Citrus Sinensis ID: 033909


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MTLQSSLCGSGVSTFICTPRPIIARPRPVTQIRAQVEPSEKSVEIMRKFSEQYARRSDTFFCVDKSVTSVVIKGLADHKDSLGAPLCPCIMTTKLLKLSRASGIVHVFP
cccccccccccccccccccccccccccccEEEcccccccHHHHHHHHHHHHHHHHHcccECccccHHHHHHHHHHHHHHHHHcccccccEEEEcHHHHHHHcccccccc
********GSGVSTFICTPRPIIARPR*V*****************RKFSEQYARRSDTFFCVDKSVTSVVIKGLADHKDSLGAPLCPCIMTTKLLKLSRASGIVHVFP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLQSSLCGSGVSTFICTPRPIIARPRPVTQIRAQVEPSEKSVEIMRKFSEQYARRSDTFFCVDKSVTSVVIKGLADHKDSLGAPLCPCIMTTKLLKLSRASGIVHVFP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferredoxin-thioredoxin reductase catalytic chain, chloroplastic FTR is a [4Fe-4S] protein playing a central role in the ferredoxin/thioredoxin regulatory chain. It converts an electron signal (photoreduced ferredoxin) to a thiol signal (reduced thioredoxin) in the regulation of enzymes by reduction of specific disulfide groups. Catalyzes the light-dependent activation of several photosynthetic enzymes.probableQ6K471

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.7.-With an iron-sulfur protein as acceptor.probable
1.8.7.2Ferredoxin:thioredoxin reductase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1DJ7, chain A
Confidence level:very confident
Coverage over the Query: 39-103
View the alignment between query and template
View the model in PyMOL