Query         033997
Match_columns 106
No_of_seqs    102 out of 323
Neff          4.9 
Searched_HMMs 46136
Date          Fri Mar 29 08:38:19 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/033997.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/033997hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3399 Predicted Yippee-type  100.0 7.3E-52 1.6E-56  295.4  -1.9  104    3-106     8-113 (122)
  2 PF03226 Yippee-Mis18:  Yippee  100.0 2.4E-34 5.1E-39  194.3   6.1   89    9-103     2-94  (96)
  3 PF11648 RIG-I_C-RD:  C-termina  96.0  0.0031 6.8E-08   44.8   1.4   86    9-98      4-93  (123)
  4 PF01641 SelR:  SelR domain;  I  94.9   0.021 4.6E-07   41.2   2.4   72    7-85     35-106 (124)
  5 TIGR00357 methionine-R-sulfoxi  94.7   0.034 7.4E-07   40.6   3.1   66    7-80     38-104 (134)
  6 PRK00222 methionine sulfoxide   94.4   0.035 7.6E-07   41.0   2.6   68    7-81     41-108 (142)
  7 PRK05508 methionine sulfoxide   93.2   0.097 2.1E-06   37.7   3.0   64    7-80     31-94  (119)
  8 PRK05550 bifunctional methioni  91.3    0.16 3.5E-06   41.1   2.5   64    7-80     34-97  (283)
  9 PRK14018 trifunctional thiored  89.6    0.34 7.3E-06   42.1   3.2   68    7-81    416-483 (521)
 10 COG0229 Conserved domain frequ  86.0     1.1 2.4E-05   33.1   3.6   64    7-77     40-103 (140)
 11 PF14976 FAM72:  FAM72 protein   85.0       2 4.3E-05   32.1   4.5   62    9-82     15-88  (150)
 12 KOG0856 Predicted pilin-like t  81.2     1.4   3E-05   32.8   2.4   67    7-80     52-118 (146)
 13 PF09814 HECT_2:  HECT-like Ubi  79.4     3.3 7.2E-05   33.0   4.3   17    9-25    106-122 (354)
 14 PF11023 DUF2614:  Protein of u  55.5     4.5 9.8E-05   29.0   0.3   25    8-32     84-108 (114)
 15 PF13465 zf-H2C2_2:  Zinc-finge  55.2     7.6 0.00016   20.1   1.1   14    5-18     10-23  (26)
 16 PRK11586 napB nitrate reductas  40.9      17 0.00036   27.2   1.4   29    7-35    118-146 (149)
 17 KOG2272 Focal adhesion protein  40.7      18 0.00039   29.8   1.7   33    5-41    133-165 (332)
 18 COG3791 Uncharacterized conser  39.0      28 0.00061   24.6   2.3   21   62-82     66-86  (133)
 19 PRK05417 glutathione-dependent  38.9      54  0.0012   25.1   4.0   53   46-103    75-127 (191)
 20 PF00412 LIM:  LIM domain;  Int  36.8      17 0.00038   21.1   0.8   15    9-23     26-40  (58)
 21 TIGR00037 eIF_5A translation i  35.6      43 0.00094   23.9   2.8   30   31-60     35-64  (130)
 22 PF14353 CpXC:  CpXC protein     32.9      18  0.0004   24.9   0.5   47   39-87     14-60  (128)
 23 COG3043 NapB Nitrate reductase  32.6      27 0.00059   26.3   1.4   29    6-34    123-151 (155)
 24 PF03811 Zn_Tnp_IS1:  InsA N-te  32.6      27 0.00059   19.9   1.1   27   64-90      4-31  (36)
 25 PLN03107 eukaryotic translatio  31.9      51  0.0011   24.4   2.8   30   31-60     49-78  (159)
 26 PF06170 DUF983:  Protein of un  31.3      19 0.00042   24.1   0.4   23   11-41     10-32  (86)
 27 PRK03999 translation initiatio  31.1      58  0.0013   23.2   2.9   30   31-60     34-63  (129)
 28 KOG2462 C2H2-type Zn-finger pr  31.0      16 0.00034   29.9  -0.1   23    4-26    210-232 (279)
 29 TIGR02820 formald_GSH S-(hydro  30.8      60  0.0013   24.7   3.1   33   46-79     71-103 (182)
 30 PF10246 MRP-S35:  Mitochondria  30.4      30 0.00065   24.4   1.3   51   39-94     10-66  (104)
 31 PF04828 GFA:  Glutathione-depe  30.1      47   0.001   20.5   2.1   47   32-78     13-61  (92)
 32 PF14803 Nudix_N_2:  Nudix N-te  28.9      32  0.0007   19.3   1.0   14   67-80      2-15  (34)
 33 smart00132 LIM Zinc-binding do  28.6      22 0.00048   18.5   0.3   12    9-20     27-38  (39)
 34 PF13248 zf-ribbon_3:  zinc-rib  28.5      20 0.00042   18.7   0.1   11   65-75     16-26  (26)
 35 PF13842 Tnp_zf-ribbon_2:  DDE_  28.2      44 0.00095   18.4   1.4   15    8-22     15-29  (32)
 36 PF13912 zf-C2H2_6:  C2H2-type   28.1     6.9 0.00015   19.8  -1.8   17    9-25      1-17  (27)
 37 PF02945 Endonuclease_7:  Recom  27.4     7.8 0.00017   25.8  -2.0   20   57-78     46-65  (81)
 38 PF10058 DUF2296:  Predicted in  27.3      20 0.00044   22.1  -0.0   35   40-79      2-36  (54)
 39 PF00096 zf-C2H2:  Zinc finger,  27.3     9.3  0.0002   18.5  -1.3   16   10-25      1-16  (23)
 40 PF10955 DUF2757:  Protein of u  26.9      26 0.00056   23.4   0.4   16    9-24      4-19  (76)
 41 PRK00398 rpoP DNA-directed RNA  26.9      36 0.00079   19.6   1.0   16    8-23      2-17  (46)
 42 cd03523 NTR_like NTR_like doma  25.6 1.7E+02  0.0037   19.0   4.2   84   14-101     3-88  (105)
 43 PF13240 zinc_ribbon_2:  zinc-r  25.3      25 0.00054   18.0   0.1   10   66-75     14-23  (23)
 44 KOG2324 Prolyl-tRNA synthetase  24.7      59  0.0013   28.1   2.3   13   74-86    271-283 (457)
 45 PF12760 Zn_Tnp_IS1595:  Transp  24.6      57  0.0012   18.9   1.6   13    5-17     33-45  (46)
 46 TIGR03791 TTQ_mauG tryptophan   24.0      44 0.00095   26.9   1.3   33    3-35     17-51  (291)
 47 COG3721 HugX Putative heme iro  22.7      36 0.00078   26.0   0.6   37   23-59    121-162 (176)
 48 PF09855 DUF2082:  Nucleic-acid  21.9 1.4E+02  0.0031   19.0   3.1   10   10-19      1-10  (64)
 49 COG1996 RPC10 DNA-directed RNA  21.4      42 0.00091   20.6   0.6   13    7-19      4-16  (49)
 50 PF06397 Desulfoferrod_N:  Desu  20.9      49  0.0011   19.0   0.8   12    8-19      5-16  (36)
 51 PF03150 CCP_MauG:  Di-haem cyt  20.8      44 0.00095   24.4   0.7   30    3-32     16-47  (159)
 52 PF04246 RseC_MucC:  Positive r  20.5 1.2E+02  0.0026   21.0   2.9   45    8-53     15-59  (135)
 53 PRK04016 DNA-directed RNA poly  20.1      17 0.00037   23.4  -1.5   18   64-81      3-20  (62)
 54 TIGR00319 desulf_FeS4 desulfof  20.0      64  0.0014   17.5   1.1   12    8-19      6-17  (34)

