Citrus Sinensis ID: 033972


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MSRPMEEDNVKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNPK
ccccccccccccHHHHcccccHHHHHHHHHccEEEEEEEccccEEEEEEEEEccccccEEccEEEEEEEccccccccccccccCEEEEEcEEEEcccEEEEEEcccc
********************PLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTEL*********ALPVNKDRFISKMFLRGDSVIIVLRNP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRPMEEDNVKNEEEEFNTGPLSVLMMSVKNNTQVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSVIIVLRNPK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable small nuclear ribonucleoprotein Sm D2 Required for pre-mRNA splicing. Required for snRNP biogenesis.confidentQ18786
Probable small nuclear ribonucleoprotein Sm D2 Required for pre-mRNA splicing. Required for snRNP biogenesis.confidentQ9VI10
Probable small nuclear ribonucleoprotein Sm D2 Required for pre-mRNA splicing. Required for snRNP biogenesis.confidentQ54NC5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B34, chain B
Confidence level:very confident
Coverage over the Query: 19-66,86-107
View the alignment between query and template
View the model in PyMOL