Query         033983
Match_columns 106
No_of_seqs    104 out of 253
Neff          4.5 
Searched_HMMs 46136
Date          Fri Mar 29 08:29:12 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033983.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033983hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2712 Transcriptional coacti 100.0 4.4E-35 9.5E-40  206.9   7.2  103    3-106     2-106 (108)
  2 PF02229 PC4:  Transcriptional   99.9 2.7E-25 5.9E-30  140.2   5.3   54   42-95      2-56  (56)
  3 COG4443 Uncharacterized protei  93.0   0.059 1.3E-06   36.0   1.6   40   54-96     30-70  (72)
  4 TIGR02530 flg_new flagellar op  72.2     4.5 9.7E-05   28.4   2.8   22   78-99     27-48  (96)
  5 COG1448 TyrB Aspartate/tyrosin  64.5     5.8 0.00012   34.0   2.5   19   76-96    184-202 (396)
  6 KOG3064 RNA-binding nuclear pr  61.4      17 0.00037   30.1   4.6   52   40-102    40-97  (303)
  7 PF08880 QLQ:  QLQ;  InterPro:   60.5     8.2 0.00018   22.4   2.0   16   82-97      2-17  (37)
  8 PF10815 ComZ:  ComZ;  InterPro  58.5      11 0.00023   24.2   2.4   22   77-98     22-43  (56)
  9 PF12651 RHH_3:  Ribbon-helix-h  53.4      20 0.00043   21.1   2.9   19   79-97      5-23  (44)
 10 COG5129 MAK16 Nuclear protein   51.2      36 0.00077   27.9   4.8   52   40-102    39-96  (303)
 11 PF01707 Peptidase_C9:  Peptida  50.9     3.3   7E-05   32.6  -1.1   14   79-92     62-75  (202)
 12 cd04754 Commd6 COMM_Domain con  50.0      63  0.0014   22.3   5.3   43   58-102    42-85  (86)
 13 PF13101 DUF3945:  Protein of u  44.5      14 0.00031   23.0   1.3   15   79-93     31-45  (59)
 14 PF08988 DUF1895:  Protein of u  40.4      44 0.00094   21.8   3.2   21   83-103    38-58  (68)
 15 KOG1412 Aspartate aminotransfe  39.8      22 0.00049   30.4   2.2   21   74-96    188-208 (410)
 16 TIGR02501 type_III_yscE type I  39.0      45 0.00098   21.6   3.1   21   83-103    37-57  (67)
 17 smart00712 PUR DNA/RNA-binding  38.9   1E+02  0.0022   19.6   6.0   49   39-101    12-61  (63)
 18 PF13487 HD_5:  HD domain; PDB:  38.1      50  0.0011   20.2   3.1   24   82-105     2-25  (64)
 19 PF04358 DsrC:  DsrC like prote  35.9      23 0.00049   25.0   1.4   18   77-94     33-50  (109)
 20 PF06526 DUF1107:  Protein of u  35.5      24 0.00051   23.1   1.3   45   55-106    19-64  (64)
 21 COG2921 Uncharacterized conser  34.8      36 0.00078   23.7   2.2   32   68-99     44-84  (90)
 22 cd07999 GH7_CBH_EG Glycosyl hy  31.7      56  0.0012   28.1   3.3   41   47-87    256-307 (386)
 23 PF06831 H2TH:  Formamidopyrimi  31.7      47   0.001   22.2   2.4   31   72-102    51-82  (92)
 24 PF02866 Ldh_1_C:  lactate/mala  31.1      65  0.0014   23.2   3.2   44   60-104   126-169 (174)
 25 TIGR03342 dsrC_tusE_dsvC sulfu  30.2      62  0.0013   22.9   2.8   17   78-94     33-49  (108)
 26 TIGR02675 tape_meas_nterm tape  30.0      66  0.0014   20.8   2.8   22   83-104    31-52  (75)
 27 PF09655 Nitr_red_assoc:  Conse  30.0      21 0.00046   26.7   0.5   17   77-93    102-118 (144)
 28 PF11580 DUF3239:  Protein of u  28.3      34 0.00074   25.0   1.3   19   82-100   110-128 (128)
 29 COG3530 Uncharacterized protei  27.4      30 0.00066   23.0   0.8   29   53-82     16-48  (71)
 30 PF08743 Nse4_C:  Nse4 C-termin  27.2      48   0.001   22.2   1.8   16   81-96     69-84  (93)
 31 PRK11508 sulfur transfer prote  26.9      76  0.0017   22.5   2.8   18   78-95     34-51  (109)
 32 cd01277 HINT_subgroup HINT (hi  26.5      90  0.0019   20.0   3.0   24   82-105    50-73  (103)
 33 PF03102 NeuB:  NeuB family;  I  26.3      66  0.0014   25.4   2.7   25   79-103   213-237 (241)
 34 PF11006 DUF2845:  Protein of u  26.3 1.2E+02  0.0025   20.0   3.5   28   39-66     58-85  (87)
 35 TIGR03586 PseI pseudaminic aci  26.1      74  0.0016   26.2   3.0   24   81-104   236-259 (327)
 36 PF08848 DUF1818:  Domain of un  26.0   1E+02  0.0023   22.3   3.4   25   81-105    29-53  (117)
 37 PF00840 Glyco_hydro_7:  Glycos  25.3      90   0.002   27.2   3.5   47   47-93    280-339 (433)
 38 COG2920 DsrC Dissimilatory sul  24.4      50  0.0011   23.8   1.5   20   73-92     31-50  (111)
 39 cd02679 MIT_spastin MIT: domai  24.0      53  0.0012   21.9   1.5   31   72-104    41-71  (79)
 40 PRK13398 3-deoxy-7-phosphohept  22.9      81  0.0018   25.1   2.6   24   79-102   243-266 (266)
 41 PF11325 DUF3127:  Domain of un  22.5      88  0.0019   21.2   2.4   17   51-67     65-81  (84)
 42 PRK06223 malate dehydrogenase;  22.4 1.1E+02  0.0025   23.8   3.3   45   60-106   263-307 (307)
 43 PF14164 YqzH:  YqzH-like prote  22.3      96  0.0021   20.3   2.4   18   81-98     24-41  (64)
 44 TIGR03569 NeuB_NnaB N-acetylne  21.8      97  0.0021   25.6   3.0   25   80-104   236-260 (329)
 45 PRK08673 3-deoxy-7-phosphohept  21.7   1E+02  0.0022   25.6   3.1   25   80-104   310-334 (335)
 46 PRK13396 3-deoxy-7-phosphohept  21.3 1.1E+02  0.0023   25.8   3.1   25   80-104   319-343 (352)
 47 cd01275 FHIT FHIT (fragile his  21.1 1.2E+02  0.0027   20.5   3.0   40   56-104    33-72  (126)
 48 COG2089 SpsE Sialic acid synth  20.8 1.1E+02  0.0024   26.0   3.1   25   79-103   247-271 (347)
 49 PRK10287 thiosulfate:cyanide s  20.4      64  0.0014   21.9   1.4   34   55-90     17-50  (104)

No 1  
>KOG2712 consensus Transcriptional coactivator [Transcription]
Probab=100.00  E-value=4.4e-35  Score=206.88  Aligned_cols=103  Identities=50%  Similarity=0.827  Sum_probs=85.0

Q ss_pred             CCCcccccccccCC--CCCCCCCCCCCCCCCCCCCCCCCcEEEEcCCceEEEEeeeCCceEEEeEEEEecCCeecCcccc
Q 033983            3 GKGKRKEEEEYDSD--GSVDGHAPPKKASKTDSSDDSDDIVVCEISKNRRVSVRNWQGKVWVDIREFYVKEGKKFPGKKG   80 (106)
Q Consensus         3 ~~~k~k~~~~~~sd--~~~~~~~~~Kk~~~~~~~~~~~~~~~~~Ls~~rrVtV~~FkG~~~VdIREyY~kdGe~~PgKKG   80 (106)
                      .++.++....+.++  ++...++|+++..+.. .+++++.++|+|+++|||||++|+|+.||||||||.++|+++||+||
T Consensus         2 s~~~~~~~~~r~~~~~~~~~~~a~~~~v~k~~-d~~s~~~~i~~l~~~RrVtV~eFkGk~~VdIREyY~kdG~mlPgkKG   80 (108)
T KOG2712|consen    2 SSSSRKDVDSRVDKKLKEKKSHAPNKKVEKPK-DDDSEDDNIFNLGKNRRVTVREFKGKILVDIREYYVKDGKMLPGKKG   80 (108)
T ss_pred             ccccccCccccccccccchhhhCCCccccCcc-cCCcCccceeecCCceEEehhhcCCceEEehhHhhhccCccccCccc
Confidence            34555555444444  4566677776655532 22566678999999999999999999999999999999999999999


