Citrus Sinensis ID: 033968

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MEHGAFGDQSNATFSLTEEDHTLANAVRFTLNQDPRVTFCGYSIPHPSDARVNIRVQTTGDPAREVLKDSCQELMLMCRHVRSTFAKAVDDFRTSEKVQAMKIDSKE
ccccccccccCEEEEEccccccHHHHHHHHHHcccccEEEEccccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccccccc
*********SNATFSLTEEDHTLANAVRFTLNQDPRVTFCGYSIPHPSDARVNIRVQTTGDPAREVLKDSCQELMLMCRHVRSTFAKAVDD****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHGAFGDQSNATFSLTEEDHTLANAVRFTLNQDPRVTFCGYSIPHPSDARVNIRVQTTGDPAREVLKDSCQELMLMCRHVRSTFAKAVDDFRTSEKVQAMKIDSKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA-directed RNA polymerases I and III subunit RPAC2 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.probableQ6DRI4
Probable DNA-directed RNA polymerases I and III subunit RPAC2 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.probableQ9VIZ0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3H0G, chain K
Confidence level:very confident
Coverage over the Query: 6-100
View the alignment between query and template
View the model in PyMOL