapped (non-prelim): 9
length of query: 109
length of database: 14,973,337
effective HSP length: 73
effective length of query: 36
effective length of database: 10,405,143
effective search space: 374585148
effective search space used: 374585148
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 45 (21.9 bits)