Q ss_pred             eecCHHHHHHHHHhHHHHHHHhhcCC
Q 033983           81 ISLSVDQWNTLRDHVEEINKALGDNS  106 (106)
Q Consensus        81 ISL~~eqw~~L~~~~~~Id~ai~~~~  106 (106)
                      ||||++||..|++++++||+||.+|+
T Consensus        81 ISLs~~qW~~Lk~~~~eId~Al~~l~  106 (108)
T KOG2712|consen   81 ISLSLEQWSKLKEHIEEIDKALRKLS  106 (108)
T ss_pred             cccCHHHHHHHHHHHHHHHHHHHHhc
Confidence            99999999999999999999999885


No 2  
>PF02229 PC4:  Transcriptional Coactivator p15 (PC4);  InterPro: IPR003173 p15 has a bipartite structure composed of an amino-terminal regulatory domain and a carboxy-terminal cryptic DNA-binding domain []. The DNA-binding activity of the carboxy-terminal is disguised by the amino-terminal p15 domain. Activity is controlled by protein kinases that target the regulatory domain.; GO: 0003677 DNA binding, 0003713 transcription coactivator activity, 0006355 regulation of transcription, DNA-dependent; PDB: 3PM7_B 2LTD_A 2LTT_B 3OBH_B 2L3A_B 2PHE_B 1PCF_B 2C62_B.
Probab=99.92  E-value=2.7e-25  Score=140.17  Aligned_cols=54  Identities=46%  Similarity=0.861  Sum_probs=49.2

Q ss_pred             EEEcCCceEEEEeeeCCceEEEeEEEEec-CCeecCcccceecCHHHHHHHHHhH
Q 033983           42 VCEISKNRRVSVRNWQGKVWVDIREFYVK-EGKKFPGKKGISLSVDQWNTLRDHV   95 (106)
Q Consensus        42 ~~~Ls~~rrVtV~~FkG~~~VdIREyY~k-dGe~~PgKKGISL~~eqw~~L~~~~   95 (106)
                      +|+++.+++|+|++|+|++|||||+||.+ +|+|+||+|||||+++||.+|++++
T Consensus         2 ~~~~~~~~rv~v~~fkG~~~vdIRe~y~~~~g~~~P~kKGIsL~~~q~~~l~~~l   56 (56)
T PF02229_consen    2 IKNLGEKRRVSVSEFKGKPYVDIREWYEKKDGEWKPTKKGISLTPEQWKELKEAL   56 (56)
T ss_dssp             EETTEEEEEEEEEEETTSEEEEEEEEETTSSS-EEEEEEEEEE-HHHHHHHHHH-
T ss_pred             cccCCCeEEEEEEEeCCeEEEEEEeeEEcCCCcCcCcCCEEEcCHHHHHHHHhhC
Confidence            57899999999999999999999999997 8999999999999999999999874


No 3  
>COG4443 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=93.04  E-value=0.059  Score=35.95  Aligned_cols=40  Identities=30%  Similarity=0.604  Sum_probs=31.0

Q ss_pred             eeeCCce-EEEeEEEEecCCeecCcccceecCHHHHHHHHHhHH
Q 033983           54 RNWQGKV-WVDIREFYVKEGKKFPGKKGISLSVDQWNTLRDHVE   96 (106)
Q Consensus        54 ~~FkG~~-~VdIREyY~kdGe~~PgKKGISL~~eqw~~L~~~~~   96 (106)
                      -.|+|++ -.|||.|-.+.-  +-| |||+|+.+++..|++.+.
T Consensus        30 vSwNg~~~KyDiR~Wspdh~--KMG-KGiTLt~eE~~~l~d~l~   70 (72)
T COG4443          30 VSWNGRPPKYDIRAWSPDHS--KMG-KGITLTNEEFKALKDLLN   70 (72)
T ss_pred             cccCCCCCcCcccccCcchh--hhc-CceeecHHHHHHHHHHHh
Confidence            3578876 789999976532  335 899999999999988764


No 4  
>TIGR02530 flg_new flagellar operon protein. Members of this family are found in a subset of bacterial flagellar operons, generally between genes designated flgD and flgE, in species as diverse as Bacillus halodurans and various other Firmicutes, Geobacter sulfurreducens, and Bdellovibrio bacteriovorus. The specific molecular function is unknown.
Probab=72.22  E-value=4.5  Score=28.38  Aligned_cols=22  Identities=36%  Similarity=0.720  Sum_probs=18.5

Q ss_pred             ccceecCHHHHHHHHHhHHHHH
Q 033983           78 KKGISLSVDQWNTLRDHVEEIN   99 (106)
Q Consensus        78 KKGISL~~eqw~~L~~~~~~Id   99 (106)
                      ..||+|+.++|..|.+++....
T Consensus        27 ~R~I~l~~~~~~~i~~av~~A~   48 (96)
T TIGR02530        27 ERNISINPDDWKKLLEAVEEAE   48 (96)
T ss_pred             HcCCCCCHHHHHHHHHHHHHHH
Confidence            4799999999999988877654


No 5  
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism]
Probab=64.50  E-value=5.8  Score=34.04  Aligned_cols=19  Identities=37%  Similarity=0.800  Sum_probs=16.8

Q ss_pred             CcccceecCHHHHHHHHHhHH
Q 033983           76 PGKKGISLSVDQWNTLRDHVE   96 (106)
Q Consensus        76 PgKKGISL~~eqw~~L~~~~~   96 (106)
                      ||  ||-||.+||..|.+.+.
T Consensus       184 PT--G~D~t~~qW~~l~~~~~  202 (396)
T COG1448         184 PT--GIDPTEEQWQELADLIK  202 (396)
T ss_pred             CC--CCCCCHHHHHHHHHHHH
Confidence            76  99999999999987765


No 6  
>KOG3064 consensus RNA-binding nuclear protein (MAK16) containing a distinct C4 Zn-finger [RNA processing and modification]
Probab=61.37  E-value=17  Score=30.05  Aligned_cols=52  Identities=17%  Similarity=0.463  Sum_probs=36.9

Q ss_pred             cEEEEcCCceEEEEeeeCCceEEEeEEEEecCCeecCcccceecCHHHHHHHH------HhHHHHHHHh
Q 033983           40 IVVCEISKNRRVSVRNWQGKVWVDIREFYVKEGKKFPGKKGISLSVDQWNTLR------DHVEEINKAL  102 (106)
Q Consensus        40 ~~~~~Ls~~rrVtV~~FkG~~~VdIREyY~kdGe~~PgKKGISL~~eqw~~L~------~~~~~Id~ai  102 (106)
                      .+.|.|.+-|++||++=+|..|+-+-.         |  --..++...|+.++      .++..|++-|
T Consensus        40 R~SCPLANSrYATVre~~g~~yLymKt---------~--ERaH~P~klwErikLSkNyekALeQIde~L   97 (303)
T KOG3064|consen   40 RSSCPLANSRYATVREENGVLYLYMKT---------I--ERAHMPRKLWERIKLSKNYEKALEQIDEQL   97 (303)
T ss_pred             cccCcCccccceeEeecCCEEEEEEec---------h--hhhcCcHHHHHHHhcchhHHHHHHHHHHHH
Confidence            467999999999999999999975433         1  23446666777654      5566666544


No 7  
>PF08880 QLQ:  QLQ;  InterPro: IPR014978 QLQ is named after the conserved Gln, Leu, Gln motif. QLQ is found at the N terminus of SWI2/SNF2 protein, which has been shown to be involved in protein-protein interactions. QLQ has been postulated to be involved in mediating protein interactions []. ; GO: 0005524 ATP binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=60.45  E-value=8.2  Score=22.44  Aligned_cols=16  Identities=19%  Similarity=0.300  Sum_probs=13.7

Q ss_pred             ecCHHHHHHHHHhHHH
Q 033983           82 SLSVDQWNTLRDHVEE   97 (106)
Q Consensus        82 SL~~eqw~~L~~~~~~   97 (106)
                      ++|++||..|+..+-.
T Consensus         2 ~FT~~Ql~~L~~Qi~a   17 (37)
T PF08880_consen    2 PFTPAQLQELRAQILA   17 (37)
T ss_pred             CCCHHHHHHHHHHHHH
Confidence            5899999999998764


No 8  
>PF10815 ComZ:  ComZ;  InterPro: IPR024558 ComZ, which contains a leucine zipper motif, negatively regulates transcription of the ComG operon [].
Probab=58.51  E-value=11  Score=24.19  Aligned_cols=22  Identities=32%  Similarity=0.519  Sum_probs=19.0

