Citrus Sinensis ID: 033932

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MAPKKDKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQATYDKLLSEAPKYKLITPSILSDRLRINGSLARKAIRELMARGLIRMVSAHASQQIYTRATNT
cccccccccccccccccccccccccccccccHHHHHHcccEEEcHHHHHHHHHcccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEccccccEEEEccccc
**********************************EKVNNMVLFDQATYDKLLSEAPKYKLITPSILSDRLRINGSLARKAIRELMARGLIRMVSAHASQQIYTRAT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPKKDKAPPPSSKPAKSGGGKQKKKKWSKGKQKEKVNNMVLFDQATYDKLLSEAPKYKLITPSILSDRLRINGSLARKAIRELMARGLIRMVSAHASQQIYTRATNT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S25-4 confidentQ9T029
40S ribosomal protein S25-3 confidentQ8GYL5
40S ribosomal protein S25-2 confidentQ9SIK2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZ6, chain V
Confidence level:very confident
Coverage over the Query: 37-108
View the alignment between query and template
View the model in PyMOL