Citrus Sinensis ID: 033940
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 108 | ||||||
| 15241111 | 323 | cysteine synthase D2 [Arabidopsis thalia | 0.638 | 0.213 | 0.898 | 8e-30 | |
| 222424429 | 323 | AT5G28020 [Arabidopsis thaliana] | 0.638 | 0.213 | 0.884 | 1e-29 | |
| 2245144 | 345 | O-acetylserine(thiol) lyase [Brassica ju | 0.638 | 0.2 | 0.884 | 1e-29 | |
| 359487913 | 156 | PREDICTED: cysteine synthase-like [Vitis | 0.638 | 0.442 | 0.884 | 2e-29 | |
| 359487838 | 323 | PREDICTED: cysteine synthase-like [Vitis | 0.638 | 0.213 | 0.884 | 2e-29 | |
| 224130744 | 323 | predicted protein [Populus trichocarpa] | 0.638 | 0.213 | 0.898 | 2e-29 | |
| 21553635 | 323 | cysteine synthase [Arabidopsis thaliana] | 0.638 | 0.213 | 0.884 | 3e-29 | |
| 359487834 | 323 | PREDICTED: cysteine synthase-like [Vitis | 0.638 | 0.213 | 0.884 | 3e-29 | |
| 147835129 | 323 | hypothetical protein VITISV_031201 [Viti | 0.638 | 0.213 | 0.884 | 3e-29 | |
| 298204918 | 128 | unnamed protein product [Vitis vinifera] | 0.638 | 0.539 | 0.884 | 4e-29 |
| >gi|15241111|ref|NP_198154.1| cysteine synthase D2 [Arabidopsis thaliana] gi|30690901|ref|NP_851087.1| cysteine synthase D2 [Arabidopsis thaliana] gi|79328865|ref|NP_001031956.1| cysteine synthase D2 [Arabidopsis thaliana] gi|79328884|ref|NP_001031957.1| cysteine synthase D2 [Arabidopsis thaliana] gi|145334565|ref|NP_001078628.1| cysteine synthase D2 [Arabidopsis thaliana] gi|15983448|gb|AAL11592.1|AF424598_1 AT5g28020/F15F15_90 [Arabidopsis thaliana] gi|4996618|dbj|BAA78561.1| cysteine synthase [Arabidopsis thaliana] gi|21700833|gb|AAM70540.1| AT5g28020/F15F15_90 [Arabidopsis thaliana] gi|332006376|gb|AED93759.1| cysteine synthase D2 [Arabidopsis thaliana] gi|332006377|gb|AED93760.1| cysteine synthase D2 [Arabidopsis thaliana] gi|332006378|gb|AED93761.1| cysteine synthase D2 [Arabidopsis thaliana] gi|332006379|gb|AED93762.1| cysteine synthase D2 [Arabidopsis thaliana] gi|332006381|gb|AED93764.1| cysteine synthase D2 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Score = 134 bits (337), Expect = 8e-30, Method: Compositional matrix adjust.
Identities = 62/69 (89%), Positives = 66/69 (95%)
Query: 1 MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAE 60
MED+C IK D+TELIG+TPMVYLNNVVDGCVA IAAKLEMM+PCSSVKDRIAYSMIKDAE
Sbjct: 1 MEDRCLIKNDITELIGNTPMVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAE 60
Query: 61 DKGLITPGK 69
DKGLITPGK
Sbjct: 61 DKGLITPGK 69
|
Source: Arabidopsis thaliana Species: Arabidopsis thaliana Genus: Arabidopsis Family: Brassicaceae Order: Brassicales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|222424429|dbj|BAH20170.1| AT5G28020 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|2245144|emb|CAA71799.1| O-acetylserine(thiol) lyase [Brassica juncea] | Back alignment and taxonomy information |
|---|
| >gi|359487913|ref|XP_003633675.1| PREDICTED: cysteine synthase-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359487838|ref|XP_003633660.1| PREDICTED: cysteine synthase-like [Vitis vinifera] gi|298204917|emb|CBI34224.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|224130744|ref|XP_002328365.1| predicted protein [Populus trichocarpa] gi|222838080|gb|EEE76445.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|21553635|gb|AAM62728.1| cysteine synthase [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|359487834|ref|XP_003633659.1| PREDICTED: cysteine synthase-like [Vitis vinifera] gi|298204916|emb|CBI34223.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147835129|emb|CAN76754.1| hypothetical protein VITISV_031201 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|298204918|emb|CBI34225.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 108 | ||||||
| TAIR|locus:2143814 | 323 | CYSD2 "cysteine synthase D2" [ | 0.638 | 0.213 | 0.898 | 2.1e-29 | |
| TAIR|locus:2143754 | 323 | DES1 "L-cysteine desulfhydrase | 0.638 | 0.213 | 0.855 | 1.3e-27 | |
| TAIR|locus:2114804 | 324 | CYSD1 "cysteine synthase D1" [ | 0.629 | 0.209 | 0.838 | 1.7e-27 | |
| TAIR|locus:2130419 | 322 | OASA1 "O-acetylserine (thiol) | 0.583 | 0.195 | 0.761 | 5.5e-22 | |
| TAIR|locus:2043964 | 392 | OASB "O-acetylserine (thiol) l | 0.583 | 0.160 | 0.746 | 1.4e-20 | |
| TAIR|locus:2080417 | 433 | OASC "O-acetylserine (thiol) l | 0.620 | 0.154 | 0.656 | 3.2e-19 | |
| TAIR|locus:2096454 | 404 | CS26 "cysteine synthase 26" [A | 0.583 | 0.155 | 0.698 | 4.1e-18 | |
| UNIPROTKB|Q76MX2 | 351 | PCAS-1 "Bifunctional L-3-cyano | 0.583 | 0.179 | 0.682 | 7.4e-18 | |
| UNIPROTKB|Q1KLZ2 | 376 | CAS1 "L-3-cyanoalanine synthas | 0.592 | 0.170 | 0.640 | 5.2e-17 | |
| UNIPROTKB|Q1KLZ1 | 375 | CAS2 "L-3-cyanoalanine synthas | 0.592 | 0.170 | 0.640 | 1.1e-16 |
| TAIR|locus:2143814 CYSD2 "cysteine synthase D2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 326 (119.8 bits), Expect = 2.1e-29, P = 2.1e-29
Identities = 62/69 (89%), Positives = 66/69 (95%)
Query: 1 MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAE 60
MED+C IK D+TELIG+TPMVYLNNVVDGCVA IAAKLEMM+PCSSVKDRIAYSMIKDAE
Sbjct: 1 MEDRCLIKNDITELIGNTPMVYLNNVVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAE 60
Query: 61 DKGLITPGK 69
DKGLITPGK
Sbjct: 61 DKGLITPGK 69
|
|
| TAIR|locus:2143754 DES1 "L-cysteine desulfhydrase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2114804 CYSD1 "cysteine synthase D1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2130419 OASA1 "O-acetylserine (thiol) lyase (OAS-TL) isoform A1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043964 OASB "O-acetylserine (thiol) lyase B" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2080417 OASC "O-acetylserine (thiol) lyase isoform C" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2096454 CS26 "cysteine synthase 26" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q76MX2 PCAS-1 "Bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial" [Solanum tuberosum (taxid:4113)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1KLZ2 CAS1 "L-3-cyanoalanine synthase 1, mitochondrial" [Malus x domestica (taxid:3750)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q1KLZ1 CAS2 "L-3-cyanoalanine synthase 2, mitochondrial" [Malus x domestica (taxid:3750)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| CYSD2 | CYSD2 (CYSTEINE SYNTHASE D2); catalytic/ cysteine synthase/ pyridoxal phosphate binding; Encodes cysteine synthase CysD2. (323 aa) | ||||||||||
(Arabidopsis thaliana) | |||||||||||
| ATSERAT1;1 | • | • | • | • | 0.998 | ||||||
| ATSERAT2;1 | • | • | • | 0.990 | |||||||
| ATSERAT2;2 | • | • | • | 0.972 | |||||||
| SIR | • | • | • | • | 0.971 | ||||||
| CBL | • | • | • | 0.963 | |||||||
| ATSERAT3;1 | • | • | • | 0.958 | |||||||
| ATSERAT3;2 | • | • | • | 0.935 | |||||||
| AT1G55880 | • | • | • | • | 0.916 | ||||||
| CYSC1 | • | • | • | • | 0.907 | ||||||
| OASC | • | • | • | • | 0.905 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 108 | |||
| PLN00011 | 323 | PLN00011, PLN00011, cysteine synthase | 3e-43 | |
| PLN02565 | 322 | PLN02565, PLN02565, cysteine synthase | 6e-39 | |
| PLN02556 | 368 | PLN02556, PLN02556, cysteine synthase/L-3-cyanoala | 8e-27 | |
| TIGR01136 | 299 | TIGR01136, cysKM, cysteine synthase | 2e-26 | |
| PLN03013 | 429 | PLN03013, PLN03013, cysteine synthase | 4e-26 | |
| COG0031 | 300 | COG0031, CysK, Cysteine synthase [Amino acid trans | 1e-24 | |
| TIGR01139 | 298 | TIGR01139, cysK, cysteine synthase A | 3e-24 | |