Q ss_pred             cccceecCHHHHHHHHHhHHHH
Q 033983           77 GKKGISLSVDQWNTLRDHVEEI   98 (106)
Q Consensus        77 gKKGISL~~eqw~~L~~~~~~I   98 (106)
                      -++||-|+.++...|.+.+-.+
T Consensus        22 ~k~GIeLsme~~qP~m~L~~~V   43 (56)
T PF10815_consen   22 DKKGIELSMEMLQPLMQLLTKV   43 (56)
T ss_pred             HHcCccCCHHHHHHHHHHHHHH
Confidence            3689999999999998887765


No 9  
>PF12651 RHH_3:  Ribbon-helix-helix domain
Probab=53.37  E-value=20  Score=21.13  Aligned_cols=19  Identities=26%  Similarity=0.378  Sum_probs=16.0

Q ss_pred             cceecCHHHHHHHHHhHHH
Q 033983           79 KGISLSVDQWNTLRDHVEE   97 (106)
Q Consensus        79 KGISL~~eqw~~L~~~~~~   97 (106)
                      =+++|+.+++..|.+...+
T Consensus         5 ~t~~l~~el~~~L~~ls~~   23 (44)
T PF12651_consen    5 FTFSLDKELYEKLKELSEE   23 (44)
T ss_pred             EEEecCHHHHHHHHHHHHH
Confidence            3789999999999987655


No 10 
>COG5129 MAK16 Nuclear protein with HMG-like acidic region [General function prediction only]
Probab=51.19  E-value=36  Score=27.92  Aligned_cols=52  Identities=19%  Similarity=0.530  Sum_probs=36.6

Q ss_pred             cEEEEcCCceEEEEeeeCCceEEEeEEEEecCCeecCcccceecCHHHHHHHH------HhHHHHHHHh
Q 033983           40 IVVCEISKNRRVSVRNWQGKVWVDIREFYVKEGKKFPGKKGISLSVDQWNTLR------DHVEEINKAL  102 (106)
Q Consensus        40 ~~~~~Ls~~rrVtV~~FkG~~~VdIREyY~kdGe~~PgKKGISL~~eqw~~L~------~~~~~Id~ai  102 (106)
                      .+.|.|.+.|++||+.-.|+.|+-+.+         |  --...+...|+.++      .++.+||+.|
T Consensus        39 RqSCPLANSrYATVr~dngkLyLymKt---------p--ERaH~P~klwerIkLSkNY~kAL~QIde~L   96 (303)
T COG5129          39 RQSCPLANSRYATVRADNGKLYLYMKT---------P--ERAHVPRKLWERIKLSKNYEKALKQIDESL   96 (303)
T ss_pred             cccCcCccCcceEEEecCCEEEEEecC---------h--hhccCcHHHHHHHHhhhhHHHHHHHHHHHH
Confidence            568999999999999999999874332         2  23456667777664      4555666544


No 11 
>PF01707 Peptidase_C9:  Peptidase family C9;  InterPro: IPR002620 The family of alphaviruses includes 26 known members. They infect a variety of hosts including mosquitoes, birds, rodents and other mammals with worldwide distribution. Alphaviruses also pose a potential threat to human health in many area. For example, Venezuelan Equine Encephalitis Virus (VEEV) causes encephalitis in humans as well as livestock in Central and South America, and some variants of Sinbis Virus (SIN) and Semliki Forest Virus (SFV) have been found to cause fever and arthritis in humans []. Alphaviruses possess a single-stranded RNA genome of approximately 12 kb. The genomic RNA of alphaviruses is translated into two polyproteins that, respectively, encode structural proteins and nonstructural proteins. The nonstructural proteins may be translated as one or two polyproteins, nsp123 or nsp1234, depending on the virus. These polyproteins are cleaved to generate nsp1, nsp2, nsp3 and nsp4 by a protease activity that resides within nsp2 []. The nsp2 protein of alphaviruses has multiple enzymatic acivities. Its N-terminal domain has been shown to possess ATPase and GTPase activity, RNA helicase activity and RNA 5'-triphosphatase activity []. The C-terminal nsp2pro domain of nsp2 is responsible for the regulation of 26S subgenome RNA synthesis, switching between negative- and positive-strand RNA synthesis, targeting nsp2 for nuclear transport and proteolytic processing of the nonstructural polyprotein [, ]. The nsp2pro domain is a member of peptidase family C9 of clan CA. The nsp2pro domain consists of two distinct subdomains. The nsp2pro N-terminal subdomain is largely alpha-helical and contains the catalytic dyad cysteine and histidine residues organised in a protein fold that differs significantly from any known cysteine protease or protein folds. The nsp2pro C-terminal subdomain displays structural similarity to S-adenosyl- L-methionine-dependent RNA methyltransferases and provides essential elements that contribute to substrate recognition and may also regulate the structure of the substrate binding cleft []. This entry represents the nsp2pro domain.; PDB: 3TRK_A 2HWK_A.
Probab=50.90  E-value=3.3  Score=32.60  Aligned_cols=14  Identities=50%  Similarity=0.947  Sum_probs=8.8

Q ss_pred             cceecCHHHHHHHH
Q 033983           79 KGISLSVDQWNTLR   92 (106)
Q Consensus        79 KGISL~~eqw~~L~   92 (106)
                      -||.||.+||+.|-
T Consensus        62 AGI~LT~~qW~~l~   75 (202)
T PF01707_consen   62 AGIQLTAEQWSTLF   75 (202)
T ss_dssp             TT----HHHHCCCH
T ss_pred             cCcccCHHHHHHHh
Confidence            69999999999886


No 12 
>cd04754 Commd6 COMM_Domain containing protein 6. The COMM Domain is found at the C-terminus of a variety of proteins; presumably all COMM_Domain containing proteins are located in the nucleus and the COMM domain plays a role in protein-protein interactions. Several family members have been shown to bind and inhibit NF-kappaB.
Probab=50.02  E-value=63  Score=22.29  Aligned_cols=43  Identities=12%  Similarity=0.315  Sum_probs=35.4

Q ss_pred             CceEEEeEEEEec-CCeecCcccceecCHHHHHHHHHhHHHHHHHh
Q 033983           58 GKVWVDIREFYVK-EGKKFPGKKGISLSVDQWNTLRDHVEEINKAL  102 (106)
Q Consensus        58 G~~~VdIREyY~k-dGe~~PgKKGISL~~eqw~~L~~~~~~Id~ai  102 (106)
                      |.+||.+--=..+ +|...|  +-+-||.+|+..|...+.++.+.|
T Consensus        42 ~~Pfl~l~L~V~~~~G~~~~--~~~EmTlpEFq~f~~~~~~~~a~l   85 (86)
T cd04754          42 NSPYVAVTLKVADPSGQVVT--KSFEMTIPEFQNFSRQFKEMAAVL   85 (86)
T ss_pred             CCceEEEEEEEEccCCCccc--eEEEEcHHHHHHHHHHHHHHHHhc
Confidence            7889887665555 788877  599999999999999988887654


No 13 
>PF13101 DUF3945:  Protein of unknown function (DUF3945)
Probab=44.46  E-value=14  Score=23.02  Aligned_cols=15  Identities=47%  Similarity=0.705  Sum_probs=13.5

Q ss_pred             cceecCHHHHHHHHH
Q 033983           79 KGISLSVDQWNTLRD   93 (106)
Q Consensus        79 KGISL~~eqw~~L~~   93 (106)
                      +|+.||++|.+.|++
T Consensus        31 ~g~~Ls~~q~~~L~~   45 (59)
T PF13101_consen   31 KGVELSPEQKEDLRE   45 (59)
T ss_pred             cCccCCHHHHHHHHC
Confidence            799999999999875


No 14 
>PF08988 DUF1895:  Protein of unknown function (DUF1895);  InterPro: IPR015081 The YscE protein, produced by the pathogen Yersinia, assumes a secondary structure composed of two anti-parallel alpha-helices separated by a flexible loop. The function of this protein is, as yet, unknown. ; PDB: 1ZW0_B 2P58_A 2UWJ_E 2Q1K_D 3PH0_B.
Probab=40.38  E-value=44  Score=21.82  Aligned_cols=21  Identities=14%  Similarity=0.352  Sum_probs=18.7

Q ss_pred             cCHHHHHHHHHhHHHHHHHhh
Q 033983           83 LSVDQWNTLRDHVEEINKALG  103 (106)
Q Consensus        83 L~~eqw~~L~~~~~~Id~ai~  103 (106)
                      ++|+||..+....+.|..|++
T Consensus        38 ~~P~eyQq~q~~~~AieAA~~   58 (68)
T PF08988_consen   38 GTPQEYQQLQQQYDAIEAAIA   58 (68)
T ss_dssp             SSHHHHHHHHHHHHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHH
Confidence            689999999999999998875


