Query         034010
Match_columns 106
No_of_seqs    105 out of 331
Neff          5.0 
Searched_HMMs 46136
Date          Fri Mar 29 08:47:44 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034010.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034010hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3399 Predicted Yippee-type  100.0 2.7E-50 5.8E-55  286.6  -2.5  102    3-104     8-110 (122)
  2 PF03226 Yippee-Mis18:  Yippee  100.0 5.6E-34 1.2E-38  192.2   6.0   88    9-102     2-93  (96)
  3 PF11648 RIG-I_C-RD:  C-termina  96.2  0.0023   5E-08   45.4   1.4   88    9-98      4-93  (123)
  4 TIGR00357 methionine-R-sulfoxi  94.9   0.035 7.5E-07   40.5   3.6   68    7-81     38-105 (134)
  5 PRK00222 methionine sulfoxide   94.9   0.027   6E-07   41.4   3.0   69    6-81     40-108 (142)
  6 PF01641 SelR:  SelR domain;  I  94.7   0.037   8E-07   39.8   3.2   72    7-85     35-106 (124)
  7 PRK05508 methionine sulfoxide   94.1   0.067 1.4E-06   38.4   3.5   64    7-80     31-94  (119)
  8 PRK05550 bifunctional methioni  92.9   0.096 2.1E-06   42.3   2.9   63    7-80     34-97  (283)
  9 PRK14018 trifunctional thiored  90.9    0.28   6E-06   42.6   3.7   70    6-82    415-484 (521)
 10 PF14976 FAM72:  FAM72 protein   88.4     1.2 2.5E-05   33.2   4.8   62    9-82     15-88  (150)
 11 KOG0856 Predicted pilin-like t  88.3    0.67 1.5E-05   34.3   3.5   65    7-80     52-118 (146)
 12 COG0229 Conserved domain frequ  83.1     2.2 4.7E-05   31.5   4.0   65    7-78     40-104 (140)
 13 PF09814 HECT_2:  HECT-like Ubi  77.7     4.5 9.8E-05   32.2   4.6   17    9-25    106-122 (354)
 14 PF11023 DUF2614:  Protein of u  54.5     5.2 0.00011   28.6   0.5   25    8-32     84-108 (114)
 15 PF13465 zf-H2C2_2:  Zinc-finge  47.5      11 0.00025   19.3   1.0   14    5-18     10-23  (26)
 16 KOG2462 C2H2-type Zn-finger pr  46.0     6.3 0.00014   32.0  -0.2   22    5-26    211-232 (279)
 17 PRK05417 glutathione-dependent  42.2      27 0.00059   26.7   2.8   35   45-80     74-108 (191)
 18 COG3791 Uncharacterized conser  40.4      20 0.00044   25.3   1.7   22   61-82     65-86  (133)
 19 PF04828 GFA:  Glutathione-depe  40.0      35 0.00076   21.1   2.7   31   48-78     31-61  (92)
 20 TIGR02820 formald_GSH S-(hydro  38.0      51  0.0011   25.0   3.7   34   45-79     70-103 (182)
 21 PF14803 Nudix_N_2:  Nudix N-te  37.9      19 0.00041   20.3   1.0   14   67-80      2-15  (34)
 22 PF10955 DUF2757:  Protein of u  37.4      13 0.00029   24.7   0.4   16    9-24      4-19  (76)
 23 PF03811 Zn_Tnp_IS1:  InsA N-te  37.2      22 0.00048   20.2   1.2   27   64-90      4-31  (36)
 24 TIGR00037 eIF_5A translation i  37.0      38 0.00081   24.1   2.7   31   31-61     35-65  (130)
 25 PRK11586 napB nitrate reductas  33.3      27 0.00058   26.0   1.5   28    7-34    118-145 (149)
 26 PF00412 LIM:  LIM domain;  Int  31.9      23  0.0005   20.5   0.8   15    9-23     26-40  (58)
 27 PF02945 Endonuclease_7:  Recom  31.2     8.1 0.00018   25.7  -1.4   16   63-78     50-65  (81)