No 1  
>KOG3399 consensus Predicted Yippee-type zinc-binding protein [General function prediction only]
Probab=100.00  E-value=7.3e-52  Score=295.44  Aligned_cols=104  Identities=59%  Similarity=1.116  Sum_probs=99.6

Q ss_pred             cccC-CceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceecEEEeeeecccCCCceeeEEEe
Q 033997            3 EMVG-PRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYER   81 (106)
Q Consensus         3 ~l~g-~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~~   81 (106)
                      +|++ ++.|+|++|+||||+++|||||+|+|++|+||||++|+||+.|+.|+|.|+||+|+|+||+|+.|++.|||||+.
T Consensus         8 ~l~~~~~~y~C~~C~thla~~~dliSksf~gr~G~AyLf~~vvNv~~ge~e~R~mlTG~h~V~di~C~~C~~~~GWkYe~   87 (122)
T KOG3399|consen    8 MLEANHRLYSCAHCKTHLARHDDLISKSFRGRTGRAYLFNRVVNVIIGETEQRVMLTGLHTVADIFCVLCGTGLGWKYEH   87 (122)
T ss_pred             HhccCCceEeccCCcccccchhhccccccccCCCcchhhhhhhhheechHHHHHHHHhHHhhcchhhhhcCCCcceeeee
Confidence            4555 368999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecccccccccceEEEEeccccccC-C
Q 033997           82 AYEETQKYKEGKFILEKSKIAKEN-W  106 (106)
Q Consensus        82 A~e~sqkYKEGkfIlE~~~i~~~~-w  106 (106)
                      |||+||||||||||||+++|.+++ |
T Consensus        88 a~e~sQkyKEGk~ilE~~~i~~~~g~  113 (122)
T KOG3399|consen   88 AYEKSQKYKEGKFILELAEIFKPEGW  113 (122)
T ss_pred             ccCchhhhcCcchHHHHHHhcCCCCc
Confidence            999999999999999999999976 5


No 2  
>PF03226 Yippee-Mis18:  Yippee zinc-binding/DNA-binding /Mis18, centromere assembly;  InterPro: IPR004910 This entry represents the Yippee-like (YPEL) family of putative zinc-binding proteins which is highly conserved among eukaryotes. The first protein in this family to be characterised, the Yippee protein from Drosophila, was identified by yeast interaction trap screen as a protein that physically interacts with moth hemolin []. It was subsequently found to be a member of a highly conserved family of proteins found in diverse eukaryotes including plants, animals and fungi []. Mammals contain five members of this family, YPEL1 to YPEL5, while other organisms tend to contain only two or three members. The mammalian proteins all appear to localise in the nucleus. YPEL1-4 are located in an unknown structure located on or close to the mitotic apparatus in the mitotic phase, whereas in the interphase they are located in the nuclei and nucleoli. In contrast, YPEL5 is localised to the centrosome and nucleus during interphase and at the mitotic spindle during mitosis, suggesting a function distinct from that of YPEL1-4. The localisation of the YPEL proteins suggests a novel, thopugh still unknown, function involved in cell division.
Probab=100.00  E-value=2.4e-34  Score=194.30  Aligned_cols=89  Identities=56%  Similarity=1.057  Sum_probs=85.2

Q ss_pred             eEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceec----EEEeeeecccCCCceeeEEEeecc
Q 033997            9 LYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGL----HTVADVFCSDCRVVLGWKYERAYE   84 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~----h~V~DI~C~~C~~~lGWkY~~A~e   84 (106)
                      +|.|++|++||+++++|+|  |+|+.|+||||+   ||..+++++|.|+||.    |+|+||+|++|++.|||||+.|++
T Consensus         2 vf~C~~C~t~l~ds~~lvs--~~g~~~~a~l~~---~v~~~~~~~~~~~t~~~~~~~~~~~l~C~~C~~~lGwkY~~a~~   76 (96)
T PF03226_consen    2 VFQCKNCKTILADSNELVS--FHGREGKAYLFN---NVSNGVPVDRELMTGETGGDHTVRDLFCSGCNTILGWKYESAPE   76 (96)
T ss_pred             EEECCCCCCCcCCHHHhee--cCCCCccEEEEe---eeeecccccceEEEeeCCCCEEEEEeEcccCChhHCcEEEEcCH
Confidence            7999999999999999999  999999999998   7778888999999999    999999999999999999999999


Q ss_pred             cccccccceEEEEeccccc
Q 033997           85 ETQKYKEGKFILEKSKIAK  103 (106)
Q Consensus        85 ~sqkYKEGkfIlE~~~i~~  103 (106)
                      + |+||||+||||++.|..
T Consensus        77 ~-~~~k~g~file~~~i~~   94 (96)
T PF03226_consen   77 E-QKYKEGKFILEKASISS   94 (96)
T ss_pred             h-HhhhCCEEEEEhhHEEE
Confidence            9 99999999999998863


No 3  
>PF11648 RIG-I_C-RD:  C-terminal domain of RIG-I;  InterPro: IPR021673  This family of proteins represents the regulatory domain RD of RIG-I, a protein which initiates a signalling cascade that provides essential antiviral protection for the host. The RD domain binds viral RNA, activating the RIG-I ATPase by RNA-dependent dimerisation. The structure of RD contains a zinc-binding domain and is thought to confer ligand specificity []. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2RQB_A 3GA3_A 2W4R_D 3EQT_A 2RQA_A 2RMJ_A 3NCU_A 2QFD_C 2QFB_D 3TMI_A ....
Probab=96.03  E-value=0.0031  Score=44.79  Aligned_cols=86  Identities=15%  Similarity=0.233  Sum_probs=57.4

Q ss_pred             eEEcccCcCCCCCCCCeeeeeecCCC----ceEEEeecccccccCCccceeeceecEEEeeeecccCCCceeeEEEeecc
Q 033997            9 LYSCCNCRNHVALHDDVISKSFQGRN----GRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYERAYE   84 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~liSk~f~G~~----G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~~A~e   84 (106)
                      .+.|++|.+.++..+||-.-  .++|    .+.  |...+.+...|.+.....-+.+....|+|..|+..+|-.+..---
T Consensus         4 ~llC~kC~~~~C~~~DIr~i--e~~hhv~v~p~--F~~~~~~~~~~~~~~~~~~d~~~~~~I~C~~C~~~wG~~m~yk~~   79 (123)
T PF11648_consen    4 KLLCRKCKKFACSGSDIRKI--ENSHHVVVDPE--FWERYIVRPHPKPLQKSFGDWEPNGKIHCKNCGQDWGIMMKYKGV   79 (123)
T ss_dssp             EEEETTTTCEEEEGGGEEEE--TTTEEEE-SHH--HHCTEEEEECSSCTSEEESSSEEEEEEEETSTSBEEEEEEEETTE
T ss_pred             EEECCCCCceeEchhheEEe--cCCcEEEcCcc--ceeeEEeccCCccccceecceEeCCEEEcCCCChHhhhheEECCc
Confidence            48899999999999998764  1111    222  335666666666544445588899999999999999987654332


Q ss_pred             cccccccceEEEEe
Q 033997           85 ETQKYKEGKFILEK   98 (106)
Q Consensus        85 ~sqkYKEGkfIlE~   98 (106)
                      +==-.|.-.|+++.
T Consensus        80 ~LP~L~iksfvv~~   93 (123)
T PF11648_consen   80 ELPCLKIKSFVVEL   93 (123)
T ss_dssp             EEEEE-GGGEEEEE
T ss_pred             cccEEEeeeeeeee
Confidence            22334555566443


No 4  
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=94.90  E-value=0.021  Score=41.15  Aligned_cols=72  Identities=21%  Similarity=0.409  Sum_probs=44.9