No 15 
>KOG1412 consensus Aspartate aminotransferase/Glutamic oxaloacetic transaminase AAT2/GOT1 [Amino acid transport and metabolism]
Probab=39.82  E-value=22  Score=30.44  Aligned_cols=21  Identities=24%  Similarity=0.642  Sum_probs=17.0

Q ss_pred             ecCcccceecCHHHHHHHHHhHH
Q 033983           74 KFPGKKGISLSVDQWNTLRDHVE   96 (106)
Q Consensus        74 ~~PgKKGISL~~eqw~~L~~~~~   96 (106)
                      .-|+  ||-.|.|||.++.+.|.
T Consensus       188 hNPT--GmDPT~EQW~qia~vik  208 (410)
T KOG1412|consen  188 HNPT--GMDPTREQWKQIADVIK  208 (410)
T ss_pred             cCCC--CCCCCHHHHHHHHHHHH
Confidence            3465  99999999999977664


No 16 
>TIGR02501 type_III_yscE type III secretion system protein, YseE family. Members of this family are found exclusively in type III secretion appparatus gene clusters in bacteria. Those bacteria with a protein from this family tend to target animal cells, as does Yersinia pestis. This protein is small (about 70 amino acids) and not well characterized.
Probab=38.99  E-value=45  Score=21.62  Aligned_cols=21  Identities=14%  Similarity=0.143  Sum_probs=17.7

Q ss_pred             cCHHHHHHHHHhHHHHHHHhh
Q 033983           83 LSVDQWNTLRDHVEEINKALG  103 (106)
Q Consensus        83 L~~eqw~~L~~~~~~Id~ai~  103 (106)
                      .+|+||..|...+..++.|++
T Consensus        37 ~tp~qYq~l~~~~~A~~aA~~   57 (67)
T TIGR02501        37 GDPQQYQEWQLLADAIEAAIK   57 (67)
T ss_pred             CCHHHHHHHHHHHHHHHHHHH
Confidence            489999999888888888875


No 17 
>smart00712 PUR DNA/RNA-binding repeats in PUR-alpha/beta/gamma and in hypothetical proteins from spirochetes and the Bacteroides-Cytophaga-Flexibacter bacteria.
Probab=38.92  E-value=1e+02  Score=19.61  Aligned_cols=49  Identities=24%  Similarity=0.486  Sum_probs=32.7

Q ss_pred             CcEEEEcCCceEEEEeeeCCceEEEeEEEEec-CCeecCcccceecCHHHHHHHHHhHHHHHHH
Q 033983           39 DIVVCEISKNRRVSVRNWQGKVWVDIREFYVK-EGKKFPGKKGISLSVDQWNTLRDHVEEINKA  101 (106)
Q Consensus        39 ~~~~~~Ls~~rrVtV~~FkG~~~VdIREyY~k-dGe~~PgKKGISL~~eqw~~L~~~~~~Id~a  101 (106)
                      -.++|+|..++|       | .|+-|-|-  + .+    ++-=|.|+.+.|..+++++.++-+-
T Consensus        12 k~fyfDvk~N~r-------G-~fLrIsE~--~~~~----~r~~I~lp~~~~~~F~~~l~~~~~~   61 (63)
T smart00712       12 KRFYFDVKENRR-------G-RFLRISEV--KNNG----GRSSITVPEQGAAEFRDALNKLIEK   61 (63)
T ss_pred             cEEEEEecccCC-------c-cEEEEEEe--cCCC----CceEEEEEHHHHHHHHHHHHHHHHh
Confidence            456677765543       4 55555552  2 11    2678999999999999998876543


No 18 
>PF13487 HD_5:  HD domain; PDB: 3TMD_A 3TM8_B 3TMC_A 3TMB_B.
Probab=38.11  E-value=50  Score=20.25  Aligned_cols=24  Identities=17%  Similarity=0.209  Sum_probs=17.2

Q ss_pred             ecCHHHHHHHHHhHHHHHHHhhcC
Q 033983           82 SLSVDQWNTLRDHVEEINKALGDN  105 (106)
Q Consensus        82 SL~~eqw~~L~~~~~~Id~ai~~~  105 (106)
                      .||++||..++.+...--+.|.++
T Consensus         2 ~Lt~~e~~~~~~Hp~~~~~~l~~~   25 (64)
T PF13487_consen    2 KLTPEEREIIQQHPEYGAELLSQI   25 (64)
T ss_dssp             GS-HHHHHHHHHHHHHHHHHHTT-
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHcc
Confidence            489999999998877666666543


No 19 
>PF04358 DsrC:  DsrC like protein;  InterPro: IPR007453 DsrC (P45573 from SWISSPROT) has been observed to co-purify with Desulphovibrio vulgaris dissimilatory sulphite reductase []. However, DsrC appears to be only loosely associated to the sulphite reductase, which suggests that it may not be an integral part of the dissimilatory sulphite reductase. Many proteins in this entry are found in organisms such as Escherichia coli and Haemophilus influenzae which do not contain dissimilatory sulphite reductases but can synthesise assimilatory sirohaem sulphite and nitrite reductases. It is speculated that DsrC may be involved in the assembly, folding or stabilisation of sirohaem proteins []. The strictly conserved cysteine in the C terminus suggests that DsrC may have a catalytic function in the metabolism of sulphur compounds []. Also included in this entry is TusE, a partner to TusBCD in a sulphur relay system for 2-thiouridine biosynthesis, a tRNA base modification process. Many proteins in this entry are annotated as the third (gamma) subunit of dissimilatory sulphite reductase ; PDB: 2V4J_F 2A5W_C 1SAU_A 1JI8_A 1YX3_A.
Probab=35.86  E-value=23  Score=24.95  Aligned_cols=18  Identities=28%  Similarity=0.645  Sum_probs=11.3

Q ss_pred             cccceecCHHHHHHHHHh
Q 033983           77 GKKGISLSVDQWNTLRDH   94 (106)
Q Consensus        77 gKKGISL~~eqw~~L~~~   94 (106)
                      -.-||.||.++|+.+.-.
T Consensus        33 ~~egI~Ltd~HW~vI~fl   50 (109)
T PF04358_consen   33 KEEGIELTDEHWEVIRFL   50 (109)
T ss_dssp             HCTT-S--HHHHHHHHHH
T ss_pred             HHcCCCCCHHHHHHHHHH
Confidence            356999999999887543


No 20 
>PF06526 DUF1107:  Protein of unknown function (DUF1107);  InterPro: IPR009491 This family consists of several short, hypothetical bacterial proteins of unknown function.; PDB: 2JRO_A.
Probab=35.46  E-value=24  Score=23.07  Aligned_cols=45  Identities=24%  Similarity=0.383  Sum_probs=25.7

Q ss_pred             eeCCceEEE-eEEEEecCCeecCcccceecCHHHHHHHHHhHHHHHHHhhcCC
Q 033983           55 NWQGKVWVD-IREFYVKEGKKFPGKKGISLSVDQWNTLRDHVEEINKALGDNS  106 (106)
Q Consensus        55 ~FkG~~~Vd-IREyY~kdGe~~PgKKGISL~~eqw~~L~~~~~~Id~ai~~~~  106 (106)
                      -|+|..||+ |-.|--++|..++-++    ...   .-...+.+|+.+|..|+
T Consensus        19 lF~Gr~~I~g~G~feFd~Gkillp~~----~~~---~~~~~~~EiN~~I~~L~   64 (64)
T PF06526_consen   19 LFRGRIYIKGIGAFEFDNGKILLPKK----ADK---RHLSVMSEINQEIRRLS   64 (64)
T ss_dssp             H-SEEEEETTTEEEEEETTEE---SS------H---HHHHHHHHHHHHHHHH-
T ss_pred             HccceEEEEecccEEEcCCEEeCCcc----ccH---HHHHHHHHHHHHHHhcC
Confidence            388999885 5555448888775332    223   34455788888887764


No 21 
>COG2921 Uncharacterized conserved protein [Function unknown]
Probab=34.79  E-value=36  Score=23.72  Aligned_cols=32  Identities=19%  Similarity=0.268  Sum_probs=21.3

Q ss_pred             EecCCeecCcccc---------eecCHHHHHHHHHhHHHHH
Q 033983           68 YVKEGKKFPGKKG---------ISLSVDQWNTLRDHVEEIN   99 (106)
Q Consensus        68 Y~kdGe~~PgKKG---------ISL~~eqw~~L~~~~~~Id   99 (106)
                      |..-=.|+|+.||         +..+.||.+.|-..+.+++
T Consensus        44 ~~~~~~~k~SSkGnY~svsI~i~A~~~EQ~e~ly~eL~~~~   84 (90)
T COG2921          44 YTPRVSWKPSSKGNYLSVSITIRATNIEQVEALYRELRKHE   84 (90)
T ss_pred             cCceeeeccCCCCceEEEEEEEEECCHHHHHHHHHHHhhCC
Confidence            3333457888888         4567788888877666543


