BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 033936
(108 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1X18|X Chain X, Contact Sites Of Era Gtpase On The Thermus Thermophilus
30s Subunit
Length = 292
Score = 25.8 bits (55), Expect = 6.3, Method: Compositional matrix adjust.
Identities = 11/32 (34%), Positives = 19/32 (59%)
Query: 32 HFPSDLISIQDRKDEALQVLRSDLMATLNKEV 63
HFP D I+ + ++ A +++R LM L E+
Sbjct: 176 HFPEDYITDRSQRFMASEIIREKLMRFLGAEL 207
>pdb|1EGA|A Chain A, Crystal Structure Of A Widely Conserved Gtpase Era
pdb|1EGA|B Chain B, Crystal Structure Of A Widely Conserved Gtpase Era
pdb|1X1L|X Chain X, Interaction Of Era,A Gtpase Protein, With The 3'minor
Domain Of The 16s Rrna Within The Thermus Thermophilus
30s Subunit.
pdb|3IEU|A Chain A, Crystal Structure Of Era In Complex With Gdp
pdb|3IEU|B Chain B, Crystal Structure Of Era In Complex With Gdp
Length = 301
Score = 25.8 bits (55), Expect = 6.4, Method: Compositional matrix adjust.
Identities = 11/32 (34%), Positives = 19/32 (59%)
Query: 32 HFPSDLISIQDRKDEALQVLRSDLMATLNKEV 63
HFP D I+ + ++ A +++R LM L E+
Sbjct: 179 HFPEDYITDRSQRFMASEIIREKLMRFLGAEL 210
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.309 0.125 0.346
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,979,899
Number of Sequences: 62578
Number of extensions: 99799
Number of successful extensions: 191
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 189
Number of HSP's gapped (non-prelim): 3
length of query: 108
length of database: 14,973,337
effective HSP length: 72
effective length of query: 36
effective length of database: 10,467,721
effective search space: 376837956
effective search space used: 376837956
T: 11
A: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 45 (21.9 bits)