BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 033950
(107 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3K12|A Chain A, Crystal Structure Of An Uncharacterized Protein A6v7t0
From Pseudomonas Aeruginosa
pdb|3K12|B Chain B, Crystal Structure Of An Uncharacterized Protein A6v7t0
From Pseudomonas Aeruginosa
pdb|3K12|C Chain C, Crystal Structure Of An Uncharacterized Protein A6v7t0
From Pseudomonas Aeruginosa
pdb|3K12|D Chain D, Crystal Structure Of An Uncharacterized Protein A6v7t0
From Pseudomonas Aeruginosa
pdb|3K12|E Chain E, Crystal Structure Of An Uncharacterized Protein A6v7t0
From Pseudomonas Aeruginosa
pdb|3K12|F Chain F, Crystal Structure Of An Uncharacterized Protein A6v7t0
From Pseudomonas Aeruginosa
Length = 122
Score = 26.9 bits (58), Expect = 2.6, Method: Compositional matrix adjust.
Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 9/58 (15%)
Query: 54 DKTENVSTICDELLKFMEARPDPLLSVT--------NSPINPIWDRWF-EGPQDARGC 102
D+T + D LL+ + + +LSV + +N +WD+WF EG R C
Sbjct: 37 DQTRQILENIDRLLQSVGSDRGQVLSVRILLAHREDYAGLNQVWDQWFPEGRAPTRAC 94
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.136 0.421
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,383,119
Number of Sequences: 62578
Number of extensions: 60235
Number of successful extensions: 104
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 104
Number of HSP's gapped (non-prelim): 1
length of query: 107
length of database: 14,973,337
effective HSP length: 72
effective length of query: 35
effective length of database: 10,467,721
effective search space: 366370235
effective search space used: 366370235
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)