No 22 
>cd07999 GH7_CBH_EG Glycosyl hydrolase family 7. Glycosyl hydrolase family 7 contains eukaryotic endoglucanases (EGs) and cellobiohydrolases (CBHs) that hydrolyze glycosidic bonds using a double-displacement mechanism. This leads to a net retention of the conformation at the anomeric carbon. Both enzymes work synergistically in the degradation of cellulose,which is the main component of plant cell wall, and is composed of beta-1,4 linked glycosyl units. EG cleaves the beta-1,4 linkages of cellulose and CBH cleaves off cellobiose disaccharide units from the reducing end of the chain. In general, the O-glycosyl hydrolases are a widespread group of enzymes that hydrolyze the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycoside hydrolase family 7.
Probab=31.75  E-value=56  Score=28.10  Aligned_cols=41  Identities=22%  Similarity=0.379  Sum_probs=29.4

Q ss_pred             CceEEEEeeeC---CceEEEeEEEEecCCeecCccc----c----eecCHHH
Q 033983           47 KNRRVSVRNWQ---GKVWVDIREFYVKEGKKFPGKK----G----ISLSVDQ   87 (106)
Q Consensus        47 ~~rrVtV~~Fk---G~~~VdIREyY~kdGe~~PgKK----G----ISL~~eq   87 (106)
                      .+++-.|..|-   |-.|..||-+|..+|+..|.-+    |    =||+.+-
T Consensus       256 ~k~fTVVTQFit~~~G~LteIrR~YVQ~GkvI~n~~~~~~g~~~~~sitd~f  307 (386)
T cd07999         256 SKPFTVVTQFVTNDGGKLTEIKRLYIQNGKVIESAVVNIEGIPPGNSITDDF  307 (386)
T ss_pred             CCCeEEEEEeEeCCCCCcceeeEEEEECCEEEeCCCccccCCCCCCccCHHH
Confidence            34555678896   4589999999999998876442    3    3777764


No 23 
>PF06831 H2TH:  Formamidopyrimidine-DNA glycosylase H2TH domain;  InterPro: IPR015886 This entry represents a helix-2turn-helix DNA-binding domain found in DNA glycosylase/AP lyase enzymes, which are involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Most damage to bases in DNA is repaired by the base excision repair pathway []. These enzymes are primarily from bacteria, and have both DNA glycosylase activity (3.2.2 from EC) and AP lyase activity (4.2.99.18 from EC). Examples include formamidopyrimidine-DNA glycosylases (Fpg; MutM) and endonuclease VIII (Nei). Formamidopyrimidine-DNA glycosylases (Fpg, MutM) is a trifunctional DNA base excision repair enzyme that removes a wide range of oxidation-damaged bases (N-glycosylase activity; 3.2.2.23 from EC) and cleaves both the 3'- and 5'-phosphodiester bonds of the resulting apurinic/apyrimidinic site (AP lyase activity; 4.2.99.18 from EC). Fpg has a preference for oxidised purines, excising oxidized purine bases such as 7,8-dihydro-8-oxoguanine (8-oxoG). ITs AP (apurinic/apyrimidinic) lyase activity introduces nicks in the DNA strand, cleaving the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates. Fpg is a monomer composed of 2 domains connected by a flexible hinge []. The two DNA-binding motifs (a zinc finger and the helix-two-turns-helix motifs) suggest that the oxidized base is flipped out from double-stranded DNA in the binding mode and excised by a catalytic mechanism similar to that of bifunctional base excision repair enzymes []. Fpg binds one ion of zinc at the C terminus, which contains four conserved and essential cysteines [, ]. Endonuclease VIII (Nei) has the same enzyme activities as Fpg above (3.2.2 from EC, 4.2.99.18 from EC), but with a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine []. These protein contains three structural domains: an N-terminal catalytic core domain, a central helix-two turn-helix (H2TH) module and a C-terminal zinc finger []. The N-terminal catalytic domain and the C-terminal zinc finger straddle the DNA with the long axis of the protein oriented roughly orthogonal to the helical axis of the DNA. Residues that contact DNA are located in the catalytic domain and in a beta-hairpin loop formed by the zinc finger []. This entry represents the central domain containing the DNA-binding helix-two turn-helix domain [].; GO: 0003684 damaged DNA binding, 0003906 DNA-(apurinic or apyrimidinic site) lyase activity, 0008270 zinc ion binding, 0016799 hydrolase activity, hydrolyzing N-glycosyl compounds, 0006289 nucleotide-excision repair; PDB: 3GQ3_A 3JR5_A 3SAT_A 3GPX_A 2F5Q_A 3SBJ_A 3U6S_A 3SAU_A 3SAR_A 2F5P_A ....
Probab=31.73  E-value=47  Score=22.19  Aligned_cols=31  Identities=19%  Similarity=0.389  Sum_probs=24.7

Q ss_pred             CeecCcccceecCHHHHHHHHHhHHHH-HHHh
Q 033983           72 GKKFPGKKGISLSVDQWNTLRDHVEEI-NKAL  102 (106)
Q Consensus        72 Ge~~PgKKGISL~~eqw~~L~~~~~~I-d~ai  102 (106)
                      -..+|..+.-+|+.+||..|.+++..| ..||
T Consensus        51 a~i~P~~~~~~L~~~~~~~l~~~~~~vl~~ai   82 (92)
T PF06831_consen   51 AGIHPERPASSLSEEELRRLHEAIKRVLREAI   82 (92)
T ss_dssp             TTB-TTSBGGGSHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCCCccCccccCCHHHHHHHHHHHHHHHHHHH
Confidence            568899999999999999998887765 4444


No 24 
>PF02866 Ldh_1_C:  lactate/malate dehydrogenase, alpha/beta C-terminal domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase;  InterPro: IPR022383 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis []. L-lactate dehydrogenase is also found as a lens crystallin in bird and crocodile eyes. L-2-hydroxyisocaproate dehydrogenases are also members of the family. Malate dehydrogenases catalyse the interconversion of malate to oxaloacetate []. The enzyme participates in the citric acid cycle. This entry represents the C-terminal, and is thought to be an is an unusual alpha+beta fold.; GO: 0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor, 0055114 oxidation-reduction process; PDB: 4MDH_B 5MDH_A 1GV0_A 1GUZ_D 2EWD_B 2FRM_D 2FNZ_B 2FN7_B 2FM3_A 1LTH_T ....
Probab=31.12  E-value=65  Score=23.24  Aligned_cols=44  Identities=18%  Similarity=0.308  Sum_probs=34.4

Q ss_pred             eEEEeEEEEecCCeecCcccceecCHHHHHHHHHhHHHHHHHhhc
Q 033983           60 VWVDIREFYVKEGKKFPGKKGISLSVDQWNTLRDHVEEINKALGD  104 (106)
Q Consensus        60 ~~VdIREyY~kdGe~~PgKKGISL~~eqw~~L~~~~~~Id~ai~~  104 (106)
                      +|+.+---..++|-+.-= .++.|++++.+.|.+++..|.+.+++
T Consensus       126 v~~s~P~~ig~~Gv~~i~-~~~~L~~~E~~~l~~sa~~l~~~i~~  169 (174)
T PF02866_consen  126 VYFSVPVVIGKNGVEKIV-EDLPLSEEEQEKLKESAKELKKEIEK  169 (174)
T ss_dssp             EEEEEEEEEETTEEEEEE-CSBSSTHHHHHHHHHHHHHHHHHHHH
T ss_pred             ceecceEEEcCCeeEEEe-CCCCCCHHHHHHHHHHHHHHHHHHHH
Confidence            667777666678866651 24789999999999999999888764


No 25 
>TIGR03342 dsrC_tusE_dsvC sulfur relay protein, TusE/DsrC/DsvC family. Members of this protein family may be described as TusE, a partner to TusBCD in a sulfur relay system for 2-thiouridine biosynthesis, a tRNA base modification process. Other members are DsrC, a functionally similar protein in species where the sulfur relay system exists primarily for sulfur metabolism rather than tRNA base modification. Some members of this family are known explicitly as the gamma subunit of sulfite reductases.
Probab=30.23  E-value=62  Score=22.86  Aligned_cols=17  Identities=24%  Similarity=0.579  Sum_probs=13.6

