BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 033950
         (107 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3K12|A Chain A, Crystal Structure Of An Uncharacterized Protein A6v7t0
           From Pseudomonas Aeruginosa
 pdb|3K12|B Chain B, Crystal Structure Of An Uncharacterized Protein A6v7t0
           From Pseudomonas Aeruginosa
 pdb|3K12|C Chain C, Crystal Structure Of An Uncharacterized Protein A6v7t0
           From Pseudomonas Aeruginosa
 pdb|3K12|D Chain D, Crystal Structure Of An Uncharacterized Protein A6v7t0
           From Pseudomonas Aeruginosa
 pdb|3K12|E Chain E, Crystal Structure Of An Uncharacterized Protein A6v7t0
           From Pseudomonas Aeruginosa
 pdb|3K12|F Chain F, Crystal Structure Of An Uncharacterized Protein A6v7t0
           From Pseudomonas Aeruginosa
          Length = 122

 Score = 26.9 bits (58), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 9/58 (15%)

Query: 54  DKTENVSTICDELLKFMEARPDPLLSVT--------NSPINPIWDRWF-EGPQDARGC 102
           D+T  +    D LL+ + +    +LSV          + +N +WD+WF EG    R C
Sbjct: 37  DQTRQILENIDRLLQSVGSDRGQVLSVRILLAHREDYAGLNQVWDQWFPEGRAPTRAC 94


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.136    0.421 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,383,119
Number of Sequences: 62578
Number of extensions: 60235
Number of successful extensions: 104
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 104
Number of HSP's gapped (non-prelim): 1
length of query: 107
length of database: 14,973,337
effective HSP length: 72
effective length of query: 35
effective length of database: 10,467,721
effective search space: 366370235
effective search space used: 366370235
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)