| cd01561 | 291 | cd01561, CBS_like, CBS_like: This subgroup include | 2e-21 | |
| PRK10717 | 330 | PRK10717, PRK10717, cysteine synthase A; Provision | 3e-17 | |
| TIGR03945 | 304 | TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate bio | 3e-16 | |
| TIGR01137 | 454 | TIGR01137, cysta_beta, cystathionine beta-synthase | 5e-16 | |
| PRK11761 | 296 | PRK11761, cysM, cysteine synthase B; Provisional | 8e-15 | |
| TIGR01138 | 290 | TIGR01138, cysM, cysteine synthase B | 2e-11 | |
| cd00640 | 244 | cd00640, Trp-synth-beta_II, Tryptophan synthase be | 2e-11 | |
| pfam00291 | 295 | pfam00291, PALP, Pyridoxal-phosphate dependent enz | 7e-10 | |
| PLN02356 | 423 | PLN02356, PLN02356, phosphateglycerate kinase | 6e-08 |
| >gnl|CDD|177651 PLN00011, PLN00011, cysteine synthase | Back alignment and domain information |
|---|
Score = 142 bits (360), Expect = 3e-43
Identities = 62/69 (89%), Positives = 66/69 (95%)
Query: 1 MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAE 60
MED+C IK DVTELIG+TPMVYLNN+VDGCVA IAAKLEMM+PCSSVKDRIAYSMIKDAE
Sbjct: 1 MEDRCLIKNDVTELIGNTPMVYLNNIVDGCVARIAAKLEMMEPCSSVKDRIAYSMIKDAE 60
Query: 61 DKGLITPGK 69
DKGLITPGK
Sbjct: 61 DKGLITPGK 69
|
Length = 323 |
| >gnl|CDD|166206 PLN02565, PLN02565, cysteine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|178171 PLN02556, PLN02556, cysteine synthase/L-3-cyanoalanine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|233286 TIGR01136, cysKM, cysteine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|178587 PLN03013, PLN03013, cysteine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|223110 COG0031, CysK, Cysteine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233288 TIGR01139, cysK, cysteine synthase A | Back alignment and domain information |
|---|
| >gnl|CDD|107204 cd01561, CBS_like, CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase | Back alignment and domain information |
|---|
| >gnl|CDD|182672 PRK10717, PRK10717, cysteine synthase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234409 TIGR03945, PLP_SbnA_fam, 2,3-diaminopropionate biosynthesis protein SbnA | Back alignment and domain information |
|---|
| >gnl|CDD|233287 TIGR01137, cysta_beta, cystathionine beta-synthase | Back alignment and domain information |
|---|
| >gnl|CDD|236972 PRK11761, cysM, cysteine synthase B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130208 TIGR01138, cysM, cysteine synthase B | Back alignment and domain information |
|---|
| >gnl|CDD|107202 cd00640, Trp-synth-beta_II, Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions | Back alignment and domain information |
|---|
| >gnl|CDD|215840 pfam00291, PALP, Pyridoxal-phosphate dependent enzyme | Back alignment and domain information |
|---|
| >gnl|CDD|215204 PLN02356, PLN02356, phosphateglycerate kinase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| COG0031 | 300 | CysK Cysteine synthase [Amino acid transport and m | 99.97 | |
| PRK11761 | 296 | cysM cysteine synthase B; Provisional | 99.96 | |
| PLN02565 | 322 | cysteine synthase | 99.96 | |
| PLN00011 | 323 | cysteine synthase | 99.96 | |
| PLN03013 | 429 | cysteine synthase | 99.96 | |
| PLN02356 | 423 | phosphateglycerate kinase | 99.96 | |
| PRK10717 | 330 | cysteine synthase A; Provisional | 99.96 | |
| TIGR01138 | 290 | cysM cysteine synthase B. Alternate name: O-acetyl | 99.95 | |
| PLN02556 | 368 | cysteine synthase/L-3-cyanoalanine synthase | 99.95 | |
| TIGR01136 | 299 | cysKM cysteine synthases. This model discriminates | 99.95 | |
| PRK06110 | 322 | hypothetical protein; Provisional | 99.95 | |
| TIGR01139 | 298 | cysK cysteine synthase A. This model distinguishes | 99.95 | |
| TIGR01137 | 454 | cysta_beta cystathionine beta-synthase. Members of | 99.95 | |
| PRK07476 | 322 | eutB threonine dehydratase; Provisional | 99.95 | |
| PRK06608 | 338 | threonine dehydratase; Provisional | 99.95 | |
| PLN02970 | 328 | serine racemase | 99.95 | |
| cd06447 | 404 | D-Ser-dehyd D-Serine dehydratase is a pyridoxal ph | 99.94 | |
| KOG1252 | 362 | consensus Cystathionine beta-synthase and related | 99.94 | |
| PRK06382 | 406 | threonine dehydratase; Provisional | 99.94 | |
| PRK08526 | 403 | threonine dehydratase; Provisional | 99.94 | |
| PRK08198 | 404 | threonine dehydratase; Provisional | 99.94 | |
| PRK07048 | 321 | serine/threonine dehydratase; Validated | 99.94 | |
| PRK08246 | 310 | threonine dehydratase; Provisional | 99.94 | |
| PRK08638 | 333 | threonine dehydratase; Validated | 99.94 | |
| PRK08639 | 420 | threonine dehydratase; Validated | 99.94 | |
| COG1171 | 347 | IlvA Threonine dehydratase [Amino acid transport a | 99.94 | |
| TIGR02991 | 317 | ectoine_eutB ectoine utilization protein EutB. Mem | 99.94 | |
| PRK08813 | 349 | threonine dehydratase; Provisional | 99.94 | |
| PRK02991 | 441 | D-serine dehydratase; Provisional | 99.93 | |
| TIGR02079 | 409 | THD1 threonine dehydratase. This model represents | 99.93 | |
| PRK07334 | 403 | threonine dehydratase; Provisional | 99.93 | |
| cd01562 | 304 | Thr-dehyd Threonine dehydratase: The first step in | 99.93 | |
| PRK06815 | 317 | hypothetical protein; Provisional | 99.93 | |
| TIGR02035 | 431 | D_Ser_am_lyase D-serine ammonia-lyase. This family | 99.93 | |
| PRK12483 | 521 | threonine dehydratase; Reviewed | 99.93 | |
| cd01561 | 291 | CBS_like CBS_like: This subgroup includes Cystathi | 99.93 | |
| PRK06381 | 319 | threonine synthase; Validated | 99.93 | |
| PLN02550 | 591 | threonine dehydratase | 99.92 | |
| PRK07409 | 353 | threonine synthase; Validated | 99.92 | |
| KOG1481 | 391 | consensus Cysteine synthase [Amino acid transport | 99.92 | |
| PRK06352 | 351 | threonine synthase; Validated | 99.92 | |
| TIGR01127 | 380 | ilvA_1Cterm threonine dehydratase, medium form. A | 99.92 | |
| PRK06721 | 352 | threonine synthase; Reviewed | 99.92 | |
| cd01563 | 324 | Thr-synth_1 Threonine synthase is a pyridoxal phos | 99.92 | |
| cd06448 | 316 | L-Ser-dehyd Serine dehydratase is a pyridoxal phos | 99.91 | |
| KOG1251 | 323 | consensus Serine racemase [Signal transduction mec | 99.91 | |
| TIGR01124 | 499 | ilvA_2Cterm threonine ammonia-lyase, biosynthetic, | 99.91 | |
| PRK06450 | 338 | threonine synthase; Validated | 99.91 | |
| PRK08197 | 394 | threonine synthase; Validated | 99.91 | |
| PRK09224 | 504 | threonine dehydratase; Reviewed | 99.91 | |
| PRK07591 | 421 | threonine synthase; Validated | 99.91 | |
| PRK05638 | 442 | threonine synthase; Validated | 99.91 | |
| PRK06260 | 397 | threonine synthase; Validated | 99.9 | |
| TIGR00260 | 328 | thrC threonine synthase. Involved in threonine bio | 99.9 | |
| PRK08206 | 399 | diaminopropionate ammonia-lyase; Provisional | 99.89 | |
| PLN02569 | 484 | threonine synthase | 99.89 | |
| PF00291 | 306 | PALP: Pyridoxal-phosphate dependent enzyme; InterP | 99.89 | |
| PRK08329 | 347 | threonine synthase; Validated | 99.89 | |
| cd00640 | 244 | Trp-synth-beta_II Tryptophan synthase beta superfa | 99.89 | |
| TIGR01415 | 419 | trpB_rel pyridoxal-phosphate dependent TrpB-like e | 99.88 | |
| KOG1250 | 457 | consensus Threonine/serine dehydratases [Amino aci | 99.87 | |
| PRK12391 | 427 | tryptophan synthase subunit beta; Reviewed | 99.87 | |
| TIGR00263 | 385 | trpB tryptophan synthase, beta subunit. Tryptophan | 99.87 | |
| TIGR03528 | 396 | 2_3_DAP_am_ly diaminopropionate ammonia-lyase. Mem | 99.87 | |
| TIGR01747 | 376 | diampropi_NH3ly diaminopropionate ammonia-lyase fa | 99.87 | |