Q ss_pred             ccceecCHHHHHHHHHh
Q 033983           78 KKGISLSVDQWNTLRDH   94 (106)
Q Consensus        78 KKGISL~~eqw~~L~~~   94 (106)
                      .-||.||.++|+.+.-.
T Consensus        33 ~egieLT~~Hw~vI~~l   49 (108)
T TIGR03342        33 EEGIELTEAHWEVINFL   49 (108)
T ss_pred             HcCCCCCHHHHHHHHHH
Confidence            56999999999876543


No 26 
>TIGR02675 tape_meas_nterm tape measure domain. Proteins containing this domain are strictly bacterial, including bacteriophage and prophage regions of bacterial genomes. Most members are 800 to 1800 amino acids long, making them among the longest predicted proteins of their respective phage genomes, where they are encoded in tail protein regions. This roughly 80-residue domain described here usually begins between residue 100 and 250. Many members are known or predicted to act as phage tail tape measure proteins, a minor tail component that regulates tail length.
Probab=30.03  E-value=66  Score=20.76  Aligned_cols=22  Identities=23%  Similarity=0.270  Sum_probs=18.6

Q ss_pred             cCHHHHHHHHHhHHHHHHHhhc
Q 033983           83 LSVDQWNTLRDHVEEINKALGD  104 (106)
Q Consensus        83 L~~eqw~~L~~~~~~Id~ai~~  104 (106)
                      |+.++|+.|.+.++.+-.+|.+
T Consensus        31 v~~ee~n~~~e~~p~~~~~lAk   52 (75)
T TIGR02675        31 LRGEEINSLLEALPGALQALAK   52 (75)
T ss_pred             ccHHHHHHHHHHhHHHHHHHHH
Confidence            7889999999999988777753


No 27 
>PF09655 Nitr_red_assoc:  Conserved nitrate reductase-associated protein (Nitr_red_assoc);  InterPro: IPR013481  Proteins in this entry are found in the Cyanobacteria, and are mostly encoded near nitrate reductase and molybdopterin biosynthesis genes. Molybdopterin guanine dinucleotide is a cofactor for nitrate reductase. These proteins are sometimes annotated as nitrate reductase-associated proteins, though their function is unknown.
Probab=30.00  E-value=21  Score=26.66  Aligned_cols=17  Identities=29%  Similarity=0.731  Sum_probs=14.1

Q ss_pred             cccceecCHHHHHHHHH
Q 033983           77 GKKGISLSVDQWNTLRD   93 (106)
Q Consensus        77 gKKGISL~~eqw~~L~~   93 (106)
                      ...||.++++||..|-.
T Consensus       102 ~~~gv~~t~~qW~~L~p  118 (144)
T PF09655_consen  102 QEFGVPLTLEQWAALTP  118 (144)
T ss_pred             HHcCCCCCHHHHhcCCH
Confidence            45799999999998854


No 28 
>PF11580 DUF3239:  Protein of unknown function (DUF3239);  InterPro: IPR021632  This entry contains possible membrane proteins, however this cannot be confirmed. Currently they have no known function. ; PDB: 3C8I_B.
Probab=28.28  E-value=34  Score=24.96  Aligned_cols=19  Identities=11%  Similarity=0.639  Sum_probs=15.0

Q ss_pred             ecCHHHHHHHHHhHHHHHH
Q 033983           82 SLSVDQWNTLRDHVEEINK  100 (106)
Q Consensus        82 SL~~eqw~~L~~~~~~Id~  100 (106)
                      +++.+||+.|..+++.|++
T Consensus       110 aIp~~eW~~L~~~~~r~~~  128 (128)
T PF11580_consen  110 AIPQEEWRQLEKNLKRLEQ  128 (128)
T ss_dssp             HS-HHHHHHHHHHGGGHHH
T ss_pred             hCCHHHHHHHHHHHhhhcC
Confidence            5788999999999887763


No 29 
>COG3530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.37  E-value=30  Score=22.98  Aligned_cols=29  Identities=38%  Similarity=0.673  Sum_probs=20.8

Q ss_pred             EeeeCCceEEEeEEEEe----cCCeecCccccee
Q 033983           53 VRNWQGKVWVDIREFYV----KEGKKFPGKKGIS   82 (106)
Q Consensus        53 V~~FkG~~~VdIREyY~----kdGe~~PgKKGIS   82 (106)
                      ...|+|+++||+-|-|.    ..| .-||+-|.-
T Consensus        16 FGKYqGR~liDLPe~YLlWFarkg-FP~G~lG~L   48 (71)
T COG3530          16 FGKYQGRVLIDLPEEYLLWFARKG-FPPGKLGRL   48 (71)
T ss_pred             cccccceeeecCCHHHHHHHHHhC-CCchHHHHH
Confidence            35799999999999664    345 556666543


No 30 
>PF08743 Nse4_C:  Nse4 C-terminal;  InterPro: IPR014854 Nse4 is a component of the Smc5/6 DNA repair complex. It forms interactions with Smc5 and Nse1 []. 
Probab=27.18  E-value=48  Score=22.16  Aligned_cols=16  Identities=25%  Similarity=0.657  Sum_probs=13.8

Q ss_pred             eecCHHHHHHHHHhHH
Q 033983           81 ISLSVDQWNTLRDHVE   96 (106)
Q Consensus        81 ISL~~eqw~~L~~~~~   96 (106)
                      ++|+.++|+.|.+...
T Consensus        69 ~~ld~~~W~~li~~~~   84 (93)
T PF08743_consen   69 LSLDYEDWQELIEKYN   84 (93)
T ss_pred             EEcCHHHHHHHHHHhC
Confidence            7999999999988653


No 31 
>PRK11508 sulfur transfer protein TusE; Provisional
Probab=26.91  E-value=76  Score=22.46  Aligned_cols=18  Identities=39%  Similarity=0.671  Sum_probs=13.9

Q ss_pred             ccceecCHHHHHHHHHhH
Q 033983           78 KKGISLSVDQWNTLRDHV   95 (106)
Q Consensus        78 KKGISL~~eqw~~L~~~~   95 (106)
                      .-||.||.++|+.+.-.-
T Consensus        34 ~egieLT~~HW~VI~~lR   51 (109)
T PRK11508         34 NEGISLSPEHWEVVRFVR   51 (109)
T ss_pred             HhCCCCCHHHHHHHHHHH
Confidence            469999999998765433


No 32 
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides. This subgroup includes members from all three forms of cellular life. Although the biochemical function has not been characterised for many of the members of this subgroup, the proteins from Yeast have been shown to be involved in secretion, peroxisome formation and gene expression.
Probab=26.55  E-value=90  Score=19.97  Aligned_cols=24  Identities=17%  Similarity=0.235  Sum_probs=20.6

Q ss_pred             ecCHHHHHHHHHhHHHHHHHhhcC
Q 033983           82 SLSVDQWNTLRDHVEEINKALGDN  105 (106)
Q Consensus        82 SL~~eqw~~L~~~~~~Id~ai~~~  105 (106)
                      .|+.++|..|...+..+..++.++
T Consensus        50 ~l~~~e~~~l~~~~~~v~~~l~~~   73 (103)
T cd01277          50 DLDPEELAELILAAKKVARALKKA   73 (103)
T ss_pred             hCCHHHHHHHHHHHHHHHHHHHHh
Confidence            489999999999999998888753


No 33 
>PF03102 NeuB:  NeuB family;  InterPro: IPR013132 NeuB is the prokaryotic N-acetylneuraminic acid synthase (Neu5Ac). It catalyses the direct formation of Neu5Ac (the most common sialic acid) by condensation of phosphoenolpyruvate (PEP) and N-acetylmannosamine (ManNAc). This reaction has only been observed in prokaryotes; eukaryotes synthesise the 9-phosphate form, Neu5Ac-9-P, and utilise ManNAc-6-P instead of ManNAc. Such eukaryotic enzymes are not present in this family []. This family also contains SpsE spore coat polysaccharide biosynthesis proteins.; GO: 0016051 carbohydrate biosynthetic process; PDB: 3G8R_B 1XUU_A 1XUZ_A 3CM4_A 2ZDR_A 1VLI_A 2WQP_A.
Probab=26.31  E-value=66  Score=25.35  Aligned_cols=25  Identities=36%  Similarity=0.547  Sum_probs=21.9

Q ss_pred             cceecCHHHHHHHHHhHHHHHHHhh
Q 033983           79 KGISLSVDQWNTLRDHVEEINKALG  103 (106)
Q Consensus        79 KGISL~~eqw~~L~~~~~~Id~ai~  103 (106)
                      -..||.|+|+..|.+.+..+..|+.
T Consensus       213 h~~Sl~p~el~~lv~~ir~~~~alG  237 (241)
T PF03102_consen  213 HKFSLEPDELKQLVRDIREVEKALG  237 (241)
T ss_dssp             GCCCB-HHHHHHHHHHHHHHHHHCS
T ss_pred             hhhcCCHHHHHHHHHHHHHHHHHcC
Confidence            4689999999999999999999885


