Citrus Sinensis ID: 033996

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------

MATFELYRRSTIGMCLTETLDEMVQNGTLTPELAIQVLVQFDKSMTEALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKSEELQETVGRVKIVACDSKLLSQ

ccHHHHHHHccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEEEEEcccEEEEEEccEEEEEcccEEccccEEEEEEccccccc

MATFELYRRSTIGMCLTETLDEMVQNGTLTPELAIQVLVQFDKSMTEALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKSEELQETVGRVKIVACDS*L***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MATFELYRRSTIGMCLTETLDEMVQNGTLTPELAIQVLVQFDKSMTEALETQVKSKVSIKGHLHTYRFCDNVWTFILQDALFKSEELQETVGRVKIVACDSKLLSQ

Annotation	Function Description	Confidence Level	Reference Protein
Transcription initiation factor IIA subunit 2	TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity.	confident	Q39236
Transcription initiation factor IIA subunit 2	TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with TBP mediates transcriptional activity (By similarity). Protein involved in the resistance to X.oryzae.	confident	Q0DLD3
Transcription initiation factor IIA subunit 2	TFIIA is a component of the transcription machinery of RNA polymerase II and plays an important role in transcriptional activation. TFIIA in a complex with tbp mediates transcriptional activity.	probable	Q54ND1

No EC number assigned to the protein, probably not an enzyme!

Template: 1NVP, chain D
Confidence level:very confident
Coverage over the Query: 4-100
View the alignment between query and template
View the model in PyMOL