Q ss_pred             CceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceecEEEeeeecccCCCceeeEEEeeccc
Q 033997            7 PRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYERAYEE   85 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~~A~e~   85 (106)
                      .-+|.|+.|+++|=+++.    -|....|=.-.+..+..-.+...+|..  -|+.. ..|.|..|+..||=-......+
T Consensus        35 ~G~Y~C~~Cg~pLF~S~~----Kf~Sg~GWPSF~~~i~~~~v~~~~D~s--~g~~R-~Ev~C~~Cg~HLGHVF~DGp~~  106 (124)
T PF01641_consen   35 EGIYVCAVCGTPLFSSDT----KFDSGCGWPSFWQPIPGDAVKEREDFS--HGMVR-TEVRCARCGSHLGHVFDDGPPP  106 (124)
T ss_dssp             SEEEEETTTS-EEEEGGG----EETSSSSSSEESSCSSTTSEEEEEEEC--TSSEE-EEEEETTTCCEEEEEESTSSTT
T ss_pred             CEEEEcCCCCCccccCcc----cccCCcCCccccCcCChHHEEEecccc--CCceE-EEEEecCCCCccccEeCCCCCC
Confidence            348999999999987653    566555654445444332333333332  24544 4789999999999876655543


No 5  
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=94.68  E-value=0.034  Score=40.64  Aligned_cols=66  Identities=20%  Similarity=0.462  Sum_probs=42.3

Q ss_pred             CceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecc-cccccCCccceeeceecEEEeeeecccCCCceeeEEE
Q 033997            7 PRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHA-MNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYE   80 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v-~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~   80 (106)
                      +-+|.|+.|+++|-++++    -|.-..|=.-.+..+ -|. +...+|+.  -|+.. ..|.|..|+..||=-..
T Consensus        38 ~G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~~-V~~~~D~s--~gm~R-tEv~C~~Cg~HLGHVF~  104 (134)
T TIGR00357        38 EGIYVDITCGEPLFSSED----KFDSGCGWPSFYKPISEEV-VAYERDES--HGMIR-TEVRCRNCDAHLGHVFD  104 (134)
T ss_pred             CeEEEccCCCCccccccc----hhcCCCCCcCcCcccCCCc-eEEeecCC--CCcEE-EEEEecCCCCccCcccC
Confidence            347999999999988765    455555544444444 222 22333332  24444 47999999999997554


No 6  
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=94.39  E-value=0.035  Score=40.97  Aligned_cols=68  Identities=19%  Similarity=0.394  Sum_probs=43.4

Q ss_pred             CceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceecEEEeeeecccCCCceeeEEEe
Q 033997            7 PRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYER   81 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~~   81 (106)
                      +-+|.|+.|.++|=++++    -|.-..|=.-.+..+-.-.+...+|+.  -|+.. ..|.|..|+..||=-...
T Consensus        41 ~G~Y~C~~Cg~pLF~S~~----Kf~Sg~GWPSF~~~i~~~~V~~~~D~s--~gm~R-tEv~C~~Cg~HLGHVF~D  108 (142)
T PRK00222         41 KGIYVCIVCGEPLFSSDT----KFDSGCGWPSFTKPIDEEAIRELRDTS--HGMVR-TEVRCANCDSHLGHVFPD  108 (142)
T ss_pred             CeEEEecCCCchhcCCcc----cccCCCCCcCcCcccCCCceEEeeccC--CCceE-EEEEeCCCCCccCcccCC
Confidence            348999999999988754    566666655555554322222233332  23322 478999999999976543


No 7  
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=93.22  E-value=0.097  Score=37.66  Aligned_cols=64  Identities=22%  Similarity=0.438  Sum_probs=42.5

Q ss_pred             CceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceecEEEeeeecccCCCceeeEEE
Q 033997            7 PRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYE   80 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~   80 (106)
                      +-+|.|+.|.++|=++++    -|.-..|=.-.+..+-|. +...+|..   | + =..|.|..|+..||=-..
T Consensus        31 ~G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~-v~~~~D~~---~-~-RtEv~C~~C~~HLGHVF~   94 (119)
T PRK05508         31 KGTYVCKQCGAPLYRSED----KFKSGCGWPSFDDEIKGA-VKRIPDAD---G-R-RTEIVCANCGGHLGHVFE   94 (119)
T ss_pred             CeEEEecCCCCccccccc----cccCCCCCcccCcccccc-eEEEecCC---C-c-EEEEEeCCCCCccCcccC
Confidence            348999999999988765    566666654445554332 33334443   2 2 357999999999997443


No 8  
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional
Probab=91.28  E-value=0.16  Score=41.10  Aligned_cols=64  Identities=22%  Similarity=0.439  Sum_probs=42.1

Q ss_pred             CceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceecEEEeeeecccCCCceeeEEE
Q 033997            7 PRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYE   80 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~   80 (106)
                      +-+|.|+.|+++|=++++    -|.-.+|=.-.++.+-|-+.- .++..   |+  =..|.|..|++.||--..
T Consensus        34 ~G~y~c~~c~~~LF~s~~----Kf~sg~GWPsF~~~~~~~~~~-~~d~~---~~--R~Ev~c~~c~~HLGHvF~   97 (283)
T PRK05550         34 KGVYLCRRCGAPLFRSED----KFNSGCGWPSFDDEIPGAVKR-LPDAD---GR--RTEIVCANCGAHLGHVFE   97 (283)
T ss_pred             CcEEEcCCCCchhcCChh----hccCCCCCcCcCcccCCccEE-EEcCC---Cc--eEEEEecCCCCccCcccC
Confidence            348999999999988764    455555544446555443222 22222   32  478999999999997554


No 9  
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=89.62  E-value=0.34  Score=42.12  Aligned_cols=68  Identities=13%  Similarity=0.150  Sum_probs=44.2

Q ss_pred             CceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceecEEEeeeecccCCCceeeEEEe
Q 033997            7 PRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYER   81 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~~   81 (106)
                      +-+|.|+.|+++|=+++    .-|....|=.-.+..+-+-.+...+|.+  -|++. ..|.|..|++.||--...
T Consensus       416 ~G~y~c~~c~~pLf~s~----~Kf~sg~GWPsF~~~i~~~~v~~~~d~s--~g~~R-~Ev~c~~c~~HLGHvf~d  483 (521)
T PRK14018        416 PGIYVDVVSGEPLFSSA----DKYDSGCGWPSFTRPIDAKVVTEHDDFS--YNMRR-TEVRSRAADSHLGHVFPD  483 (521)
T ss_pred             CEEEEecCCCCccccCc----ccccCCCCCcccCcccCcCceEEeeccC--CCceE-EEEEECCCCCcCCcccCC
Confidence            44899999999998885    3566666655545544322233333332  24444 379999999999976544


No 10 
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=85.97  E-value=1.1  Score=33.12  Aligned_cols=64  Identities=25%  Similarity=0.457  Sum_probs=42.8

Q ss_pred             CceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceecEEEeeeecccCCCceee
Q 033997            7 PRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGW   77 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGW   77 (106)
                      +-+|.|+.|..+|=++++    -|.-..|=--.+.-+..-.+...+|+  .-|++.+ .|.|..|++.||=
T Consensus        40 ~GiY~c~~cg~pLF~S~~----KfdSgcGWPSF~~pi~~~~I~~~~D~--S~gM~Rt-EVrc~~c~sHLGH  103 (140)
T COG0229          40 KGIYVCIVCGEPLFSSED----KFDSGCGWPSFTKPISPDAITYKEDR--SHGMVRT-EVRCANCDSHLGH  103 (140)
T ss_pred             CceEEeecCCCccccccc----cccCCCCCccccccCCcccceEeecc--CCCcEEE-EEEecCCCCcccc
Confidence            348999999999988765    45555554444444444344444443  3455554 6899999999996