No 34 
>PF11006 DUF2845:  Protein of unknown function (DUF2845);  InterPro: IPR021268  This bacterial family of proteins has no known function. 
Probab=26.28  E-value=1.2e+02  Score=19.96  Aligned_cols=28  Identities=11%  Similarity=0.137  Sum_probs=24.1

Q ss_pred             CcEEEEcCCceEEEEeeeCCceEEEeEE
Q 033983           39 DIVVCEISKNRRVSVRNWQGKVWVDIRE   66 (106)
Q Consensus        39 ~~~~~~Ls~~rrVtV~~FkG~~~VdIRE   66 (106)
                      +.++.+.+.++...+-.|.|-.++.|+.
T Consensus        58 E~W~Yn~Gp~~~~~~l~f~~Gkl~~I~~   85 (87)
T PF11006_consen   58 EEWTYNFGPNGFMQILTFENGKLVRIES   85 (87)
T ss_pred             eEEEEeCCCCCcEEEEEEECCEEEEEEe
Confidence            3567778999999999999999999973


No 35 
>TIGR03586 PseI pseudaminic acid synthase.
Probab=26.05  E-value=74  Score=26.23  Aligned_cols=24  Identities=33%  Similarity=0.471  Sum_probs=22.0

Q ss_pred             eecCHHHHHHHHHhHHHHHHHhhc
Q 033983           81 ISLSVDQWNTLRDHVEEINKALGD  104 (106)
Q Consensus        81 ISL~~eqw~~L~~~~~~Id~ai~~  104 (106)
                      .||+|+|+..|+..+..|..++..
T Consensus       236 ~Sl~p~e~~~lv~~ir~~~~~lg~  259 (327)
T TIGR03586       236 FSLEPDEFKALVKEVRNAWLALGE  259 (327)
T ss_pred             ccCCHHHHHHHHHHHHHHHHHhCC
Confidence            789999999999999999998864


No 36 
>PF08848 DUF1818:  Domain of unknown function (DUF1818);  InterPro: IPR014947 This entry represents a small family of uncharacterised cyanobacterial proteins. ; PDB: 2IT9_A 2NVN_A.
Probab=26.05  E-value=1e+02  Score=22.28  Aligned_cols=25  Identities=12%  Similarity=0.290  Sum_probs=21.3

Q ss_pred             eecCHHHHHHHHHhHHHHHHHhhcC
Q 033983           81 ISLSVDQWNTLRDHVEEINKALGDN  105 (106)
Q Consensus        81 ISL~~eqw~~L~~~~~~Id~ai~~~  105 (106)
                      |-||..+|+.|...+..+.+.+..+
T Consensus        29 iELT~~E~~~f~~Ll~~L~~q~~~i   53 (117)
T PF08848_consen   29 IELTEAEFNDFCRLLQQLAEQMQAI   53 (117)
T ss_dssp             EEE-HHHHHHHHHHHHHHHHHHHCC
T ss_pred             eeecHHHHHHHHHHHHHHHHHHHHH
Confidence            8899999999999999998887654


No 37 
>PF00840 Glyco_hydro_7:  Glycosyl hydrolase family 7;  InterPro: IPR001722 O-Glycosyl hydrolases 3.2.1. from EC are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families [, ]. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Glycoside hydrolase family 7 GH7 from CAZY comprises enzymes with several known activities; endoglucanase (3.2.1.4 from EC); cellobiohydrolase (3.2.1.91 from EC). These enzymes were formerly known as cellulase family C.  Exoglucanases and cellobiohydrolases [] play a role in the conversion of cellulose to glucose by cutting the dissaccharide cellobiose from the nonreducing end of the cellulose polymer chain. Structurally, cellulases and xylanases generally consist of a catalytic domain joined to a cellulose-binding domain (CBD) via a linker region that is rich in proline and/or hydroxy-amino acids. In type I exoglucanases, the CBD domain is found at the C-terminal extremity of these enzyme (this short domain forms a hairpin loop structure stabilised by 2 disulphide bridges).; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 2Y9N_A 2Y9L_A 2RFW_D 2RFZ_A 2RFY_D 2RG0_C 1EG1_C 1OVW_D 2OVW_A 4OVW_A ....
Probab=25.28  E-value=90  Score=27.23  Aligned_cols=47  Identities=21%  Similarity=0.347  Sum_probs=30.2

Q ss_pred             CceEEEEeeeCCc-----eEEEeEEEEecCCeecCccc----c----eecCHHHHHHHHH
Q 033983           47 KNRRVSVRNWQGK-----VWVDIREFYVKEGKKFPGKK----G----ISLSVDQWNTLRD   93 (106)
Q Consensus        47 ~~rrVtV~~FkG~-----~~VdIREyY~kdGe~~PgKK----G----ISL~~eqw~~L~~   93 (106)
                      .+++-.|..|-..     .|+-||-||..+|+..+..+    |    =||+.+-=.+-+.
T Consensus       280 tkkfTVVTQFit~~~t~G~L~EIrR~YVQnGkvI~n~~~~~~g~~~~nsItd~fC~~~~~  339 (433)
T PF00840_consen  280 TKKFTVVTQFITDDGTTGDLSEIRRLYVQNGKVIQNPKVNIPGLPGFNSITDEFCSAQKS  339 (433)
T ss_dssp             TSEEEEEEEEEETTSSTS-EEEEEEEEEETTEEEESSSEESTTSESSSSBSHHHHHHHHH
T ss_pred             CCccEEEEEeecCCCCccccceeeEEEEECCEEEeCCCcccCCCCCCCccCHHHHhhhcc
Confidence            4455557778654     49999999999998775432    2    2577664444444


No 38 
>COG2920 DsrC Dissimilatory sulfite reductase (desulfoviridin), gamma subunit [Inorganic ion transport and metabolism]
Probab=24.44  E-value=50  Score=23.80  Aligned_cols=20  Identities=25%  Similarity=0.768  Sum_probs=15.7

Q ss_pred             eecCcccceecCHHHHHHHH
Q 033983           73 KKFPGKKGISLSVDQWNTLR   92 (106)
Q Consensus        73 e~~PgKKGISL~~eqw~~L~   92 (106)
                      +++--.-||.||.++|+.++
T Consensus        31 e~lA~~e~i~LT~eHWevv~   50 (111)
T COG2920          31 EALAEREGIELTEEHWEVVR   50 (111)
T ss_pred             HHHHHHhccCccHHHHHHHH
Confidence            44555679999999998764


No 39 
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules. This MIT domain sub-family is found in the AAA protein spastin, a probable ATPase involved in the assembly or function of nuclear protein complexes; spastins might also be involved in microtubule dynamics. The molecular function of the MIT domain is unclear.
Probab=23.98  E-value=53  Score=21.88  Aligned_cols=31  Identities=19%  Similarity=0.258  Sum_probs=22.2

Q ss_pred             CeecCcccceecCHHHHHHHHHhHHHHHHHhhc
Q 033983           72 GKKFPGKKGISLSVDQWNTLRDHVEEINKALGD  104 (106)
Q Consensus        72 Ge~~PgKKGISL~~eqw~~L~~~~~~Id~ai~~  104 (106)
                      |--.|..  +.-+-+||+..+.....+..++.+
T Consensus        41 g~ai~~~--~~~~~~~w~~ar~~~~Km~~~~~~   71 (79)
T cd02679          41 GIAVPVP--SAGVGSQWERARRLQQKMKTNLNM   71 (79)
T ss_pred             HcCCCCC--cccccHHHHHHHHHHHHHHHHHHH
Confidence            4444542  455669999999999888887754


No 40 
>PRK13398 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=22.95  E-value=81  Score=25.10  Aligned_cols=24  Identities=25%  Similarity=0.400  Sum_probs=20.9

Q ss_pred             cceecCHHHHHHHHHhHHHHHHHh
Q 033983           79 KGISLSVDQWNTLRDHVEEINKAL  102 (106)
Q Consensus        79 KGISL~~eqw~~L~~~~~~Id~ai  102 (106)
                      --.||+++++..|.+.+..|.+++
T Consensus       243 ~~~sl~p~~l~~l~~~i~~~~~~~  266 (266)
T PRK13398        243 ARQTLNFEEMKELVDELKPMAKAL  266 (266)
T ss_pred             hhhcCCHHHHHHHHHHHHHHHhhC
Confidence            458899999999999999988764


No 41 
>PF11325 DUF3127:  Domain of unknown function (DUF3127);  InterPro: IPR021474  This bacterial family of proteins has no known function. 
Probab=22.49  E-value=88  Score=21.22  Aligned_cols=17  Identities=29%  Similarity=0.812  Sum_probs=14.3

