Citrus Sinensis ID: 033995


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MGRGVSSGGGQSSLGYLFSDGEAPKPAAKEGQAQNNAPTQKPAPVAQPVDITKQLPAGINSTSMNNYMRADGQNTGNFITDRPSTKVHAAPGGGSSLGYLFGGGSN
ccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccEEEcccccccccECcccccc
**********QSSLGYLFSD**************************************************DGQNTGNFITDRPSTKVHAAPGGGSSLGYLFGG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGVSSGGGQSSLGYLFSDGEAPKPAAKEGQAQNNAPTQKPAPVAQPVDITKQLPAGINSTSMNNYMRADGQNTGNFITDRPSTKVHAAPGGGSSLGYLFGGGSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein SPIRAL1-like 2 Acts redundantly with SPR1 in maintaining the cortical microtubules organization essential for anisotropic cell growth.confidentQ9LE54
Protein SPIRAL1-like 3 Acts in maintaining the cortical microtubules organization essential for anisotropic cell growth.probableQ2QQ99

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted