Citrus Sinensis ID: 033979

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------
MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVINYTIIFFLVLNSYSLAVWLPRNCRNL
cccccccccccccHHHHHHHHHHHHHHHcccccccCECccccccEEEEEEEccccccccccEEEEEEEccccccccccEEEEEcccEEccccccccEEEcccccccc
**********************ELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVINYTIIFFLVLNSYSLAVWLPRNCRN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSSSAPSRKALSKIASNRLQKELVEWQVNPPAGFKHKVTDNLQRWIIEVNGAPGTLYANETFELQVDFPEHYPMEAPQVINYTIIFFLVLNSYSLAVWLPRNCRNL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable ubiquitin-conjugating enzyme E2 16 Accepts the ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins.probableQ9FWT2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2A7L, chain A
Confidence level:very confident
Coverage over the Query: 6-101
View the alignment between query and template
View the model in PyMOL