| PRK04346 | 397 | tryptophan synthase subunit beta; Validated | 99.86 | |
| PRK13028 | 402 | tryptophan synthase subunit beta; Provisional | 99.86 | |
| PLN02618 | 410 | tryptophan synthase, beta chain | 99.86 | |
| cd06446 | 365 | Trp-synth_B Tryptophan synthase-beta: Trptophan sy | 99.86 | |
| TIGR03844 | 398 | cysteate_syn cysteate synthase. Members of this fa | 99.86 | |
| PRK13802 | 695 | bifunctional indole-3-glycerol phosphate synthase/ | 99.85 | |
| PRK03910 | 331 | D-cysteine desulfhydrase; Validated | 99.83 | |
| TIGR01275 | 311 | ACC_deam_rel pyridoxal phosphate-dependent enzymes | 99.83 | |
| PRK14045 | 329 | 1-aminocyclopropane-1-carboxylate deaminase; Provi | 99.82 | |
| PRK13803 | 610 | bifunctional phosphoribosylanthranilate isomerase/ | 99.82 | |
| TIGR01274 | 337 | ACC_deam 1-aminocyclopropane-1-carboxylate deamina | 99.8 | |
| PRK12390 | 337 | 1-aminocyclopropane-1-carboxylate deaminase; Provi | 99.79 | |
| cd06449 | 307 | ACCD Aminocyclopropane-1-carboxylate deaminase (AC | 99.79 | |
| COG0498 | 411 | ThrC Threonine synthase [Amino acid transport and | 99.7 | |
| KOG1395 | 477 | consensus Tryptophan synthase beta chain [Amino ac | 99.42 | |
| COG1350 | 432 | Predicted alternative tryptophan synthase beta-sub | 99.36 | |
| COG0133 | 396 | TrpB Tryptophan synthase beta chain [Amino acid tr | 99.3 | |
| cd01560 | 460 | Thr-synth_2 Threonine synthase catalyzes the final | 99.26 | |
| PRK09225 | 462 | threonine synthase; Validated | 99.17 | |
| COG3048 | 443 | DsdA D-serine dehydratase [Amino acid transport an | 98.05 | |
| COG2515 | 323 | Acd 1-aminocyclopropane-1-carboxylate deaminase [A | 97.36 |
| >COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.97 E-value=2.1e-30 Score=198.03 Aligned_cols=98 Identities=38% Similarity=0.562 Sum_probs=93.1
Q ss_pred HHHHhcccCCCceeEccCccCCCCceEEEEeCCCCCCcchhhHHHHHHHHHHHHcCCCCCCeEe----cchHHHHH-HH-
Q 033940 8 KKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKVF----NGNSPILK-LI- 81 (108)
Q Consensus 8 ~~~i~~~v~~TPLv~~~~l~~~~~~~i~~KlE~~nptGS~K~R~a~~~l~~a~~~g~~~~g~~v----sGN~g~al-~~- 81 (108)
++++.+.+|+|||+++.++....+++||+|+|++||+||.|||.|++||..|+++|.++||.+| |||+|+|| ++
T Consensus 2 ~~~~~~~iG~TPlvrL~~~~~~~~~~i~~KlE~~NP~gSvKDR~A~~mI~~Ae~~G~l~pG~tIVE~TSGNTGI~LA~va 81 (300)
T COG0031 2 YESILDLIGNTPLVRLNRLSPGTGVEIYAKLESFNPGGSVKDRIALYMIEDAEKRGLLKPGGTIVEATSGNTGIALAMVA 81 (300)
T ss_pred ccchHHHhCCCCcEeecccCCCCCceEEEEhhhcCCCCchhHHHHHHHHHHHHHcCCCCCCCEEEEcCCChHHHHHHHHH
Confidence 4678899999999999999877789999999999999999999999999999999999999987 99999999 99
Q ss_pred HHcCCcEEEEecCCCCHHHHhhcc
Q 033940 82 NHKNYAMNSVFLFSVNVNNFNQAH 105 (108)
Q Consensus 82 ~~~G~~~~ivvp~~~~~~k~~~~~ 105 (108)
+.+|+++++|||+++|++|+++|+
T Consensus 82 a~~Gy~~iivmP~~~S~er~~~l~ 105 (300)
T COG0031 82 AAKGYRLIIVMPETMSQERRKLLR 105 (300)
T ss_pred HHcCCcEEEEeCCCCCHHHHHHHH
Confidence 999999999999999999999886
|
|
| >PRK11761 cysM cysteine synthase B; Provisional | Back alignment and domain information |
|---|
| >PLN02565 cysteine synthase | Back alignment and domain information |
|---|
| >PLN00011 cysteine synthase | Back alignment and domain information |
|---|
| >PLN03013 cysteine synthase | Back alignment and domain information |
|---|
| >PLN02356 phosphateglycerate kinase | Back alignment and domain information |
|---|
| >PRK10717 cysteine synthase A; Provisional | Back alignment and domain information |
|---|
| >TIGR01138 cysM cysteine synthase B | Back alignment and domain information |
|---|
| >PLN02556 cysteine synthase/L-3-cyanoalanine synthase | Back alignment and domain information |
|---|
| >TIGR01136 cysKM cysteine synthases | Back alignment and domain information |
|---|
| >PRK06110 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01139 cysK cysteine synthase A | Back alignment and domain information |
|---|
| >TIGR01137 cysta_beta cystathionine beta-synthase | Back alignment and domain information |
|---|
| >PRK07476 eutB threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK06608 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PLN02970 serine racemase | Back alignment and domain information |
|---|
| >cd06447 D-Ser-dehyd D-Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- or D-serine to pyruvate and ammonia | Back alignment and domain information |
|---|
| >KOG1252 consensus Cystathionine beta-synthase and related enzymes [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06382 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08526 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08198 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK07048 serine/threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK08246 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK08638 threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >PRK08639 threonine dehydratase; Validated | Back alignment and domain information |
|---|
| >COG1171 IlvA Threonine dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02991 ectoine_eutB ectoine utilization protein EutB | Back alignment and domain information |
|---|
| >PRK08813 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >PRK02991 D-serine dehydratase; Provisional | Back alignment and domain information |
|---|
| >TIGR02079 THD1 threonine dehydratase | Back alignment and domain information |
|---|
| >PRK07334 threonine dehydratase; Provisional | Back alignment and domain information |
|---|
| >cd01562 Thr-dehyd Threonine dehydratase: The first step in amino acid degradation is the removal of nitrogen | Back alignment and domain information |
|---|
| >PRK06815 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02035 D_Ser_am_lyase D-serine ammonia-lyase | Back alignment and domain information |
|---|
| >PRK12483 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >cd01561 CBS_like CBS_like: This subgroup includes Cystathionine beta-synthase (CBS) and Cysteine synthase | Back alignment and domain information |
|---|
| >PRK06381 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PLN02550 threonine dehydratase | Back alignment and domain information |
|---|
| >PRK07409 threonine synthase; Validated | Back alignment and domain information |
|---|
| >KOG1481 consensus Cysteine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06352 threonine synthase; Validated | Back alignment and domain information |
|---|
| >TIGR01127 ilvA_1Cterm threonine dehydratase, medium form | Back alignment and domain information |
|---|
| >PRK06721 threonine synthase; Reviewed | Back alignment and domain information |
|---|
| >cd01563 Thr-synth_1 Threonine synthase is a pyridoxal phosphate (PLP) dependent enzyme that catalyses the last reaction in the synthesis of threonine from aspartate | Back alignment and domain information |
|---|
| >cd06448 L-Ser-dehyd Serine dehydratase is a pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of L- , D-serine, or L-threonine to pyruvate/ketobutyrate and ammonia | Back alignment and domain information |
|---|
| >KOG1251 consensus Serine racemase [Signal transduction mechanisms; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01124 ilvA_2Cterm threonine ammonia-lyase, biosynthetic, long form | Back alignment and domain information |
|---|
| >PRK06450 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK08197 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK09224 threonine dehydratase; Reviewed | Back alignment and domain information |
|---|