No 11 
>PF14976 FAM72:  FAM72 protein
Probab=84.95  E-value=2  Score=32.15  Aligned_cols=62  Identities=19%  Similarity=0.400  Sum_probs=39.3

Q ss_pred             eEEcccCcCCCCCCCCeeeeeecCCCceEEEeeccccccc----CCccceeeceec--------EEEeeeecccCCCcee
Q 033997            9 LYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVV----GPKEDRQLMTGL--------HTVADVFCSDCRVVLG   76 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~----g~~~~r~m~TG~--------h~V~DI~C~~C~~~lG   76 (106)
                      +..|+.|.+-|+...           =||-|..+ .|+..    -||....-.+|.        =.++|+-|.+|+..||
T Consensus        15 ~L~C~~C~~~l~~Rg-----------MkAvLLad-t~ieLySTD~~P~~~v~~vg~~y~t~~C~C~~~d~aC~~CGn~vG   82 (150)
T PF14976_consen   15 ILCCKFCDQVLCNRG-----------MKAVLLAD-TNIELYSTDIPPTNCVDFVGSCYFTRTCKCKIQDIACLGCGNIVG   82 (150)
T ss_pred             EEECCCCCchhccch-----------hhheeecC-CccEEEecCCCCcccccccccceecccCceEeeeeeeecCCCeee
Confidence            478999998887542           24555544 33332    222222323333        3899999999999999


Q ss_pred             eEEEee
Q 033997           77 WKYERA   82 (106)
Q Consensus        77 WkY~~A   82 (106)
                      +.....
T Consensus        83 YhV~~P   88 (150)
T PF14976_consen   83 YHVVVP   88 (150)
T ss_pred             eEEEEE
Confidence            887654


No 12 
>KOG0856 consensus Predicted pilin-like transcription factor [Posttranslational modification, protein turnover, chaperones]
Probab=81.22  E-value=1.4  Score=32.81  Aligned_cols=67  Identities=19%  Similarity=0.383  Sum_probs=39.0

Q ss_pred             CceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceecEEEeeeecccCCCceeeEEE
Q 033997            7 PRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYE   80 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~   80 (106)
                      +-+|.|+.|.++|-++.    .-|.-..|=--.|+.+-+=.+-..+|.+  -|.+ =.+|.|..|+..||--.+
T Consensus        52 ~GvY~C~~C~~pLykS~----tKfdsgcGWPAF~e~i~~gaI~r~~d~s--~~~~-R~Ev~Ca~C~~HLGHVF~  118 (146)
T KOG0856|consen   52 EGVYVCAGCGTPLYKST----TKFDSGCGWPAFFEAIGPGAITRTPDNS--RGGR-RTEVSCATCGGHLGHVFK  118 (146)
T ss_pred             CceEEEeecCCcccccc----ccccCCCCCchhhhccCCCceeeccccC--CCCc-ceEEEEeecCCceeeeec
Confidence            45899999999998764    3565555543334443111111111211  1122 347899999999997554


No 13 
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=79.42  E-value=3.3  Score=32.96  Aligned_cols=17  Identities=24%  Similarity=0.559  Sum_probs=13.9

Q ss_pred             eEEcccCcCCCCCCCCe
Q 033997            9 LYSCCNCRNHVALHDDV   25 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~l   25 (106)
                      .+.|++|+..|.....+
T Consensus       106 ~~~C~~C~~~li~~~~~  122 (354)
T PF09814_consen  106 SLCCRNCKNPLIPSRNF  122 (354)
T ss_pred             EEECCCCCCcccCcccc
Confidence            69999999999766543


No 14 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=55.51  E-value=4.5  Score=29.00  Aligned_cols=25  Identities=24%  Similarity=0.630  Sum_probs=21.7

Q ss_pred             ceEEcccCcCCCCCCCCeeeeeecC
Q 033997            8 RLYSCCNCRNHVALHDDVISKSFQG   32 (106)
Q Consensus         8 ~~y~C~~C~thLa~~~~liSk~f~G   32 (106)
                      |...|-+|++||+...++--|.|+-
T Consensus        84 r~D~CM~C~~pLTLd~~legkef~~  108 (114)
T PF11023_consen   84 RVDACMHCKEPLTLDPSLEGKEFDE  108 (114)
T ss_pred             hhhccCcCCCcCccCchhhcchhhH
Confidence            6789999999999999988887763


No 15 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=55.23  E-value=7.6  Score=20.11  Aligned_cols=14  Identities=29%  Similarity=0.774  Sum_probs=11.5

Q ss_pred             cCCceEEcccCcCC
Q 033997            5 VGPRLYSCCNCRNH   18 (106)
Q Consensus         5 ~g~~~y~C~~C~th   18 (106)
                      .|.++|.|..|..-
T Consensus        10 ~~~k~~~C~~C~k~   23 (26)
T PF13465_consen   10 TGEKPYKCPYCGKS   23 (26)
T ss_dssp             SSSSSEEESSSSEE
T ss_pred             CCCCCCCCCCCcCe
Confidence            57889999999753


No 16 
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=40.94  E-value=17  Score=27.22  Aligned_cols=29  Identities=28%  Similarity=0.595  Sum_probs=25.1

Q ss_pred             CceEEcccCcCCCCCCCCeeeeeecCCCc
Q 033997            7 PRLYSCCNCRNHVALHDDVISKSFQGRNG   35 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G   35 (106)
                      ++.|-|..|+++=+...-|+.-.|....|
T Consensus       118 prRYfCtQCHVPQada~PLV~N~F~~~~~  146 (149)
T PRK11586        118 PRRYFCLQCHVPQADTAPIVGNTFTPSKG  146 (149)
T ss_pred             ccceeeccccCccccCccCCCCCccchhh
Confidence            57899999999999999999999976443


No 17 
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton]
Probab=40.72  E-value=18  Score=29.80  Aligned_cols=33  Identities=24%  Similarity=0.606  Sum_probs=25.2

Q ss_pred             cCCceEEcccCcCCCCCCCCeeeeeecCCCceEEEee
Q 033997            5 VGPRLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFS   41 (106)
Q Consensus         5 ~g~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~   41 (106)
                      .|.-.|.|..|+.|+-. +.|   -|+|..--+|.|+
T Consensus       133 ~~~g~YvC~KCh~~iD~-~~l---~fr~d~yH~yHFk  165 (332)
T KOG2272|consen  133 KGRGRYVCQKCHAHIDE-QPL---TFRGDPYHPYHFK  165 (332)
T ss_pred             cccceeehhhhhhhccc-ccc---cccCCCCCcccee
Confidence            34458999999999977 334   3788888888887


No 18 
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=38.95  E-value=28  Score=24.56  Aligned_cols=21  Identities=24%  Similarity=0.572  Sum_probs=15.9

Q ss_pred             EEeeeecccCCCceeeEEEee
Q 033997           62 TVADVFCSDCRVVLGWKYERA   82 (106)
Q Consensus        62 ~V~DI~C~~C~~~lGWkY~~A   82 (106)
                      .+.-.||..|++.|-|+....
T Consensus        66 ~~~r~FC~~CGs~l~~~~~~~   86 (133)
T COG3791          66 SAGRGFCPTCGSPLFWRGPDE   86 (133)
T ss_pred             CCCCeecccCCCceEEecCCC
Confidence            344449999999999986543


No 19 
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=38.87  E-value=54  Score=25.09  Aligned_cols=53  Identities=9%  Similarity=0.097  Sum_probs=28.2

