Citrus Sinensis ID: 033962

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVAKTAA
ccHHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHccccccccEEEcccEEccHHHHHHHHHccccHHHHHHccccccccc
******QETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVA****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALPKAQETVSSNSVVVFSKTLCPFCVSVKELFQQLGVTFKAIELDKESDGSDIQSALAEWTGQKTVPNVFIGGKHIGGCDSTTALHREGKLVPLLTEAGAVAKTAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutaredoxin-C6 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins. Possesses thioltransferase, dehydroascorbate reductase and GSH-dependent peroxidase activities in vitro.confidentP55142
Glutaredoxin-C2 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.confidentQ9FNE2
Glutaredoxin Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.probableO81187

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E7P, chain A
Confidence level:very confident
Coverage over the Query: 3-101
View the alignment between query and template
View the model in PyMOL