| >PRK07591 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK05638 threonine synthase; Validated | Back alignment and domain information |
|---|
| >PRK06260 threonine synthase; Validated | Back alignment and domain information |
|---|
| >TIGR00260 thrC threonine synthase | Back alignment and domain information |
|---|
| >PRK08206 diaminopropionate ammonia-lyase; Provisional | Back alignment and domain information |
|---|
| >PLN02569 threonine synthase | Back alignment and domain information |
|---|
| >PF00291 PALP: Pyridoxal-phosphate dependent enzyme; InterPro: IPR001926 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) | Back alignment and domain information |
|---|
| >PRK08329 threonine synthase; Validated | Back alignment and domain information |
|---|
| >cd00640 Trp-synth-beta_II Tryptophan synthase beta superfamily (fold type II); this family of pyridoxal phosphate (PLP)-dependent enzymes catalyzes beta-replacement and beta-elimination reactions | Back alignment and domain information |
|---|
| >TIGR01415 trpB_rel pyridoxal-phosphate dependent TrpB-like enzyme | Back alignment and domain information |
|---|
| >KOG1250 consensus Threonine/serine dehydratases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12391 tryptophan synthase subunit beta; Reviewed | Back alignment and domain information |
|---|
| >TIGR00263 trpB tryptophan synthase, beta subunit | Back alignment and domain information |
|---|
| >TIGR03528 2_3_DAP_am_ly diaminopropionate ammonia-lyase | Back alignment and domain information |
|---|
| >TIGR01747 diampropi_NH3ly diaminopropionate ammonia-lyase family | Back alignment and domain information |
|---|
| >PRK04346 tryptophan synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK13028 tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PLN02618 tryptophan synthase, beta chain | Back alignment and domain information |
|---|
| >cd06446 Trp-synth_B Tryptophan synthase-beta: Trptophan synthase is a bifunctional enzyme that catalyses the last two steps in the biosynthesis of L-tryptophan via its alpha and beta reactions | Back alignment and domain information |
|---|
| >TIGR03844 cysteate_syn cysteate synthase | Back alignment and domain information |
|---|
| >PRK13802 bifunctional indole-3-glycerol phosphate synthase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK03910 D-cysteine desulfhydrase; Validated | Back alignment and domain information |
|---|
| >TIGR01275 ACC_deam_rel pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family | Back alignment and domain information |
|---|
| >PRK14045 1-aminocyclopropane-1-carboxylate deaminase; Provisional | Back alignment and domain information |
|---|
| >PRK13803 bifunctional phosphoribosylanthranilate isomerase/tryptophan synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR01274 ACC_deam 1-aminocyclopropane-1-carboxylate deaminase | Back alignment and domain information |
|---|
| >PRK12390 1-aminocyclopropane-1-carboxylate deaminase; Provisional | Back alignment and domain information |
|---|
| >cd06449 ACCD Aminocyclopropane-1-carboxylate deaminase (ACCD): Pyridoxal phosphate (PLP)-dependent enzyme which catalyzes the conversion of 1-aminocyclopropane-L-carboxylate (ACC), a precursor of the plant hormone ethylene, to alpha-ketobutyrate and ammonia | Back alignment and domain information |
|---|
| >COG0498 ThrC Threonine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1395 consensus Tryptophan synthase beta chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG1350 Predicted alternative tryptophan synthase beta-subunit (paralog of TrpB) [General function prediction only] | Back alignment and domain information |
|---|
| >COG0133 TrpB Tryptophan synthase beta chain [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd01560 Thr-synth_2 Threonine synthase catalyzes the final step of threonine biosynthesis | Back alignment and domain information |
|---|
| >PRK09225 threonine synthase; Validated | Back alignment and domain information |
|---|
| >COG3048 DsdA D-serine dehydratase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2515 Acd 1-aminocyclopropane-1-carboxylate deaminase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 108 | ||||
| 2isq_A | 320 | Crystal Structure Of O-Acetylserine Sulfhydrylase F | 9e-25 | ||
| 1z7w_A | 322 | Crystal Structure Of O-Acetylserine Sulfhydrylase F | 9e-25 | ||
| 1z7y_A | 322 | Crystal Structure Of The Arabidopsis Thaliana O-Ace | 4e-24 | ||
| 4aec_A | 430 | Crystal Structure Of The Arabidopsis Thaliana O-Ace | 4e-22 | ||
| 3vbe_A | 344 | Crystal Structure Of Beta-Cyanoalanine Synthase In | 2e-20 | ||
| 3vc3_A | 344 | Crystal Structure Of Beta-Cyanoalanine Synthase K95 | 1e-19 | ||
| 2q3d_A | 313 | 2.2 A Resolution Crystal Structure Of O-acetylserin | 1e-14 | ||
| 2q3b_A | 313 | 1.8 A Resolution Crystal Structure Of O-Acetylserin | 5e-14 | ||
| 3rr2_A | 314 | Structure Of A Cysteine Synthase (O-Acetylserine Su | 1e-12 | ||
| 4i1y_A | 314 | The Structure Of Cysteine Synthase From Mycobacteri | 5e-12 | ||
| 3pc2_A | 527 | Full Length Structure Of Cystathionine Beta-Synthas | 1e-11 | ||
| 2egu_A | 308 | Crystal Structure Of O-Acetylserine Sulfhydrase Fro | 1e-11 | ||
| 1ve1_A | 304 | Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfh | 3e-10 | ||
| 1oas_A | 322 | O-Acetylserine Sulfhydrylase From Salmonella Typhim | 1e-08 | ||
| 1d6s_A | 322 | Crystal Structure Of The K41a Mutant Of O-Acetylser | 5e-08 | ||
| 2jc3_A | 303 | Structure Of O-acetylserine Sulfhydrylase B From Sa | 1e-07 | ||
| 4air_A | 354 | Leishmania Major Cysteine Synthase Length = 354 | 4e-07 | ||
| 2bhs_A | 303 | Crystal Structure Of Cysteine Synthase B Length = 3 | 4e-07 | ||
| 2bht_A | 303 | Crystal Structure Of O-Acetylserine Sulfhydrylase B | 1e-06 | ||
| 1jbq_A | 435 | Structure Of Human Cystathionine Beta-Synthase: A U | 1e-06 | ||
| 1m54_A | 363 | Cystathionine-Beta Synthase: Reduced Vicinal Thiols | 1e-06 | ||
| 3t4p_A | 334 | Crystal Structure Of O-Acetyl Serine Sulfhydrylase | 2e-06 | ||
| 2v03_A | 303 | High Resolution Structure And Catalysis Of An O- Ac | 2e-06 | ||
| 3dwi_A | 323 | Crystal Structure Of Mycobacterium Tuberculosis Cys | 1e-05 | ||
| 3fca_A | 291 | Genetic Incorporation Of A Metal-Ion Chelating Amin | 2e-05 | ||
| 1o58_A | 303 | Crystal Structure Of O-Acetylserine Sulfhydrylase ( | 2e-05 | ||
| 3dwg_A | 325 | Crystal Structure Of A Sulfur Carrier Protein Compl | 3e-05 | ||
| 3bm5_A | 338 | Crystal Structure Of O-Acetyl-Serine Sulfhydrylase | 5e-05 | ||
| 2pqm_A | 343 | Crystal Structure Of Cysteine Synthase (Oass) From | 6e-05 | ||
| 3dki_A | 326 | 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobac | 2e-04 |
| >pdb|2ISQ|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana In Complex With C-Terminal Peptide From Arabidopsis Serine Acetyltransferase Length = 320 | Back alignment and structure |
|
| >pdb|1Z7W|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase From Arabidopsis Thaliana Length = 322 | Back alignment and structure |
| >pdb|1Z7Y|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetylserine Sulfhydrylase K46a Mutant Length = 322 | Back alignment and structure |
| >pdb|4AEC|A Chain A, Crystal Structure Of The Arabidopsis Thaliana O-Acetyl- Serine-(Thiol)-Lyase C Length = 430 | Back alignment and structure |
| >pdb|3VBE|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase In Soybean Length = 344 | Back alignment and structure |