Q ss_pred             cccCCccceeeceecEEEeeeecccCCCceeeEEEeecccccccccceEEEEeccccc
Q 033997           46 IVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYERAYEETQKYKEGKFILEKSKIAK  103 (106)
Q Consensus        46 v~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~~A~e~sqkYKEGkfIlE~~~i~~  103 (106)
                      +..|+...+...+|.. +.--||..|++.|-+..+....+    -.|..+|=...+..
T Consensus        75 it~g~~~l~~y~ss~~-i~R~FC~~CGS~L~~~~e~~~~~----~pgl~fV~~gllDd  127 (191)
T PRK05417         75 VTANGDKLKVVDESAT-IQRHACKECGVHMYGRIENKDHP----FYGLDFVHTELSQE  127 (191)
T ss_pred             EEeCCcceEEEeCCCC-eEeeeCCCCCCccccccccccCC----CCCeEEEehhhcCC
Confidence            3335443333333333 44559999999998876622101    12566665554443


No 20 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=36.85  E-value=17  Score=21.06  Aligned_cols=15  Identities=20%  Similarity=0.603  Sum_probs=11.9

Q ss_pred             eEEcccCcCCCCCCC
Q 033997            9 LYSCCNCRNHVALHD   23 (106)
Q Consensus         9 ~y~C~~C~thLa~~~   23 (106)
                      -|.|..|+.+|...+
T Consensus        26 Cf~C~~C~~~l~~~~   40 (58)
T PF00412_consen   26 CFKCSKCGKPLNDGD   40 (58)
T ss_dssp             TSBETTTTCBTTTSS
T ss_pred             ccccCCCCCccCCCe
Confidence            478889998887765


No 21 
>TIGR00037 eIF_5A translation initiation factor eIF-5A. Observed in eukaryotes and archaea.
Probab=35.60  E-value=43  Score=23.86  Aligned_cols=30  Identities=23%  Similarity=0.189  Sum_probs=26.0

Q ss_pred             cCCCceEEEeecccccccCCccceeeceec
Q 033997           31 QGRNGRAFLFSHAMNIVVGPKEDRQLMTGL   60 (106)
Q Consensus        31 ~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~   60 (106)
                      .|+||.|+.--.+.|+..|...+....++.
T Consensus        35 pGkhG~A~vr~k~knl~tG~~~e~~f~s~~   64 (130)
T TIGR00037        35 PGKHGHAKARVVAIGIFTGKKLEFVSPSTS   64 (130)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEECCCC
Confidence            699999999999999999999887766655


No 22 
>PF14353 CpXC:  CpXC protein
Probab=32.95  E-value=18  Score=24.89  Aligned_cols=47  Identities=15%  Similarity=0.351  Sum_probs=30.9

Q ss_pred             EeecccccccCCccceeeceecEEEeeeecccCCCceeeEEEeeccccc
Q 033997           39 LFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKYERAYEETQ   87 (106)
Q Consensus        39 Lf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY~~A~e~sq   87 (106)
                      -+-..+|+...|.-...+++|.  +-...|..|+...---|.--|.+.+
T Consensus        14 ~v~~~I~~~~~p~l~e~il~g~--l~~~~CP~Cg~~~~~~~p~lY~D~~   60 (128)
T PF14353_consen   14 EVWTSINADEDPELKEKILDGS--LFSFTCPSCGHKFRLEYPLLYHDPE   60 (128)
T ss_pred             EEEeEEcCcCCHHHHHHHHcCC--cCEEECCCCCCceecCCCEEEEcCC
Confidence            3447888888886555566776  2334899999987655555554433


No 23 
>COG3043 NapB Nitrate reductase cytochrome c-type subunit [Energy production and conversion]
Probab=32.61  E-value=27  Score=26.27  Aligned_cols=29  Identities=24%  Similarity=0.498  Sum_probs=25.3

Q ss_pred             CCceEEcccCcCCCCCCCCeeeeeecCCC
Q 033997            6 GPRLYSCCNCRNHVALHDDVISKSFQGRN   34 (106)
Q Consensus         6 g~~~y~C~~C~thLa~~~~liSk~f~G~~   34 (106)
                      .+|.|-|..|+.+=|...-|+--.|..-.
T Consensus       123 SPRRYFClQCHVPQaD~kPlV~N~F~p~~  151 (155)
T COG3043         123 SPRRYFCLQCHVPQADVKPLVGNTFKPMK  151 (155)
T ss_pred             CccceeeeecccccccccccCCCCcccch
Confidence            47899999999999999999998887544


No 24 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=32.58  E-value=27  Score=19.87  Aligned_cols=27  Identities=26%  Similarity=0.469  Sum_probs=20.6

Q ss_pred             eeeecccCCCce-eeEEEeecccccccc
Q 033997           64 ADVFCSDCRVVL-GWKYERAYEETQKYK   90 (106)
Q Consensus        64 ~DI~C~~C~~~l-GWkY~~A~e~sqkYK   90 (106)
                      -||.|..|++.- --|+-+.-.-.|+|.
T Consensus         4 i~v~CP~C~s~~~v~k~G~~~~G~qryr   31 (36)
T PF03811_consen    4 IDVHCPRCQSTEGVKKNGKSPSGHQRYR   31 (36)
T ss_pred             EeeeCCCCCCCCcceeCCCCCCCCEeEe
Confidence            378999999988 667766666677763


No 25 
>PLN03107 eukaryotic translation initiation factor 5A; Provisional
Probab=31.88  E-value=51  Score=24.44  Aligned_cols=30  Identities=23%  Similarity=0.311  Sum_probs=26.6

Q ss_pred             cCCCceEEEeecccccccCCccceeeceec
Q 033997           31 QGRNGRAFLFSHAMNIVVGPKEDRQLMTGL   60 (106)
Q Consensus        31 ~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~   60 (106)
                      .|+||.|+.--.+.|+..|...+....++-
T Consensus        49 pGKHG~A~vr~k~knl~TG~k~e~~f~s~~   78 (159)
T PLN03107         49 TGKHGHAKCHFVAIDIFTGKKLEDIVPSSH   78 (159)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEecCCC
Confidence            799999999999999999999888777665


No 26 
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=31.32  E-value=19  Score=24.13  Aligned_cols=23  Identities=17%  Similarity=0.439  Sum_probs=18.6

Q ss_pred             EcccCcCCCCCCCCeeeeeecCCCceEEEee
Q 033997           11 SCCNCRNHVALHDDVISKSFQGRNGRAFLFS   41 (106)
Q Consensus        11 ~C~~C~thLa~~~~liSk~f~G~~G~AyLf~   41 (106)
                      +|.+|+.+++..+        ...|+||+.-
T Consensus        10 ~C~~CG~d~~~~~--------adDgPA~fvi   32 (86)
T PF06170_consen   10 RCPHCGLDYSHAR--------ADDGPAYFVI   32 (86)
T ss_pred             cccccCCccccCC--------cCccchhHHH
Confidence            6999999998776        5678888754


No 27 
>PRK03999 translation initiation factor IF-5A; Provisional
Probab=31.10  E-value=58  Score=23.16  Aligned_cols=30  Identities=23%  Similarity=0.177  Sum_probs=25.5

Q ss_pred             cCCCceEEEeecccccccCCccceeeceec
Q 033997           31 QGRNGRAFLFSHAMNIVVGPKEDRQLMTGL   60 (106)
Q Consensus        31 ~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~   60 (106)
                      .|+||.|+.--.+.|+..|...++...++.
T Consensus        34 pGkhg~a~vr~k~knL~tG~~~e~~~~s~d   63 (129)
T PRK03999         34 PGKHGSAKARIVAIGIFDGQKRSLVQPVDA   63 (129)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEecCCC
Confidence            789999999999999999988777766664


No 28 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=31.05  E-value=16  Score=29.90  Aligned_cols=23  Identities=22%  Similarity=0.491  Sum_probs=18.8

