Query         033928
Match_columns 108
No_of_seqs    54 out of 56
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 07:53:15 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033928.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033928hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00053 photosystem II subuni 100.0 2.7E-50 5.9E-55  293.8   6.7   84   24-107     1-87  (117)
  2 PF04725 PsbR:  Photosystem II  100.0 8.9E-44 1.9E-48  253.9   4.9   68   40-107     1-69  (99)
  3 PLN00083 photosystem II subuni 100.0 2.7E-33 5.9E-38  200.5   3.2   71   38-108     2-77  (101)
  4 PF05430 Methyltransf_30:  S-ad  48.1     5.9 0.00013   28.4  -0.0   15   85-99     56-70  (124)
  5 PF08576 DUF1764:  Eukaryotic p  42.1     5.7 0.00012   27.3  -0.8   13   85-98     70-82  (102)
  6 COG4121 Uncharacterized conser  34.9      11 0.00024   30.6  -0.4   15   85-99    174-188 (252)
  7 COG5659 FOG: Transposase [DNA   26.3      26 0.00056   30.6   0.4   42   62-103    98-160 (385)
  8 PF10417 1-cysPrx_C:  C-termina  21.1      27 0.00058   20.8  -0.3   21   75-103     2-22  (40)
  9 COG5007 Predicted transcriptio  20.3      23 0.00049   25.0  -0.9    9   92-100    70-78  (80)
 10 PLN02289 ribulose-bisphosphate  17.5      88  0.0019   24.9   1.7   45    1-45      1-54  (176)

No 1  
>PLN00053 photosystem II subunit R; Provisional
Probab=100.00  E-value=2.7e-50  Score=293.82  Aligned_cols=84  Identities=74%  Similarity=1.338  Sum_probs=81.8

Q ss_pred             ccCCCCCcc--ceeEEeecCc-eeeeccccccCCCcccCcCcCCCCCCccCCeeEEeccccccCCCCccccccCCCCCCC
Q 033928           24 ARGLPSLAK--TSFKIVAKGG-KIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPS  100 (108)
Q Consensus        24 ~~glp~l~R--~s~~v~asgg-Kikt~kp~G~~ggm~~k~gvDasGRk~KgkgVYqf~~KyGANVDgYSPIY~p~eWs~~  100 (108)
                      +||||+++|  ++|+|+|+++ ||||++|||++|+|++|+|+||+|||+||||||||+||||||||||||||+||||||+
T Consensus         1 ~~glp~l~r~~ss~~v~as~~kkikt~~p~G~~G~m~~k~gvDasGRk~kGkGVYqFvdKYGANVDgYSPIY~~~ews~~   80 (117)
T PLN00053          1 VRGLPPLSRTARSFKVTASGGKKIKTDQPYGPSGGMNLKDGVDASGRKGKGKGVYQFVDKYGANVDGYSPIYTPDEWSPS   80 (117)
T ss_pred             CCccCcccccccceEEEecCCceeeecCCcccCCCcccccccCCCCccCCCcceEEehhhcCccccccCCCcChhhcCCC
Confidence            589999999  6899999988 8999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCeeccC
Q 033928          101 GDVYTGV  107 (108)
Q Consensus       101 GD~Y~G~  107 (108)
                      ||+|+|+
T Consensus        81 Gd~Y~gg   87 (117)
T PLN00053         81 GDVYVGG   87 (117)
T ss_pred             CCeeeCC
Confidence            9999996


No 2  
>PF04725 PsbR:  Photosystem II 10 kDa polypeptide PsbR;  InterPro: IPR006814 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight intrinsic protein PsbR found in PSII, which is also known as the 10 kDa polypeptide. The PsbR gene is found only in the nucleus of green algae and higher plants. PsbR may provide a binding site for the extrinsic oxygen-evolving complex protein PsbP to the thylakoid membrane. PsbR has a transmembrane domain to anchor it to the thylakoid membrane, and a charged N-terminal domain capable of forming ion bridges with extrinsic proteins, allowing PsbR to act as a docking protein. PsbR may be a pH-dependent stabilising protein that functions at both donor and acceptor sides of PSII [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0042651 thylakoid membrane
Probab=100.00  E-value=8.9e-44  Score=253.90  Aligned_cols=68  Identities=79%  Similarity=1.411  Sum_probs=65.9

Q ss_pred             cCc-eeeeccccccCCCcccCcCcCCCCCCccCCeeEEeccccccCCCCccccccCCCCCCCCCeeccC
Q 033928           40 KGG-KIKTDKPYGVNGGMDLREGLDASGRKAKGKGVYQFVDKYGANVDGYSPIYNENDWSPSGDVYTGV  107 (108)
Q Consensus        40 sgg-Kikt~kp~G~~ggm~~k~gvDasGRk~KgkgVYqf~~KyGANVDgYSPIY~p~eWs~~GD~Y~G~  107 (108)
                      |++ ||||++|+|++|+|++|+|+||+|||+||+|||||+||||||||||||||+||||||+||+|+|+
T Consensus         1 Sg~KKIkt~~p~G~~g~m~~k~gvDa~gRkgKg~gVYqf~~KyGANVDgYSPIY~p~~Ws~~GD~Y~gG   69 (99)
T PF04725_consen    1 SGGKKIKTDKPYGPSGGMTLKDGVDASGRKGKGKGVYQFVDKYGANVDGYSPIYTPDEWSPSGDVYVGG   69 (99)
T ss_pred             CCCccccccCCccCCCCccccCCccCCCCCCCCceeEEehhhcCccccccCCCcChhhcCCCCCeecCC
Confidence            455 99999999999999999999999999999999999999999999999999999999999999996