| >pdb|3VC3|A Chain A, Crystal Structure Of Beta-Cyanoalanine Synthase K95a Mutant In Soybean Length = 344 | Back alignment and structure |
| >pdb|2Q3D|A Chain A, 2.2 A Resolution Crystal Structure Of O-acetylserine Sulfhydrylase (oass) From Mycobacterium Tuberculosis In Complex With The Reaction Intermediate Alpha-aminoacrylate Length = 313 | Back alignment and structure |
| >pdb|2Q3B|A Chain A, 1.8 A Resolution Crystal Structure Of O-Acetylserine Sulfhydrylase (Oass) Holoenzyme From Mycobacterium Tuberculosis Length = 313 | Back alignment and structure |
| >pdb|3RR2|A Chain A, Structure Of A Cysteine Synthase (O-Acetylserine Sulfhydrylase (Oass)) From Mycobacterium Marinum Atcc Baa-535 M Length = 314 | Back alignment and structure |
| >pdb|4I1Y|A Chain A, The Structure Of Cysteine Synthase From Mycobacterium Ulcerans Agy99 Length = 314 | Back alignment and structure |
| >pdb|3PC2|A Chain A, Full Length Structure Of Cystathionine Beta-Synthase From Drosophila Length = 527 | Back alignment and structure |
| >pdb|2EGU|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrase From Geobacillus Kaustophilus Hta426 Length = 308 | Back alignment and structure |
| >pdb|1VE1|A Chain A, Crystal Structure Of T.Th. Hb8 O-Acetylserine Sulfhydrylase Length = 304 | Back alignment and structure |
| >pdb|1OAS|A Chain A, O-Acetylserine Sulfhydrylase From Salmonella Typhimurium Length = 322 | Back alignment and structure |
| >pdb|1D6S|A Chain A, Crystal Structure Of The K41a Mutant Of O-Acetylserine Sulfhydrylase Complexed In External Aldimine Linkage With Methionine Length = 322 | Back alignment and structure |
| >pdb|2JC3|A Chain A, Structure Of O-acetylserine Sulfhydrylase B From Salmonella Typhimurium Length = 303 | Back alignment and structure |
| >pdb|4AIR|A Chain A, Leishmania Major Cysteine Synthase Length = 354 | Back alignment and structure |
| >pdb|2BHS|A Chain A, Crystal Structure Of Cysteine Synthase B Length = 303 | Back alignment and structure |
| >pdb|2BHT|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase B Length = 303 | Back alignment and structure |
| >pdb|1JBQ|A Chain A, Structure Of Human Cystathionine Beta-Synthase: A Unique Pyridoxal 5'- Phosphate Dependent Hemeprotein Length = 435 | Back alignment and structure |
| >pdb|1M54|A Chain A, Cystathionine-Beta Synthase: Reduced Vicinal Thiols Length = 363 | Back alignment and structure |
| >pdb|3T4P|A Chain A, Crystal Structure Of O-Acetyl Serine Sulfhydrylase From Leishmania Donovani In Complex With Designed Tetrapeptide Length = 334 | Back alignment and structure |
| >pdb|2V03|A Chain A, High Resolution Structure And Catalysis Of An O- Acetylserine Sulfhydrylase Length = 303 | Back alignment and structure |
| >pdb|3DWI|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cysm, The Cysteine Synthase B Length = 323 | Back alignment and structure |
| >pdb|3FCA|A Chain A, Genetic Incorporation Of A Metal-Ion Chelating Amino Acid Into Proteins As Biophysical Probe Length = 291 | Back alignment and structure |
| >pdb|1O58|A Chain A, Crystal Structure Of O-Acetylserine Sulfhydrylase (Tm0665) From Thermotoga Maritima At 1.80 A Resolution Length = 303 | Back alignment and structure |
| >pdb|3DWG|A Chain A, Crystal Structure Of A Sulfur Carrier Protein Complex Found In The Cysteine Biosynthetic Pathway Of Mycobacterium Tuberculosis Length = 325 | Back alignment and structure |
| >pdb|3BM5|A Chain A, Crystal Structure Of O-Acetyl-Serine Sulfhydrylase From Entamoeba Histolytica In Complex With Cysteine Length = 338 | Back alignment and structure |
| >pdb|2PQM|A Chain A, Crystal Structure Of Cysteine Synthase (Oass) From Entamoeba Histolytica At 1.86 A Resolution Length = 343 | Back alignment and structure |
| >pdb|3DKI|A Chain A, 2.1 A X-Ray Structure Of Cysm (Rv1336) From Mycobacterium Tuberculosis An O-Phosphoserine Dependent Cysteine Synthase Length = 326 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 108 | |||
| 2q3b_A | 313 | Cysteine synthase A; pyridoxal-5'-phosphate, sulph | 3e-39 | |
| 4aec_A | 430 | Cysteine synthase, mitochondrial; lyase, cysteine | 6e-39 | |
| 1z7w_A | 322 | Cysteine synthase; transferase; HET: PLP; 2.20A {A | 9e-39 | |
| 3tbh_A | 334 | O-acetyl serine sulfhydrylase; cysteine synthase, | 1e-36 | |
| 1y7l_A | 316 | O-acetylserine sulfhydrylase, O-acetylserine (thio | 1e-35 | |
| 1ve1_A | 304 | O-acetylserine sulfhydrylase; PLP, transferase, ri | 1e-35 | |
| 2egu_A | 308 | Cysteine synthase; O-acetylserine sulfhydrase, str | 2e-35 | |
| 2pqm_A | 343 | Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 | 5e-34 | |
| 2v03_A | 303 | Cysteine synthase B; pyridoxal phosphate, cysteine | 1e-31 | |
| 1o58_A | 303 | O-acetylserine sulfhydrylase; TM0665, structural g | 2e-30 | |
| 3dwg_A | 325 | Cysteine synthase B; sulfur carrier protein comple | 9e-29 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 2e-25 | |
| 1jbq_A | 435 | B, cystathionine beta-synthase, serine sulfhydrase | 1e-24 | |
| 1wkv_A | 389 | Cysteine synthase; homodimer, open alpha/beta fold | 6e-21 |
| >2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A Length = 313 | Back alignment and structure |
|---|
Score = 131 bits (332), Expect = 3e-39
Identities = 34/67 (50%), Positives = 43/67 (64%)
Query: 4 KCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKG 63
I +D+T+LIG TP+V L V DG VA I AKLE P +SVKDRI +M++ AE G
Sbjct: 3 HMSIAEDITQLIGRTPLVRLRRVTDGAVADIVAKLEFFNPANSVKDRIGVAMLQAAEQAG 62
Query: 64 LITPGKV 70
LI P +
Sbjct: 63 LIKPDTI 69
|
| >4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} Length = 430 | Back alignment and structure |
|---|
| >1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* Length = 322 | Back alignment and structure |
|---|
| >3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3t4p_A* 3spx_A* 4air_A* Length = 334 | Back alignment and structure |
|---|
| >1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* Length = 316 | Back alignment and structure |
|---|
| >1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* Length = 304 | Back alignment and structure |
|---|
| >2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} Length = 308 | Back alignment and structure |
|---|
| >2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* Length = 343 | Back alignment and structure |
|---|
| >2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* Length = 303 | Back alignment and structure |
|---|
| >1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* Length = 303 | Back alignment and structure |
|---|
| >3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3fgp_A* 3dki_A* 3dwi_A* Length = 325 | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* Length = 527 | Back alignment and structure |
|---|
| >1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* Length = 435 | Back alignment and structure |
|---|
| >1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 Length = 389 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| 3vc3_A | 344 | Beta-cyanoalnine synthase; beta-cyanoalanine synth | 100.0 | |
| 3dwg_A | 325 | Cysteine synthase B; sulfur carrier protein comple | 99.96 | |
| 2q3b_A | 313 | Cysteine synthase A; pyridoxal-5'-phosphate, sulph | 99.95 | |
| 1y7l_A | 316 | O-acetylserine sulfhydrylase, O-acetylserine (thio | 99.95 | |
| 2v03_A | 303 | Cysteine synthase B; pyridoxal phosphate, cysteine | 99.95 | |
| 2egu_A | 308 | Cysteine synthase; O-acetylserine sulfhydrase, str | 99.95 | |
