Citrus Sinensis ID: 033970


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MKKMQGRVVCASSDKTVAVEVVRLDPHPKYKRRIRKKKKYQAHDPENQFQVGDLVQLEKSRPISKTKSFIAVAMPPRNASKKAAGESSNAGNNELGIPLESEQQLEA
ccEEEEEEEccccccEEEEEEEECccccccccEEEEEEcEEECccccccccccEEEEEEcccccccccEEEEEEEccccccccccccccccccccccccccHHHHcc
MKKMQGRVVCASSDKTVAVEVVRLDPHPKYKRRIRKKKKYQAHDPENQFQVGDLVQLEKSRPISKTKSFIAVAMPP*******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKMQGRVVCASSDKTVAVEVVRLDPHPKYKRRIRKKKKYQAHDPENQFQVGDLVQLEKSRPISKTKSFIAVAMPPRNASKKAAGESSNAGNNELGIPLESEQQLEA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S17, chloroplastic One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.probableP16180
30S ribosomal protein S17 One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.probableQ92GX5
30S ribosomal protein S17 One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.probableQ1RHN0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBN, chain Q
Confidence level:very confident
Coverage over the Query: 1-80
View the alignment between query and template
View the model in PyMOL