BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 033901
(109 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1RKY|A Chain A, Pplo + Xe
pdb|1W7C|A Chain A, Pplo At 1.23 Angstroms
Length = 747
Score = 28.5 bits (62), Expect = 1.0, Method: Composition-based stats.
Identities = 13/38 (34%), Positives = 22/38 (57%)
Query: 15 QNPKRSLGFIANAKKHKHSFIQLFAMTGILLLSVRSLG 52
QNP ++ FI+ ++F+ F + G L +SVR+ G
Sbjct: 423 QNPTLNVRFISTIGNXDYNFLYKFFLDGTLEVSVRAAG 460
>pdb|1N9E|A Chain A, Crystal Structure Of Pichia Pastoris Lysyl Oxidase Pplo
pdb|1N9E|B Chain B, Crystal Structure Of Pichia Pastoris Lysyl Oxidase Pplo
pdb|1N9E|C Chain C, Crystal Structure Of Pichia Pastoris Lysyl Oxidase Pplo
pdb|1N9E|D Chain D, Crystal Structure Of Pichia Pastoris Lysyl Oxidase Pplo
Length = 787
Score = 28.5 bits (62), Expect = 1.0, Method: Composition-based stats.
Identities = 13/38 (34%), Positives = 22/38 (57%)
Query: 15 QNPKRSLGFIANAKKHKHSFIQLFAMTGILLLSVRSLG 52
QNP ++ FI+ ++F+ F + G L +SVR+ G
Sbjct: 463 QNPTLNVRFISTIGNXDYNFLYKFFLDGTLEVSVRAAG 500
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.131 0.360
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,314,179
Number of Sequences: 62578
Number of extensions: 65786
Number of successful extensions: 162
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 160
Number of HSP's gapped (non-prelim): 3
length of query: 109
length of database: 14,973,337
effective HSP length: 73
effective length of query: 36
effective length of database: 10,405,143
effective search space: 374585148
effective search space used: 374585148
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)