| 3tbh_A | 334 | O-acetyl serine sulfhydrylase; cysteine synthase, | 99.95 | |
| 1z7w_A | 322 | Cysteine synthase; transferase; HET: PLP; 2.20A {A | 99.95 | |
| 4aec_A | 430 | Cysteine synthase, mitochondrial; lyase, cysteine | 99.95 | |
| 2pqm_A | 343 | Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.8 | 99.95 | |
| 1ve1_A | 304 | O-acetylserine sulfhydrylase; PLP, transferase, ri | 99.94 | |
| 3l6b_A | 346 | Serine racemase; pyridoxal phosphate, PLP, isomera | 99.94 | |
| 1jbq_A | 435 | B, cystathionine beta-synthase, serine sulfhydrase | 99.94 | |
| 3pc3_A | 527 | CG1753, isoform A; CBS, synthase, PLP, heme, amino | 99.94 | |
| 1ve5_A | 311 | Threonine deaminase; riken structural genomics/Pro | 99.93 | |
| 1o58_A | 303 | O-acetylserine sulfhydrylase; TM0665, structural g | 99.92 | |
| 2gn0_A | 342 | Threonine dehydratase catabolic; TDCB, biodegradat | 99.92 | |
| 1v71_A | 323 | Serine racemase, hypothetical protein C320.14 in c | 99.92 | |
| 1p5j_A | 372 | L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo | 99.92 | |
| 4h27_A | 364 | L-serine dehydratase/L-threonine deaminase; PLP de | 99.92 | |
| 3aey_A | 351 | Threonine synthase; PLP, pyridoxal phosphate, lyas | 99.91 | |
| 2d1f_A | 360 | Threonine synthase; amino acid synthesis, pyridoxa | 99.91 | |
| 2rkb_A | 318 | Serine dehydratase-like; PLP bound enzyme, enzyme | 99.91 | |
| 2zsj_A | 352 | Threonine synthase; PLP dependent enzyme, lyase; H | 99.91 | |
| 1tdj_A | 514 | Biosynthetic threonine deaminase; allostery, coope | 99.91 | |
| 3ss7_X | 442 | D-serine dehydratase; type II fold, ALFA,beta-elim | 99.91 | |
| 3iau_A | 366 | Threonine deaminase; pyridoxal phosphate, amino-ac | 99.91 | |
| 4d9i_A | 398 | Diaminopropionate ammonia-lyase; fold type II PLP- | 99.89 | |
| 4d9b_A | 342 | D-cysteine desulfhydrase; fold type II PLP-depende | 99.89 | |
| 1qop_B | 396 | Tryptophan synthase beta chain; lyase, carbon-oxyg | 99.88 | |
| 1v8z_A | 388 | Tryptophan synthase beta chain 1; beta+alpha, rike | 99.88 | |
| 1f2d_A | 341 | 1-aminocyclopropane-1-carboxylate deaminase; carbo | 99.88 | |
| 1tzj_A | 338 | ACC deaminase, 1-aminocyclopropane-1-carboxylate d | 99.88 | |
| 1wkv_A | 389 | Cysteine synthase; homodimer, open alpha/beta fold | 99.88 | |
| 1j0a_A | 325 | 1-aminocyclopropane-1-carboxylate deaminase; PLP d | 99.87 | |
| 1x1q_A | 418 | Tryptophan synthase beta chain; structural genomic | 99.87 | |
| 2o2e_A | 422 | Tryptophan synthase beta chain; amino-acid biosynt | 99.87 | |
| 1e5x_A | 486 | Threonine synthase; threonine biosynthesis, PLP en | 99.85 | |
| 1kl7_A | 514 | Threonine synthase; threonine synthesis, pyridoxal | 99.78 | |
| 4f4f_A | 468 | Threonine synthase; structural genomics, niaid, na | 99.72 | |
| 1vb3_A | 428 | Threonine synthase; PLP-dependent enzyme, lyase; H | 99.71 | |
| 3v7n_A | 487 | Threonine synthase; ssgcid, structural genomics, s | 99.71 |
| >3vc3_A Beta-cyanoalnine synthase; beta-cyanoalanine synthase, transferase; HET: C6P; 1.77A {Glycine max} PDB: 3vbe_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.7e-33 Score=214.14 Aligned_cols=102 Identities=46% Similarity=0.693 Sum_probs=94.7
Q ss_pred hhhhHHHHhcccCCCceeEccCccCCCCceEEEEeCCCCCCcchhhHHHHHHHHHHHHcCCCCCCe--Ee---cchHHHH
Q 033940 4 KCEIKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGK--VF---NGNSPIL 78 (108)
Q Consensus 4 ~~~~~~~i~~~v~~TPLv~~~~l~~~~~~~i~~KlE~~nptGS~K~R~a~~~l~~a~~~g~~~~g~--~v---sGN~g~a 78 (108)
...|+++|.++||+|||+++++|++..|++||+|+|++|||||||||+|+++|..|.++|.+.+|. ++ +||||+|
T Consensus 22 ~~~i~~~i~~lIG~TPLv~~~~Ls~~~G~~IylK~E~lnptGSfK~RgA~~~i~~a~~~g~l~~g~~~Vv~aSsGN~g~a 101 (344)
T 3vc3_A 22 STNIKKHVSQLIGRTPLVYLNKVTEGCGAYVAVKQEMMQPTASIADRPAYAMITDAEEKNLITPGKTTLIEPTSGNMGIS 101 (344)
T ss_dssp CCSCBSSGGGGSCCCCEEECCSTTTTCCSEEEEEEGGGSTTSBTTHHHHHHHHHHHHHTTCCCTTTCEEEEECSSHHHHH
T ss_pred hhhhhccHhhhcCCCceEECcccchhhCCEEEEEecCCCCCCCcHHHHHHHHHHHHHHcCCCCCCCCEEEEeCCcHHHHH
Confidence 346788999999999999999999988999999999999999999999999999999999887763 33 9999999
Q ss_pred H-HH-HHcCCcEEEEecCCCCHHHHhhcc
Q 033940 79 K-LI-NHKNYAMNSVFLFSVNVNNFNQAH 105 (108)
Q Consensus 79 l-~~-~~~G~~~~ivvp~~~~~~k~~~~~ 105 (108)
+ ++ +.+|++|+||||+++|++|+++++
T Consensus 102 lA~~aa~~G~~~~IvmP~~~~~~k~~~~~ 130 (344)
T 3vc3_A 102 MAFMAAMKGYKMVLTMPSYTSLERRVTMR 130 (344)
T ss_dssp HHHHHHHHTCEEEEEEETTSCHHHHHHHH
T ss_pred HHHHHHHcCCcEEEEECCCChHHHHHHHH
Confidence 9 99 999999999999999999999886
|
| >3dwg_A Cysteine synthase B; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} SCOP: c.79.1.0 PDB: 3fgp_A* 3dki_A* 3dwi_A* | Back alignment and structure |
|---|
| >2q3b_A Cysteine synthase A; pyridoxal-5'-phosphate, sulphur metabolism, cysteine biosynthesis, transferase; HET: LLP; 1.80A {Mycobacterium tuberculosis} PDB: 2q3c_A* 2q3d_A* 3rr2_A | Back alignment and structure |
|---|
| >1y7l_A O-acetylserine sulfhydrylase, O-acetylserine (thiol)-lyase; X-RAY crystallography, sulfhydrylase; HET: LLP; 1.55A {Haemophilus influenzae} SCOP: c.79.1.1 PDB: 3iqg_X* 3iqh_X* 3iqi_X* 1fcj_A* 1oas_A* 1d6s_A* | Back alignment and structure |
|---|
| >2v03_A Cysteine synthase B; pyridoxal phosphate, cysteine biosynthesis, transferase, ENZ kinetics, enzymatic sythesis of novel compounds; HET: LLP CIT; 1.33A {Escherichia coli} PDB: 2bhs_A* 2bht_A* 2jc3_A* | Back alignment and structure |
|---|
| >2egu_A Cysteine synthase; O-acetylserine sulfhydrase, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; 1.90A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3tbh_A O-acetyl serine sulfhydrylase; cysteine synthase, type II PLP dependent enzyme, serine ACET transferase; HET: LLP; 1.68A {Leishmania donovani} PDB: 3spx_A* 3t4p_A* 4air_A* | Back alignment and structure |
|---|
| >1z7w_A Cysteine synthase; transferase; HET: PLP; 2.20A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 1z7y_A* 2isq_A* | Back alignment and structure |
|---|
| >4aec_A Cysteine synthase, mitochondrial; lyase, cysteine synthesis, assimilatory sulfate reduction, S plant inorganic sulfur uptake; HET: PLP; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2pqm_A Cysteine synthase; OASS, PLP, lyase; HET: PLP; 1.86A {Entamoeba histolytica} PDB: 3bm5_A* | Back alignment and structure |
|---|
| >1ve1_A O-acetylserine sulfhydrylase; PLP, transferase, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.45A {Thermus thermophilus} SCOP: c.79.1.1 PDB: 2eco_A* 2ecq_A* 2efy_A* | Back alignment and structure |
|---|
| >3l6b_A Serine racemase; pyridoxal phosphate, PLP, isomerase; HET: PLP; 1.50A {Homo sapiens} SCOP: c.79.1.0 PDB: 3l6r_A* 3hmk_A* 3l6c_A* | Back alignment and structure |
|---|
| >1jbq_A B, cystathionine beta-synthase, serine sulfhydrase; fold type II of PLP enzymes, lyase; HET: HEM PLP; 2.60A {Homo sapiens} SCOP: c.79.1.1 PDB: 1m54_A* | Back alignment and structure |
|---|
| >3pc3_A CG1753, isoform A; CBS, synthase, PLP, heme, aminoacrylate, lyase; HET: HEM P1T; 1.55A {Drosophila melanogaster} PDB: 3pc2_A* 3pc4_A* | Back alignment and structure |
|---|
| >1ve5_A Threonine deaminase; riken structural genomics/Pro initiative, RSGI, structural genomics, lyase; HET: PLP; 2.15A {Thermus thermophilus} SCOP: c.79.1.1 | Back alignment and structure |
|---|
| >1o58_A O-acetylserine sulfhydrylase; TM0665, structural genomics, J protein structure initiative, joint center for structural G transferase; 1.80A {Thermotoga maritima} SCOP: c.79.1.1 PDB: 3fca_A* | Back alignment and structure |