Q ss_pred             ccCCceEEcccCcCCCCCCCCee
Q 033997            4 MVGPRLYSCCNCRNHVALHDDVI   26 (106)
Q Consensus         4 l~g~~~y~C~~C~thLa~~~~li   26 (106)
                      -.|+++|.|.+|+.-+|..+.|-
T Consensus       210 HTGEKPF~C~hC~kAFADRSNLR  232 (279)
T KOG2462|consen  210 HTGEKPFSCPHCGKAFADRSNLR  232 (279)
T ss_pred             ccCCCCccCCcccchhcchHHHH
Confidence            36889999999998888777664


No 29 
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=30.85  E-value=60  Score=24.72  Aligned_cols=33  Identities=6%  Similarity=0.095  Sum_probs=19.5

Q ss_pred             cccCCccceeeceecEEEeeeecccCCCceeeEE
Q 033997           46 IVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKY   79 (106)
Q Consensus        46 v~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY   79 (106)
                      +..|....+....|.+..+ -||..|++.|-+..
T Consensus        71 i~~G~~~l~~Y~ss~~~~R-~FC~~CGS~L~~~~  103 (182)
T TIGR02820        71 VTANGDKLKVVDASATIQR-HACKGCGTHMYGRI  103 (182)
T ss_pred             EecCCcceEEEeCCCCEEe-ecCCCCCCcccccc
Confidence            3345544333334555444 49999999996544


No 30 
>PF10246 MRP-S35:  Mitochondrial ribosomal protein MRP-S35;  InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This is a family of short mitochondrial ribosomal proteins, less than 200 amino acids long. MRP-S35 was proposed as a more appropriate name to this group of proteins [].
Probab=30.40  E-value=30  Score=24.44  Aligned_cols=51  Identities=27%  Similarity=0.409  Sum_probs=31.7

Q ss_pred             EeecccccccCCccceeeceec--EEEeeeecccCCCceeeEEE----eecccccccccceE
Q 033997           39 LFSHAMNIVVGPKEDRQLMTGL--HTVADVFCSDCRVVLGWKYE----RAYEETQKYKEGKF   94 (106)
Q Consensus        39 Lf~~v~Nv~~g~~~~r~m~TG~--h~V~DI~C~~C~~~lGWkY~----~A~e~sqkYKEGkf   94 (106)
                      |+.+--=+..|+++++. ++|.  |+|.|--    ---+|||..    +....+++|.+|-=
T Consensus        10 lLR~S~fi~lG~~~gk~-V~G~I~hvv~ddL----YIDfG~KFhcVc~rp~~~~~~y~~G~r   66 (104)
T PF10246_consen   10 LLRNSPFIQLGDPEGKI-VIGKIFHVVDDDL----YIDFGGKFHCVCKRPAVNGEKYVRGSR   66 (104)
T ss_pred             HhcCChhhhcCCccCCE-EEEEEEEEecCce----EEEeCCceeEEEecccccccccccCCE
Confidence            33333345579988875 6776  8887621    123578764    33447788998853


No 31 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=30.10  E-value=47  Score=20.54  Aligned_cols=47  Identities=17%  Similarity=0.198  Sum_probs=21.6

Q ss_pred             CCCceEEEeecccccc--cCCccceeeceecEEEeeeecccCCCceeeE
Q 033997           32 GRNGRAFLFSHAMNIV--VGPKEDRQLMTGLHTVADVFCSDCRVVLGWK   78 (106)
Q Consensus        32 G~~G~AyLf~~v~Nv~--~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWk   78 (106)
                      |..-.++..-..-++.  .|+..-+.....-..+.-.+|..|++.|.+.
T Consensus        13 g~~~~~~~~~~~~~~~~~~g~~~l~~y~~s~~~~~r~FC~~CGs~l~~~   61 (92)
T PF04828_consen   13 GSPFSAWAIVPKDDFRWTSGSENLKEYQFSGKGVERYFCPTCGSPLFSE   61 (92)
T ss_dssp             T-SSEEEEEEEGGGEEEEE-GGGEEEC--TTSSCEEEEETTT--EEEEE
T ss_pred             CCceeeEEEEcccceEEeeccccceEEEeCCCcCcCcccCCCCCeeecc
Confidence            3333334433333443  3444333333123334558999999999875


No 32 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=28.93  E-value=32  Score=19.35  Aligned_cols=14  Identities=29%  Similarity=0.674  Sum_probs=7.1

Q ss_pred             ecccCCCceeeEEE
Q 033997           67 FCSDCRVVLGWKYE   80 (106)
Q Consensus        67 ~C~~C~~~lGWkY~   80 (106)
                      ||..|++.|-++..
T Consensus         2 fC~~CG~~l~~~ip   15 (34)
T PF14803_consen    2 FCPQCGGPLERRIP   15 (34)
T ss_dssp             B-TTT--B-EEE--
T ss_pred             ccccccChhhhhcC
Confidence            79999999988765


No 33 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=28.59  E-value=22  Score=18.51  Aligned_cols=12  Identities=17%  Similarity=0.794  Sum_probs=10.2

Q ss_pred             eEEcccCcCCCC
Q 033997            9 LYSCCNCRNHVA   20 (106)
Q Consensus         9 ~y~C~~C~thLa   20 (106)
                      -|.|..|+.+|+
T Consensus        27 Cf~C~~C~~~L~   38 (39)
T smart00132       27 CFKCSKCGKPLG   38 (39)
T ss_pred             CCCCcccCCcCc
Confidence            488999999886


No 34 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=28.52  E-value=20  Score=18.66  Aligned_cols=11  Identities=36%  Similarity=0.969  Sum_probs=6.7

Q ss_pred             eeecccCCCce
Q 033997           65 DVFCSDCRVVL   75 (106)
Q Consensus        65 DI~C~~C~~~l   75 (106)
                      +-||..|++.|
T Consensus        16 ~~fC~~CG~~L   26 (26)
T PF13248_consen   16 AKFCPNCGAKL   26 (26)
T ss_pred             cccChhhCCCC
Confidence            45677776654


No 35 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=28.19  E-value=44  Score=18.39  Aligned_cols=15  Identities=20%  Similarity=0.640  Sum_probs=12.3

Q ss_pred             ceEEcccCcCCCCCC
Q 033997            8 RLYSCCNCRNHVALH   22 (106)
Q Consensus         8 ~~y~C~~C~thLa~~   22 (106)
                      ..|.|..|..+|...
T Consensus        15 T~~~C~~C~v~lC~~   29 (32)
T PF13842_consen   15 TRYMCSKCDVPLCVE   29 (32)
T ss_pred             eEEEccCCCCcccCC
Confidence            469999999888754


No 36 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=28.12  E-value=6.9  Score=19.77  Aligned_cols=17  Identities=12%  Similarity=0.440  Sum_probs=12.4

Q ss_pred             eEEcccCcCCCCCCCCe
Q 033997            9 LYSCCNCRNHVALHDDV   25 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~l   25 (106)
                      +|.|..|+.-..+.+.+
T Consensus         1 ~~~C~~C~~~F~~~~~l   17 (27)
T PF13912_consen    1 PFECDECGKTFSSLSAL   17 (27)
T ss_dssp             SEEETTTTEEESSHHHH
T ss_pred             CCCCCccCCccCChhHH
Confidence            58899998877665544


No 37 
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=27.43  E-value=7.8  Score=25.82  Aligned_cols=20  Identities=35%  Similarity=0.689  Sum_probs=16.5

Q ss_pred             ceecEEEeeeecccCCCceeeE
Q 033997           57 MTGLHTVADVFCSDCRVVLGWK   78 (106)
Q Consensus        57 ~TG~h~V~DI~C~~C~~~lGWk   78 (106)
                      .||.  ||-+-|..|++.||.-
T Consensus        46 ~tG~--vRGlLC~~CN~~lG~~   65 (81)
T PF02945_consen   46 KTGR--VRGLLCRSCNTALGKV   65 (81)
T ss_dssp             TTTB--EEEEEEHHHHHHHHHC
T ss_pred             CCCC--chhhhhhHHhhhhccc
Confidence            3444  9999999999999974


