Citrus Sinensis ID: 034000


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MQWLNGSVRFSHSVRFTRLLSDANSRTKLFIGGLSYDTNETVLKDAFGQHGEIIEVKVICDRVTGQSRGYGFVKFASEAAAGEAIKEMDGLLLDGRNIRVNYAHKD
ccccccccccccccccccccccccccccEEEEcccccccHHHHHHHHHccccEEEEEEEEcccccccccEEEEEEccHHHHHHHHHHccccccccEEEEEEccccc
*********FSHSVRFTRLLSDANSRTKLFIGGLSYDTNETVLKDAFGQHGEIIEVKVICDRVTGQSRGYGFVKFASEAAAGEAIKEMDGLLLDGRNIRVNYA***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQWLNGSVRFSHSVRFTRLLSDANSRTKLFIGGLSYDTNETVLKDAFGQHGEIIEVKVICDRVTGQSRGYGFVKFASEAAAGEAIKEMDGLLLDGRNIRVNYAHKD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycine-rich RNA-binding protein 2, mitochondrial Possibly has a role in RNA transcription or processing during stress.probableQ9SVM8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CQD, chain A
Confidence level:very confident
Coverage over the Query: 20-105
View the alignment between query and template
View the model in PyMOL
Template: 3SXL, chain A
Confidence level:probable
Coverage over the Query: 1-91
View the alignment between query and template
View the model in PyMOL