|---|
| >1v71_A Serine racemase, hypothetical protein C320.14 in chromosome III; dimer, PLP, isomerase; HET: PLP; 1.70A {Schizosaccharomyces pombe} SCOP: c.79.1.1 PDB: 1wtc_A* 2zpu_A* 2zr8_A* | Back alignment and structure |
|---|
| >1p5j_A L-serine dehydratase; lyase; HET: PLP; 2.50A {Homo sapiens} SCOP: c.79.1.1 PDB: 1pwh_A* 1pwe_A* | Back alignment and structure |
|---|
| >4h27_A L-serine dehydratase/L-threonine deaminase; PLP dependent typeii, PLP binding, liver, lyase; HET: LLP; 1.30A {Homo sapiens} PDB: 1p5j_A* 1pwh_A* 1pwe_A* | Back alignment and structure |
|---|
| >3aey_A Threonine synthase; PLP, pyridoxal phosphate, lyase; 1.92A {Thermus thermophilus} PDB: 1uin_A* 1uim_A* 3aex_A* 1v7c_A | Back alignment and structure |
|---|
| >2d1f_A Threonine synthase; amino acid synthesis, pyridoxal-5'-phosphate, PLP, lyase; HET: PLP; 2.50A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2rkb_A Serine dehydratase-like; PLP bound enzyme, enzyme found in human cells, lyase, pyridoxal phosphate; HET: PLP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2zsj_A Threonine synthase; PLP dependent enzyme, lyase; HET: PLP; 1.80A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1tdj_A Biosynthetic threonine deaminase; allostery, cooperative, tetramer, regulation, pyridoxal PHOS isoleucine biosynthesis; HET: PLP; 2.80A {Escherichia coli} SCOP: c.79.1.1 d.58.18.2 d.58.18.2 | Back alignment and structure |
|---|
| >3ss7_X D-serine dehydratase; type II fold, ALFA,beta-elimination, P 5'-phosphate, lyase; HET: PLP; 1.55A {Escherichia coli} PDB: 3ss9_X* 3r0x_A* 3r0z_A | Back alignment and structure |
|---|
| >3iau_A Threonine deaminase; pyridoxal phosphate, amino-acid biosynthesis, defensive PROT jasmonic acid pathway, jasmonic acid,structural genomics; HET: LLP 15P; 2.35A {Solanum lycopersicum} | Back alignment and structure |
|---|
| >4d9i_A Diaminopropionate ammonia-lyase; fold type II PLP-dependent enzyme, tryptophan synthase beta like PLP-dependent enzymes superfamily; HET: IT1; 2.00A {Escherichia coli} PDB: 4d9g_A* 4d9n_A* 4d9k_A* 4d9m_A* | Back alignment and structure |
|---|
| >4d9b_A D-cysteine desulfhydrase; fold type II PLP-dependent enzyme or tryptophan synthase BET like family, PLP dependent enzyme, lyase; HET: PMP; 1.67A {Salmonella typhimurium} PDB: 4d96_A* 4d9c_A* 4d9e_A* 4d9f_A* 4d97_A* 4d8w_A* 4d8u_A* 4d8t_A* 4d92_A* 4d99_A* | Back alignment and structure |
|---|
| >1qop_B Tryptophan synthase beta chain; lyase, carbon-oxygen lyase, tryptophan biosynthesis, pyridoxal phosphate; HET: IPL PLP; 1.4A {Salmonella typhimurium} SCOP: c.79.1.1 PDB: 1k7e_B* 1k7f_B* 1kfb_B* 1k3u_B* 1tjp_B* 1wbj_B* 2cli_B* 2clk_B* 2cll_B* 2j9x_B* 3cep_B* 1kfc_B* 1k8x_B* 1kfj_B* 1kfk_B* 2rh9_B* 2rhg_B* 2j9y_B* 1cw2_B* 1a5s_B* ... | Back alignment and structure |
|---|
| >1v8z_A Tryptophan synthase beta chain 1; beta+alpha, riken structural genomics/proteomics initiative, structural genomics, lyase; HET: PLP; 2.21A {Pyrococcus furiosus} SCOP: c.79.1.1 PDB: 1wdw_B* | Back alignment and structure |
|---|
| >1f2d_A 1-aminocyclopropane-1-carboxylate deaminase; carbon-carbon L open twisted alpha/beta, lyase; HET: PLP; 2.00A {Williopsis saturnus} SCOP: c.79.1.1 PDB: 1j0e_A* 1j0d_A* 1j0c_A* | Back alignment and structure |
|---|
| >1tzj_A ACC deaminase, 1-aminocyclopropane-1-carboxylate deaminase; substrate, PLP, crystal, complex, hydrolase; HET: PLP; 1.99A {Pseudomonas SP} SCOP: c.79.1.1 PDB: 1rqx_A* 1tz2_A* 1tyz_A* 1tzk_A* 1tzm_A* | Back alignment and structure |
|---|
| >1wkv_A Cysteine synthase; homodimer, open alpha/beta folding, transferase; HET: PLP; 2.00A {Aeropyrum pernix} SCOP: c.79.1.1 | Back alignment and structure |
|---|
| >1j0a_A 1-aminocyclopropane-1-carboxylate deaminase; PLP dependent, lyase; HET: PLP; 2.50A {Pyrococcus horikoshii} SCOP: c.79.1.1 PDB: 1j0b_A* | Back alignment and structure |
|---|
| >1x1q_A Tryptophan synthase beta chain; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2o2e_A Tryptophan synthase beta chain; amino-acid biosynthesis, tryptophan biosynthesis, structural genomics; 2.20A {Mycobacterium tuberculosis} PDB: 2o2j_A | Back alignment and structure |
|---|
| >1e5x_A Threonine synthase; threonine biosynthesis, PLP enzyme, S-adenosyl-methionine, allostery; 2.25A {Arabidopsis thaliana} SCOP: c.79.1.1 PDB: 2c2b_A* 2c2g_A* | Back alignment and structure |
|---|
| >1kl7_A Threonine synthase; threonine synthesis, pyridoxal 5-phosphate, beta-family, MON lyase; HET: PLP; 2.70A {Saccharomyces cerevisiae} SCOP: c.79.1.1 | Back alignment and structure |
|---|
| >4f4f_A Threonine synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.90A {Brucella melitensis BV} | Back alignment and structure |
|---|
| >1vb3_A Threonine synthase; PLP-dependent enzyme, lyase; HET: KPA; 2.20A {Escherichia coli} SCOP: c.79.1.1 | Back alignment and structure |
|---|
| >3v7n_A Threonine synthase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, lyase; 1.40A {Burkholderia thailandensis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 108 | ||||
| d1z7wa1 | 320 | c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (C | 6e-24 | |
| d1y7la1 | 310 | c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (C | 8e-22 | |
| d1fcja_ | 302 | c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei | 3e-20 | |
| d1ve1a1 | 302 | c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (C | 1e-19 | |
| d2bhsa1 | 292 | c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (C | 4e-19 | |
| d1jbqa_ | 355 | c.79.1.1 (A:) Cystathionine beta-synthase {Human ( | 1e-18 | |
| d1o58a_ | 293 | c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cystei | 9e-16 | |
| d1tdja1 | 331 | c.79.1.1 (A:5-335) Threonine deaminase {Escherichi | 3e-13 | |
| d1ve5a1 | 310 | c.79.1.1 (A:2-311) Threonine deaminase {Thermus th | 1e-11 | |
| d1v71a1 | 318 | c.79.1.1 (A:6-323) Hypothetical protein C320.14 (S | 6e-11 | |
| d1wkva1 | 382 | c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (C | 7e-11 | |
| d1v7ca_ | 351 | c.79.1.1 (A:) Threonine synthase {Thermus thermoph | 2e-10 | |
| d1j0aa_ | 325 | c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de | 8e-10 | |
| d1e5xa_ | 477 | c.79.1.1 (A:) Threonine synthase {Mouse-ear cress | 1e-09 | |
| d1p5ja_ | 319 | c.79.1.1 (A:) L-serine dehydratase {Human (Homo sa | 1e-08 | |
| d1f2da_ | 341 | c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de | 3e-08 | |
| d1tyza_ | 338 | c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate de | 8e-08 | |
| d1qopb_ | 390 | c.79.1.1 (B:) Tryptophan synthase, beta-subunit {S | 1e-05 | |
| d1v8za1 | 386 | c.79.1.1 (A:1-386) Tryptophan synthase, beta-subun | 3e-04 |
| >d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 320 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes family: Tryptophan synthase beta subunit-like PLP-dependent enzymes domain: O-acetylserine sulfhydrylase (Cysteine synthase) species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 90.7 bits (224), Expect = 6e-24
Identities = 48/63 (76%), Positives = 55/63 (87%)
Query: 7 IKKDVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLIT 66
I KDVTELIG+TP+VYLNNV +GCV +AAKLEMM+PCSSVKDRI +SMI DAE KGLI
Sbjct: 3 IAKDVTELIGNTPLVYLNNVAEGCVGRVAAKLEMMEPCSSVKDRIGFSMISDAEKKGLIK 62
Query: 67 PGK 69
PG+
Sbjct: 63 PGE 65
|
| >d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} Length = 310 | Back information, alignment and structure |
|---|