No 3  
>PLN00083 photosystem II subunit R; Provisional
Probab=99.97  E-value=2.7e-33  Score=200.48  Aligned_cols=71  Identities=34%  Similarity=0.565  Sum_probs=66.1

Q ss_pred             eecCceeeeccccccCCCcccCc----CcCCCCCCccCCeeEEeccccc-cCCCCccccccCCCCCCCCCeeccCC
Q 033928           38 VAKGGKIKTDKPYGVNGGMDLRE----GLDASGRKAKGKGVYQFVDKYG-ANVDGYSPIYNENDWSPSGDVYTGVL  108 (108)
Q Consensus        38 ~asggKikt~kp~G~~ggm~~k~----gvDasGRk~KgkgVYqf~~KyG-ANVDgYSPIY~p~eWs~~GD~Y~G~l  108 (108)
                      .+|.|+.+.+|.-+.+.++.+|+    |..++|||+||+|||||+|||| ||||||||||+||||+|+||+|+|+|
T Consensus         2 ~nssgpkrgtk~a~~q~~vgykgst~agsapkgRk~Kg~gVYqf~~KyGkANVDgYSPIY~p~eWs~sGD~Y~GgL   77 (101)
T PLN00083          2 ANSSGPKRGTKAAGGQAGVGYKGSTEAGSAPKTRSGKAGYVYKLGLRNGKANVDEYSPIYTPQEFKTDGDKYEGDL   77 (101)
T ss_pred             CCCCCCCCccccCccccccccccccccCCCCCCccCCCceEEEehhccCcccccccCCccChhhcCCCcchhhccH
Confidence            35677888889999999999998    8889999999999999999999 99999999999999999999999975


No 4  
>PF05430 Methyltransf_30:  S-adenosyl-L-methionine-dependent methyltransferase;  InterPro: IPR008471 This entry contains several uncharacterised bacterial proteins with no known function.; GO: 0016645 oxidoreductase activity, acting on the CH-NH group of donors, 0055114 oxidation-reduction process; PDB: 2E58_D 3SGL_A 3PVC_A 3AWI_D 3PS9_A 2QY6_A.
Probab=48.12  E-value=5.9  Score=28.36  Aligned_cols=15  Identities=47%  Similarity=0.915  Sum_probs=11.7

Q ss_pred             CCCccccccCCCCCC
Q 033928           85 VDGYSPIYNENDWSP   99 (108)
Q Consensus        85 VDgYSPIY~p~eWs~   99 (108)
                      -||+||-=+||-|++
T Consensus        56 lDgFsP~~nPelWs~   70 (124)
T PF05430_consen   56 LDGFSPAKNPELWSE   70 (124)
T ss_dssp             E-SS-TTTSGGGSSH
T ss_pred             ecCCCCcCCcccCCH
Confidence            389999999999986


No 5  
>PF08576 DUF1764:  Eukaryotic protein of unknown function (DUF1764);  InterPro: IPR013885  This entry consists of eukaryotic proteins of unknown function, including many hypothetical proteins. 
Probab=42.12  E-value=5.7  Score=27.33  Aligned_cols=13  Identities=46%  Similarity=0.928  Sum_probs=10.7

Q ss_pred             CCCccccccCCCCC
Q 033928           85 VDGYSPIYNENDWS   98 (108)
Q Consensus        85 VDgYSPIY~p~eWs   98 (108)
                      +||| |||+.||-.
T Consensus        70 eDGl-~IYt~eEL~   82 (102)
T PF08576_consen   70 EDGL-PIYTEEELG   82 (102)
T ss_pred             CCCc-eEecHHHhC
Confidence            6887 899998865


No 6  
>COG4121 Uncharacterized conserved protein [Function unknown]
Probab=34.85  E-value=11  Score=30.59  Aligned_cols=15  Identities=33%  Similarity=0.922  Sum_probs=13.7

Q ss_pred             CCCccccccCCCCCC
Q 033928           85 VDGYSPIYNENDWSP   99 (108)
Q Consensus        85 VDgYSPIY~p~eWs~   99 (108)
                      -||+||.-|||-|++
T Consensus       174 lDgFsP~kNP~mW~~  188 (252)
T COG4121         174 LDGFRPVKNPEMWED  188 (252)
T ss_pred             cCCccccCChhhccH
Confidence            499999999999986


No 7  
>COG5659 FOG: Transposase [DNA replication, recombination, and repair]
Probab=26.35  E-value=26  Score=30.64  Aligned_cols=42  Identities=40%  Similarity=0.801  Sum_probs=31.7