Q ss_pred             EEEeeeCCceEEEeEEE
Q 033983           51 VSVRNWQGKVWVDIREF   67 (106)
Q Consensus        51 VtV~~FkG~~~VdIREy   67 (106)
                      +.-|+|.|+-|.|||-|
T Consensus        65 i~~RE~~gr~fn~i~aW   81 (84)
T PF11325_consen   65 IEGREWNGRWFNSIRAW   81 (84)
T ss_pred             eeccEecceEeeEeEEE
Confidence            34589999999999986


No 42 
>PRK06223 malate dehydrogenase; Reviewed
Probab=22.42  E-value=1.1e+02  Score=23.76  Aligned_cols=45  Identities=18%  Similarity=0.192  Sum_probs=33.0

Q ss_pred             eEEEeEEEEecCCeecCcccceecCHHHHHHHHHhHHHHHHHhhcCC
Q 033983           60 VWVDIREFYVKEGKKFPGKKGISLSVDQWNTLRDHVEEINKALGDNS  106 (106)
Q Consensus        60 ~~VdIREyY~kdGe~~PgKKGISL~~eqw~~L~~~~~~Id~ai~~~~  106 (106)
                      .++-+--...++|-..-  -.+.|+.++.+.|.+....|.+.+++++
T Consensus       263 ~~~s~P~~i~~~Gv~~i--~~~~l~~~e~~~l~~s~~~l~~~~~~~~  307 (307)
T PRK06223        263 VYVGVPVKLGKNGVEKI--IELELDDEEKAAFDKSVEAVKKLIEALK  307 (307)
T ss_pred             eEEEeEEEEeCCeEEEE--eCCCCCHHHHHHHHHHHHHHHHHHHhcC
Confidence            45555555555554333  2478999999999999999999988763


No 43 
>PF14164 YqzH:  YqzH-like protein
Probab=22.27  E-value=96  Score=20.27  Aligned_cols=18  Identities=33%  Similarity=0.739  Sum_probs=14.9

Q ss_pred             eecCHHHHHHHHHhHHHH
Q 033983           81 ISLSVDQWNTLRDHVEEI   98 (106)
Q Consensus        81 ISL~~eqw~~L~~~~~~I   98 (106)
                      +.|+.++|+.|.+.+..+
T Consensus        24 ~pls~~E~~~L~~~i~~~   41 (64)
T PF14164_consen   24 MPLSDEEWEELCKHIQER   41 (64)
T ss_pred             CCCCHHHHHHHHHHHHHH
Confidence            449999999999887664


No 44 
>TIGR03569 NeuB_NnaB N-acetylneuraminate synthase. This family is a subset of the Pfam model pfam03102 and is believed to include only authentic NeuB N-acetylneuraminate (sialic acid) synthase enzymes. The majority of the genes identified by this model are observed adjacent to both the NeuA and NeuC genes which together effect the biosynthesis of CMP-N-acetylneuraminate from UDP-N-acetylglucosamine.
Probab=21.85  E-value=97  Score=25.57  Aligned_cols=25  Identities=32%  Similarity=0.517  Sum_probs=22.5

Q ss_pred             ceecCHHHHHHHHHhHHHHHHHhhc
Q 033983           80 GISLSVDQWNTLRDHVEEINKALGD  104 (106)
Q Consensus        80 GISL~~eqw~~L~~~~~~Id~ai~~  104 (106)
                      -.||+++|+..|.+.+..+..++..
T Consensus       236 ~~Sl~p~el~~lv~~ir~~~~~lG~  260 (329)
T TIGR03569       236 KASLEPDELKEMVQGIRNVEKALGD  260 (329)
T ss_pred             hhcCCHHHHHHHHHHHHHHHHHcCC
Confidence            5899999999999999999998863


No 45 
>PRK08673 3-deoxy-7-phosphoheptulonate synthase; Reviewed
Probab=21.66  E-value=1e+02  Score=25.57  Aligned_cols=25  Identities=28%  Similarity=0.460  Sum_probs=22.1

Q ss_pred             ceecCHHHHHHHHHhHHHHHHHhhc
Q 033983           80 GISLSVDQWNTLRDHVEEINKALGD  104 (106)
Q Consensus        80 GISL~~eqw~~L~~~~~~Id~ai~~  104 (106)
                      -.||+++++..|++.+..|.+++.+
T Consensus       310 ~~sl~p~e~~~lv~~i~~i~~~~g~  334 (335)
T PRK08673        310 PQSLTPEEFEELMKKLRAIAEALGR  334 (335)
T ss_pred             hhcCCHHHHHHHHHHHHHHHHHhCC
Confidence            4789999999999999999998864


No 46 
>PRK13396 3-deoxy-7-phosphoheptulonate synthase; Provisional
Probab=21.33  E-value=1.1e+02  Score=25.82  Aligned_cols=25  Identities=28%  Similarity=0.454  Sum_probs=21.9

Q ss_pred             ceecCHHHHHHHHHhHHHHHHHhhc
Q 033983           80 GISLSVDQWNTLRDHVEEINKALGD  104 (106)
Q Consensus        80 GISL~~eqw~~L~~~~~~Id~ai~~  104 (106)
                      --||+++++..|.+.+..|..++.+
T Consensus       319 ~qsl~p~~~~~l~~~i~~i~~~~g~  343 (352)
T PRK13396        319 PQSLTPDRFDRLMQELAVIGKTVGR  343 (352)
T ss_pred             hhcCCHHHHHHHHHHHHHHHHHhCC
Confidence            3679999999999999999998864


No 47 
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three  branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases. Fhit plays a very important role in the development of tumours. Infact, Fhit deletions are among the earliest and most frequent genetic alterations in the development of tumours.
Probab=21.14  E-value=1.2e+02  Score=20.49  Aligned_cols=40  Identities=23%  Similarity=0.052  Sum_probs=29.4

Q ss_pred             eCCceEEEeEEEEecCCeecCcccceecCHHHHHHHHHhHHHHHHHhhc
Q 033983           56 WQGKVWVDIREFYVKEGKKFPGKKGISLSVDQWNTLRDHVEEINKALGD  104 (106)
Q Consensus        56 FkG~~~VdIREyY~kdGe~~PgKKGISL~~eqw~~L~~~~~~Id~ai~~  104 (106)
                      +.|.++|=-|+.+..         =..|++++|..|...+..+..+|++
T Consensus        33 ~~gh~lIiPk~H~~~---------~~~L~~~e~~~l~~~~~~v~~~l~~   72 (126)
T cd01275          33 NPGHVLVVPYRHVPR---------LEDLTPEEIADLFKLVQLAMKALKV   72 (126)
T ss_pred             CCCcEEEEeccccCC---------hhhCCHHHHHHHHHHHHHHHHHHHH
Confidence            456666666655432         2348999999999999988888875


No 48 
>COG2089 SpsE Sialic acid synthase [Cell envelope biogenesis, outer membrane]
Probab=20.82  E-value=1.1e+02  Score=25.97  Aligned_cols=25  Identities=32%  Similarity=0.638  Sum_probs=22.7

Q ss_pred             cceecCHHHHHHHHHhHHHHHHHhh
Q 033983           79 KGISLSVDQWNTLRDHVEEINKALG  103 (106)
Q Consensus        79 KGISL~~eqw~~L~~~~~~Id~ai~  103 (106)
                      --+||.|++|..|++++.++..||.
T Consensus       247 ~~fSldP~efk~mv~~ir~~~~alG  271 (347)
T COG2089         247 HAFSLDPDEFKEMVDAIRQVEKALG  271 (347)
T ss_pred             cceecCHHHHHHHHHHHHHHHHHhC
Confidence            4589999999999999999999885


No 49 
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional
Probab=20.42  E-value=64  Score=21.89  Aligned_cols=34  Identities=15%  Similarity=0.378  Sum_probs=23.1

Q ss_pred             eeCCceEEEeEEEEecCCeecCcccceecCHHHHHH
Q 033983           55 NWQGKVWVDIREFYVKEGKKFPGKKGISLSVDQWNT   90 (106)
Q Consensus        55 ~FkG~~~VdIREyY~kdGe~~PgKKGISL~~eqw~~   90 (106)
                      .|.-..+||||+-=+=.+.-.||  -|+++..++..
T Consensus        17 ~~~~~~lIDvR~~~ef~~ghIpG--AiniP~~~l~~   50 (104)
T PRK10287         17 VFAAEHWIDVRVPEQYQQEHVQG--AINIPLKEVKE   50 (104)
T ss_pred             ccCCCEEEECCCHHHHhcCCCCc--cEECCHHHHHH
Confidence            38889999999932213456787  47888666543


Done!