| >d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} Length = 302 | Back information, alignment and structure |
|---|
| >d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} Length = 302 | Back information, alignment and structure |
|---|
| >d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Length = 292 | Back information, alignment and structure |
|---|
| >d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} Length = 293 | Back information, alignment and structure |
|---|
| >d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} Length = 331 | Back information, alignment and structure |
|---|
| >d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} Length = 310 | Back information, alignment and structure |
|---|
| >d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 318 | Back information, alignment and structure |
|---|
| >d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 382 | Back information, alignment and structure |
|---|
| >d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} Length = 351 | Back information, alignment and structure |
|---|
| >d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 325 | Back information, alignment and structure |
|---|
| >d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 477 | Back information, alignment and structure |
|---|
| >d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} Length = 319 | Back information, alignment and structure |
|---|
| >d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} Length = 341 | Back information, alignment and structure |
|---|
| >d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} Length = 338 | Back information, alignment and structure |
|---|
| >d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} Length = 390 | Back information, alignment and structure |
|---|
| >d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 386 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 108 | |||
| d2bhsa1 | 292 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 99.97 | |
| d1z7wa1 | 320 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 99.97 | |
| d1y7la1 | 310 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 99.97 | |
| d1jbqa_ | 355 | Cystathionine beta-synthase {Human (Homo sapiens) | 99.96 | |
| d1ve1a1 | 302 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 99.96 | |
| d1fcja_ | 302 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 99.96 | |
| d1o58a_ | 293 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 99.96 | |
| d1ve5a1 | 310 | Threonine deaminase {Thermus thermophilus [TaxId: | 99.95 | |
| d1v71a1 | 318 | Hypothetical protein C320.14 (SPCC320.14, SPCC330. | 99.94 | |
| d1p5ja_ | 319 | L-serine dehydratase {Human (Homo sapiens) [TaxId: | 99.94 | |
| d1wkva1 | 382 | O-acetylserine sulfhydrylase (Cysteine synthase) { | 99.94 | |
| d1tdja1 | 331 | Threonine deaminase {Escherichia coli [TaxId: 562] | 99.93 | |
| d1qopb_ | 390 | Tryptophan synthase, beta-subunit {Salmonella typh | 99.92 | |
| d1v7ca_ | 351 | Threonine synthase {Thermus thermophilus [TaxId: 2 | 99.9 | |
| d1v8za1 | 386 | Tryptophan synthase, beta-subunit {Archaeon Pyroco | 99.9 | |
| d1e5xa_ | 477 | Threonine synthase {Mouse-ear cress (Arabidopsis t | 99.88 | |
| d1tyza_ | 338 | 1-aminocyclopropane-1-carboxylate deaminase {Pseud | 99.88 | |
| d1f2da_ | 341 | 1-aminocyclopropane-1-carboxylate deaminase {Yeast | 99.86 | |
| d1j0aa_ | 325 | 1-aminocyclopropane-1-carboxylate deaminase {Archa | 99.85 | |
| d1vb3a1 | 428 | Threonine synthase {Escherichia coli [TaxId: 562]} | 98.6 | |
| d1kl7a_ | 511 | Threonine synthase {Baker's yeast (Saccharomyces c | 96.05 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 89.35 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 80.47 |
| >d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Tryptophan synthase beta subunit-like PLP-dependent enzymes superfamily: Tryptophan synthase beta subunit-like PLP-dependent enzymes family: Tryptophan synthase beta subunit-like PLP-dependent enzymes domain: O-acetylserine sulfhydrylase (Cysteine synthase) species: Escherichia coli, isoform B (CysM) [TaxId: 562]
Probab=99.97 E-value=5.3e-32 Score=200.62 Aligned_cols=96 Identities=34% Similarity=0.468 Sum_probs=89.9
Q ss_pred HHhcccCCCceeEccCccCCCCceEEEEeCCCCCCcchhhHHHHHHHHHHHHcCCCCCCeEe----cchHHHHH-HH-HH
Q 033940 10 DVTELIGHTPMVYLNNVVDGCVAHIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKVF----NGNSPILK-LI-NH 83 (108)
Q Consensus 10 ~i~~~v~~TPLv~~~~l~~~~~~~i~~KlE~~nptGS~K~R~a~~~l~~a~~~g~~~~g~~v----sGN~g~al-~~-~~ 83 (108)
.|.+.||+|||++++++++..|++||+|+|++|||||||||+|.++|..|.++|.+.++.++ +||||+|+ ++ +.
T Consensus 2 ~i~~~IG~TPL~~~~~l~~~~g~~iy~K~E~~~ptGSfK~Rga~~~i~~a~~~g~~~~~~~vv~aSsGN~g~a~A~~a~~ 81 (292)
T d2bhsa1 2 TLEQTIGNTPLVKLQRMGPDNGSEVWLKLEGNNPAGSVKDRAALSMIVEAEKRGEIKPGDVLIEATSGNTGIALAMIAAL 81 (292)
T ss_dssp CGGGGSSCCCEEECSSSSCCSSCEEEEEEGGGSTTSBTHHHHHHHHHHHHHHTTSCCTTSEEEEECCSHHHHHHHHHHHH
T ss_pred chhcccCCCceEECCccChhhCCEEEEEeCCCCCCCCcHHHHHHHHHHHHHHhCCcCCCceeeeecccchhHHHHHHHHh
Confidence 47889999999999999988899999999999999999999999999999999987765554 99999999 99 99
Q ss_pred cCCcEEEEecCCCCHHHHhhcc
Q 033940 84 KNYAMNSVFLFSVNVNNFNQAH 105 (108)
Q Consensus 84 ~G~~~~ivvp~~~~~~k~~~~~ 105 (108)
+|++|+||||+++|+.|+++++
T Consensus 82 ~G~~~~i~~p~~~~~~k~~~~~ 103 (292)
T d2bhsa1 82 KGYRMKLLMPDNMSQERRAAMR 103 (292)
T ss_dssp HTCEEEEEEESCCCHHHHHHHH
T ss_pred cCcceEeeeccCchhhhhHHHH
Confidence 9999999999999999999886
|
| >d1z7wa1 c.79.1.1 (A:3-322) O-acetylserine sulfhydrylase (Cysteine synthase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y7la1 c.79.1.1 (A:2-311) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jbqa_ c.79.1.1 (A:) Cystathionine beta-synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ve1a1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1fcja_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1o58a_ c.79.1.1 (A:) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ve5a1 c.79.1.1 (A:2-311) Threonine deaminase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v71a1 c.79.1.1 (A:6-323) Hypothetical protein C320.14 (SPCC320.14, SPCC330.15c) {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1p5ja_ c.79.1.1 (A:) L-serine dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wkva1 c.79.1.1 (A:2-383) O-acetylserine sulfhydrylase (Cysteine synthase) {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1tdja1 c.79.1.1 (A:5-335) Threonine deaminase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qopb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1v7ca_ c.79.1.1 (A:) Threonine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1v8za1 c.79.1.1 (A:1-386) Tryptophan synthase, beta-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1e5xa_ c.79.1.1 (A:) Threonine synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1tyza_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Pseudomonas sp., strain ACP [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1f2da_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Yeast (Hansenula saturnus) [TaxId: 4906]} | Back information, alignment and structure |
|---|
| >d1j0aa_ c.79.1.1 (A:) 1-aminocyclopropane-1-carboxylate deaminase {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1vb3a1 c.79.1.1 (A:1-428) Threonine synthase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kl7a_ c.79.1.1 (A:) Threonine synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|