Q ss_pred             cCCCCCCccCC---eeE-Eec-------------cccccCCCCcccc----ccCCCCCCCCCe
Q 033928           62 LDASGRKAKGK---GVY-QFV-------------DKYGANVDGYSPI----YNENDWSPSGDV  103 (108)
Q Consensus        62 vDasGRk~Kgk---gVY-qf~-------------~KyGANVDgYSPI----Y~p~eWs~~GD~  103 (108)
                      +|.-|=..|||   ||+ |++             --|++|.+++-||    |-|++|-+.||.
T Consensus        98 idetg~~kkgk~s~~v~rqy~G~Lgkidn~~v~v~~~~~~~~~~~~i~~~~~kp~~~l~e~~k  160 (385)
T COG5659          98 IDETGFPKKGKHSDGVARQYIGNLGKIDNCQVAVSLYGITEGGTLPIASQLYKPEEWLDEGDK  160 (385)
T ss_pred             ccccCCCcccccccchhhhhhhhhhhhhhhHHHHHHhhhhcceeEeechhccCChhhccccch
Confidence            45566666777   676 333             3455889999999    999999999998


No 8  
>PF10417 1-cysPrx_C:  C-terminal domain of 1-Cys peroxiredoxin;  InterPro: IPR019479  This entry represents the C-terminal domain of 1-Cys peroxiredoxin, a member of the peroxiredoxin superfamily which protect cells against membrane oxidation through glutathione (GSH)-dependent reduction of phospholipid hydroperoxides to corresponding alcohols []. The C-terminal domain is crucial for providing the extra cysteine necessary for dimerisation of the whole molecule. Loss of the enzyme's peroxidase activity is associated with oxidation of the catalytic cysteine found upstream of this domain. Glutathionylation, presumably through its disruption of protein structure, facilitates access for GSH, resulting in spontaneous reduction of the mixed disulphide to the sulphydryl and consequent activation of the enzyme []. The domain is associated with IPR000866 from INTERPRO, which carries the catalytic cysteine. ; GO: 0051920 peroxiredoxin activity, 0055114 oxidation-reduction process; PDB: 1ZOF_E 2H01_A 3EMP_D 1YF1_G 1YF0_D 1N8J_C 1YEP_D 1YEX_D 2V41_H 2V32_C ....
Probab=21.07  E-value=27  Score=20.80  Aligned_cols=21  Identities=43%  Similarity=0.877  Sum_probs=14.8

Q ss_pred             EEeccccccCCCCccccccCCCCCCCCCe
Q 033928           75 YQFVDKYGANVDGYSPIYNENDWSPSGDV  103 (108)
Q Consensus        75 Yqf~~KyGANVDgYSPIY~p~eWs~~GD~  103 (108)
                      +||.||+|        +-+|..|.+.-++
T Consensus         2 LQ~~d~~~--------v~tPanW~pGd~~   22 (40)
T PF10417_consen    2 LQFTDKHG--------VATPANWKPGDDV   22 (40)
T ss_dssp             HHHHHHHS--------SBBCTTTCTTSGE
T ss_pred             ceehhhhC--------cccCcCCCCCCCe
Confidence            36777776        3589999886554


No 9  
>COG5007 Predicted transcriptional regulator, BolA superfamily [Transcription]
Probab=20.33  E-value=23  Score=25.05  Aligned_cols=9  Identities=22%  Similarity=0.929  Sum_probs=6.3

Q ss_pred             ccCCCCCCC
Q 033928           92 YNENDWSPS  100 (108)
Q Consensus        92 Y~p~eWs~~  100 (108)
                      |||+||.++
T Consensus        70 ~Tp~eW~~~   78 (80)
T COG5007          70 YTPAEWARD   78 (80)
T ss_pred             cCHHHhhhc
Confidence            777777653


No 10 
>PLN02289 ribulose-bisphosphate carboxylase small chain
Probab=17.50  E-value=88  Score=24.89  Aligned_cols=45  Identities=20%  Similarity=0.309  Sum_probs=0.0

Q ss_pred             CchhhccccccccCCccccccccccCCCCC-----ccc---eeEEeecCc-eee
Q 033928            1 MAASVMASSLSLKPAPFTVEKSAARGLPSL-----AKT---SFKIVAKGG-KIK   45 (108)
Q Consensus         1 MAasvm~ss~~lkps~~~~~~~~~~glp~l-----~R~---s~~v~asgg-Kik   45 (108)
                      ||++||+|+..-..+.-.---.+..||-+.     +|.   .+.-.++.| +++
T Consensus         1 Mas~~~~s~~~~~~~~qas~vapf~gLKs~~~fp~~~k~~~~~~~~~sng~rv~   54 (176)
T PLN02289          1 MASSMLSSAAVATSPAQATMVAPFTGLKSSAAFPVTRKANNDITSIASNGGRVS   54 (176)
T ss_pred             CcchhhhcccccccccccccccccccccccccCcceeeccccccccccCCceeE


Done!