No 38 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=27.35  E-value=20  Score=22.06  Aligned_cols=35  Identities=20%  Similarity=0.411  Sum_probs=24.4

Q ss_pred             eecccccccCCccceeeceecEEEeeeecccCCCceeeEE
Q 033997           40 FSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVVLGWKY   79 (106)
Q Consensus        40 f~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~lGWkY   79 (106)
                      |++++.+..|..+     |+...--.+-|..|.+.=|---
T Consensus         2 ~Dki~d~L~G~d~-----~~~~~r~aLIC~~C~~hNGla~   36 (54)
T PF10058_consen    2 FDKILDVLLGDDP-----TSPSNRYALICSKCFSHNGLAP   36 (54)
T ss_pred             hHHHHHHHhCCCC-----ccccCceeEECcccchhhcccc
Confidence            5778888888877     3333333456999999988643


No 39 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=27.25  E-value=9.3  Score=18.50  Aligned_cols=16  Identities=19%  Similarity=0.600  Sum_probs=11.6

Q ss_pred             EEcccCcCCCCCCCCe
Q 033997           10 YSCCNCRNHVALHDDV   25 (106)
Q Consensus        10 y~C~~C~thLa~~~~l   25 (106)
                      |.|..|+....+.++|
T Consensus         1 y~C~~C~~~f~~~~~l   16 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNL   16 (23)
T ss_dssp             EEETTTTEEESSHHHH
T ss_pred             CCCCCCCCccCCHHHH
Confidence            7899998877665544


No 40 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=26.92  E-value=26  Score=23.36  Aligned_cols=16  Identities=25%  Similarity=0.638  Sum_probs=13.3

Q ss_pred             eEEcccCcCCCCCCCC
Q 033997            9 LYSCCNCRNHVALHDD   24 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~   24 (106)
                      .|.|++|++.+.+-+.
T Consensus         4 ~Y~CRHCg~~IG~i~~   19 (76)
T PF10955_consen    4 HYYCRHCGTKIGTIDA   19 (76)
T ss_pred             EEEecCCCCEEEEeec
Confidence            4999999999877655


No 41 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=26.88  E-value=36  Score=19.62  Aligned_cols=16  Identities=31%  Similarity=0.802  Sum_probs=11.3

Q ss_pred             ceEEcccCcCCCCCCC
Q 033997            8 RLYSCCNCRNHVALHD   23 (106)
Q Consensus         8 ~~y~C~~C~thLa~~~   23 (106)
                      ..|.|.+|++.+...+
T Consensus         2 ~~y~C~~CG~~~~~~~   17 (46)
T PRK00398          2 AEYKCARCGREVELDE   17 (46)
T ss_pred             CEEECCCCCCEEEECC
Confidence            3688888888776543


No 42 
>cd03523 NTR_like NTR_like domain; a beta barrel with an oligosaccharide/oligonucleotide-binding fold found in netrins, complement proteins, tissue inhibitors of metalloproteases (TIMP), and procollagen C-proteinase enhancers (PCOLCE), amongst others. In netrins, the domain plays a role in controlling axon branching in neural development, while the common function of these modules in TIMPs appears to be binding to metzincins. A subset of this family is also known as the C345C domain because it occurs as a C-terminal domain in complement C3, C4 and C5. In C5, the domain interacts with various partners during the formation of the membrane attack complex.
Probab=25.57  E-value=1.7e+02  Score=19.01  Aligned_cols=84  Identities=12%  Similarity=0.207  Sum_probs=45.1

Q ss_pred             cCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccceeeceecEEEeeeecccCCCc--eeeEEEeeccccccccc
Q 033997           14 NCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKEDRQLMTGLHTVADVFCSDCRVV--LGWKYERAYEETQKYKE   91 (106)
Q Consensus        14 ~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~r~m~TG~h~V~DI~C~~C~~~--lGWkY~~A~e~sqkYKE   91 (106)
                      -|.++.+...-++|..-.+.. ..|-+ ++.+|.-+.........-...+.+..|..|...  +|=.|+-+=.....  .
T Consensus         3 ~C~sdyvi~~~V~~~~~~~~~-~~~~v-~v~~v~K~g~~~~~~~~~~~~~~~~~~~~c~~~l~~g~~YLImG~~~~~--~   78 (105)
T cd03523           3 FCKSDYVVRAKIKEIKEENDD-VKYEV-KIIKIYKTGKAKADKADLRFYYTAPACCPCHPILNPGREYLIMGKEEDS--Q   78 (105)
T ss_pred             cCcccEEEEEEEEEEEecCCc-EEEEE-EEEEEecCCCcccccccEEEEEeCCcccccCcccCCCceEEEEEeeecc--c
Confidence            366677777778787766543 22333 455554332221111111246667778777443  46777655543222  4


Q ss_pred             ceEEEEeccc
Q 033997           92 GKFILEKSKI  101 (106)
Q Consensus        92 GkfIlE~~~i  101 (106)
                      |+|+|.....
T Consensus        79 ~~~~l~~~s~   88 (105)
T cd03523          79 GGLVLDPLSF   88 (105)
T ss_pred             CcEEEcCccE
Confidence            8888865443


No 43 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=25.35  E-value=25  Score=18.01  Aligned_cols=10  Identities=40%  Similarity=1.069  Sum_probs=6.0

Q ss_pred             eecccCCCce
Q 033997           66 VFCSDCRVVL   75 (106)
Q Consensus        66 I~C~~C~~~l   75 (106)
                      .+|..|++.|
T Consensus        14 ~fC~~CG~~l   23 (23)
T PF13240_consen   14 KFCPNCGTPL   23 (23)
T ss_pred             cchhhhCCcC
Confidence            4577776653


No 44 
>KOG2324 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=24.69  E-value=59  Score=28.11  Aligned_cols=13  Identities=31%  Similarity=0.618  Sum_probs=10.2

Q ss_pred             ceeeEEEeecccc
Q 033997           74 VLGWKYERAYEET   86 (106)
Q Consensus        74 ~lGWkY~~A~e~s   86 (106)
                      .||=||-+++...
T Consensus       271 ~LG~kYS~~lna~  283 (457)
T KOG2324|consen  271 LLGTKYSKPLNAK  283 (457)
T ss_pred             EeccccccccCce
Confidence            6888998888655


No 45 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=24.65  E-value=57  Score=18.85  Aligned_cols=13  Identities=31%  Similarity=0.669  Sum_probs=8.1

Q ss_pred             cCCceEEcccCcC
Q 033997            5 VGPRLYSCCNCRN   17 (106)
Q Consensus         5 ~g~~~y~C~~C~t   17 (106)
                      .+...|.|+.|+.
T Consensus        33 ~~~~~~~C~~C~~   45 (46)
T PF12760_consen   33 KTRGRYRCKACRK   45 (46)
T ss_pred             CCCCeEECCCCCC
Confidence            3345677777764


No 46 
>TIGR03791 TTQ_mauG tryptophan tryptophylquinone biosynthesis enzyme MauG. Members of this protein family are the tryptophan tryptophylquinone biosynthesis (TTQ) enzyme MauG, as found in Methylobacterium extorquens and related species. This protein is required to complete the maturation of the TTQ cofactor in the methylamine dehydrogenase light (beta) chain.
Probab=24.03  E-value=44  Score=26.91  Aligned_cols=33  Identities=18%  Similarity=0.307  Sum_probs=22.5

Q ss_pred             cccCCceEEcccCcCCCCCCCC--eeeeeecCCCc
Q 033997            3 EMVGPRLYSCCNCRNHVALHDD--VISKSFQGRNG   35 (106)
Q Consensus         3 ~l~g~~~y~C~~C~thLa~~~~--liSk~f~G~~G   35 (106)
                      .|.+.+..+|+.|+.+-.-..+  .+|.+..|+.|
T Consensus        17 ~LS~~~~~SCasCH~p~~~~~d~~~~s~G~~g~~~   51 (291)
T TIGR03791        17 RLSRDGSMSCATCHNPGLGWSDGLILALGADGVEH   51 (291)
T ss_pred             ccCCCCCcCchhcCCccccCCCCcccccCCCCCCC
Confidence            3678889999999987654333  45666655443


No 47 
>COG3721 HugX Putative heme iron utilization protein [Inorganic ion transport and metabolism]
Probab=22.75  E-value=36  Score=25.98  Aligned_cols=37  Identities=27%  Similarity=0.499  Sum_probs=29.6

Q ss_pred             CCeeeeeecCCCceEEEee-----cccccccCCccceeecee
Q 033997           23 DDVISKSFQGRNGRAFLFS-----HAMNIVVGPKEDRQLMTG   59 (106)
Q Consensus        23 ~~liSk~f~G~~G~AyLf~-----~v~Nv~~g~~~~r~m~TG   59 (106)
                      =.++|+.|+|+.--..+|=     .+.-|.+|..+.|+|..+
T Consensus       121 Ialv~rpFmG~~s~si~Ffn~~G~~mfKiylgRDe~RqL~~e  162 (176)
T COG3721         121 IALVERPFMGMESASILFFNAQGEAMFKIYLGRDEHRQLLPE  162 (176)
T ss_pred             eeEeccccCCccceeeeeecccCceeeeeeeccchHhhhhHH
Confidence            3489999999998877775     356778899999988765


No 48 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=21.93  E-value=1.4e+02  Score=19.00  Aligned_cols=10  Identities=40%  Similarity=0.996  Sum_probs=7.4

Q ss_pred             EEcccCcCCC
Q 033997           10 YSCCNCRNHV   19 (106)
Q Consensus        10 y~C~~C~thL   19 (106)
                      |.|.+|+..-
T Consensus         1 y~C~KCg~~~   10 (64)
T PF09855_consen    1 YKCPKCGNEE   10 (64)
T ss_pred             CCCCCCCCcc
Confidence            6788998743


No 49 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=21.38  E-value=42  Score=20.61  Aligned_cols=13  Identities=31%  Similarity=0.715  Sum_probs=10.9

Q ss_pred             CceEEcccCcCCC
Q 033997            7 PRLYSCCNCRNHV   19 (106)
Q Consensus         7 ~~~y~C~~C~thL   19 (106)
                      ...|.|..|+..+
T Consensus         4 ~~~Y~C~~Cg~~~   16 (49)
T COG1996           4 MMEYKCARCGREV   16 (49)
T ss_pred             eEEEEhhhcCCee
Confidence            3569999999988


No 50 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=20.86  E-value=49  Score=19.00  Aligned_cols=12  Identities=42%  Similarity=0.985  Sum_probs=7.2

Q ss_pred             ceEEcccCcCCC
Q 033997            8 RLYSCCNCRNHV   19 (106)
Q Consensus         8 ~~y~C~~C~thL   19 (106)
                      .+|.|..|..-+
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            589999998754


No 51 
>PF03150 CCP_MauG:  Di-haem cytochrome c peroxidase;  InterPro: IPR004852 This is a group of distinct cytochrome c peroxidases (CCPs) that contain two haem groups. Similar to other cytochrome c peroxidases, they reduce hydrogen peroxide to water using c-type haem as an oxidizable substrate. However, since they possess two, instead of one, haem prosthetic groups, bacterial CCPs reduce hydrogen peroxide without the need to generate semi-stable free radicals. The two haem groups have significantly different redox potentials. The high potential (+320 mV) haem feeds electrons from electron shuttle proteins to the low potential (-330 mV) haem, where peroxide is reduced (indeed, the low potential site is known as the peroxidatic site) []. The CCP protein itself is structured into two domains, each containing one c-type haem group, with a calcium-binding site at the domain interface. This family also includes MauG proteins, whose similarity to di-haem CCP was previously recognised [].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1IQC_A 2VHD_B 1EB7_A 3RN0_A 3SVW_B 3RMZ_A 3SJL_B 3PXW_A 3SLE_B 3PXS_A ....
Probab=20.83  E-value=44  Score=24.42  Aligned_cols=30  Identities=23%  Similarity=0.444  Sum_probs=16.0

Q ss_pred             cccCCceEEcccCcCCCCCCCC--eeeeeecC
Q 033997            3 EMVGPRLYSCCNCRNHVALHDD--VISKSFQG   32 (106)
Q Consensus         3 ~l~g~~~y~C~~C~thLa~~~~--liSk~f~G   32 (106)
                      -|.+....+|+.|+.+=....+  -.|.+..|
T Consensus        16 ~LS~~~~~SCasCH~~~~~~td~~~~~~G~~g   47 (159)
T PF03150_consen   16 RLSGDGTVSCASCHDPEHGFTDGLAVSIGVGG   47 (159)
T ss_dssp             GGSTTSS--HHHHS-TTTTTS-SSSSBBEGGG
T ss_pred             ccCCCcCcCchhhCCCcccCCcccccCCCCCC
Confidence            3677889999999987533333  33444444


No 52 
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=20.48  E-value=1.2e+02  Score=20.98  Aligned_cols=45  Identities=20%  Similarity=0.413  Sum_probs=33.8

Q ss_pred             ceEEcccCcCCCCCCCCeeeeeecCCCceEEEeecccccccCCccc
Q 033997            8 RLYSCCNCRNHVALHDDVISKSFQGRNGRAFLFSHAMNIVVGPKED   53 (106)
Q Consensus         8 ~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~~~   53 (106)
                      |.=.|..|+.-=.-...++++.+.++. ..+...+-.|+..|+..+
T Consensus        15 r~saC~~C~~~~~Cg~~~~~~~~~~~~-~~~~~~~~~~~~~GD~V~   59 (135)
T PF04246_consen   15 RSSACGSCSASGGCGTGLLAKLFSGKP-ITFRAPNPIGAKVGDRVE   59 (135)
T ss_pred             cCCcCcccCCCCCCCcchhhhhcCCCc-EEEEecCCCCCCCCCEEE
Confidence            344699998666667778888888877 666667777888888754


No 53 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=20.07  E-value=17  Score=23.44  Aligned_cols=18  Identities=33%  Similarity=0.554  Sum_probs=14.9

Q ss_pred             eeeecccCCCceeeEEEe
Q 033997           64 ADVFCSDCRVVLGWKYER   81 (106)
Q Consensus        64 ~DI~C~~C~~~lGWkY~~   81 (106)
                      -+|.|-+|+..+|=+|++
T Consensus         3 iPvRCFTCGkvi~~~we~   20 (62)
T PRK04016          3 IPVRCFTCGKVIAEKWEE   20 (62)
T ss_pred             CCeEecCCCCChHHHHHH
Confidence            478999999999976654


No 54 
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=20.04  E-value=64  Score=17.47  Aligned_cols=12  Identities=42%  Similarity=0.916  Sum_probs=10.2

Q ss_pred             ceEEcccCcCCC
Q 033997            8 RLYSCCNCRNHV   19 (106)
Q Consensus         8 ~~y~C~~C~thL   19 (106)
                      ++|.|..|+.-+
T Consensus         6 ~~ykC~~Cgniv   17 (34)
T TIGR00319         6 QVYKCEVCGNIV   17 (34)
T ss_pred             cEEEcCCCCcEE
Confidence            589999998765


Done!