 28 smart00132 LIM Zinc-binding do  31.0      20 0.00043   18.7   0.4   13    8-20     26-38  (39)
 29 KOG2272 Focal adhesion protein  29.0      32 0.00069   28.3   1.3   33    5-41    133-165 (332)
 30 KOG2324 Prolyl-tRNA synthetase  28.8      45 0.00097   28.7   2.2   13   74-86    271-283 (457)
 31 PF13912 zf-C2H2_6:  C2H2-type   28.7       6 0.00013   20.0  -1.9   18    9-26      1-18  (27)
 32 PF11682 DUF3279:  Protein of u  28.7      33 0.00073   24.8   1.3   18    8-25     27-44  (128)
 33 PF13248 zf-ribbon_3:  zinc-rib  28.5      19 0.00042   18.6   0.0   11   65-75     16-26  (26)
 34 PF10058 DUF2296:  Predicted in  28.1      22 0.00048   21.8   0.3   35   40-79      2-36  (54)
 35 PF00096 zf-C2H2:  Zinc finger,  28.0     8.2 0.00018   18.6  -1.4   16   10-25      1-16  (23)
 36 PF04246 RseC_MucC:  Positive r  27.1      86  0.0019   21.7   3.2   45    8-53     15-59  (135)
 37 PF10246 MRP-S35:  Mitochondria  26.7      41 0.00089   23.7   1.4   45   44-93     15-65  (104)
 38 PF06170 DUF983:  Protein of un  26.1      29 0.00062   23.2   0.5   23   11-41     10-32  (86)
 39 PF13240 zinc_ribbon_2:  zinc-r  26.0      23  0.0005   18.1   0.0   10   66-75     14-23  (23)
 40 PF03150 CCP_MauG:  Di-haem cyt  25.9      17 0.00038   26.5  -0.6   21    4-24     17-37  (159)
 41 TIGR03791 TTQ_mauG tryptophan   24.7      47   0.001   26.7   1.6   32    4-35     18-51  (291)
 42 PLN03107 eukaryotic translatio  24.4      92   0.002   23.0   3.0   31   31-61     49-79  (159)
 43 cd02669 Peptidase_C19M A subfa  24.3      61  0.0013   27.0   2.2   53    4-76     23-77  (440)
 44 PF13842 Tnp_zf-ribbon_2:  DDE_  24.2      64  0.0014   17.6   1.6   15    8-22     15-29  (32)
 45 PRK00398 rpoP DNA-directed RNA  24.0      43 0.00094   19.2   1.0   14    9-22      3-16  (46)
 46 COG3043 NapB Nitrate reductase  23.7      53  0.0011   24.6   1.6   30    6-35    123-152 (155)
 47 PF12760 Zn_Tnp_IS1595:  Transp  22.8      67  0.0015   18.5   1.7   12    6-17     34-45  (46)
 48 cd07973 Spt4 Transcription elo  22.6      39 0.00085   23.2   0.7   22   11-32     22-49  (98)
 49 PRK03999 translation initiatio  22.5 1.1E+02  0.0024   21.7   3.0   30   31-60     34-63  (129)
 50 TIGR01053 LSD1 zinc finger dom  22.2      63  0.0014   17.7   1.3   17    2-18     12-28  (31)
 51 TIGR00319 desulf_FeS4 desulfof  21.0      61  0.0013   17.5   1.2   13    8-20      6-18  (34)
 52 PF06397 Desulfoferrod_N:  Desu  20.9      53  0.0011   18.8   0.9   12    8-19      5-16  (36)
 53 cd00974 DSRD Desulforedoxin (D  20.9      62  0.0014   17.5   1.2   13    8-20      3-15  (34)
 54 smart00714 LITAF Possible memb  20.5      52  0.0011   20.3   0.9   11   67-77     54-64  (67)
 55 PF14353 CpXC:  CpXC protein     20.5      45 0.00098   22.9   0.7   46   40-87     15-60  (128)

No 1  
>KOG3399 consensus Predicted Yippee-type zinc-binding protein [General function prediction only]
Probab=100.00  E-value=2.7e-50  Score=286.57  Aligned_cols=102  Identities=45%  Similarity=0.919  Sum_probs=97.5

Q ss_pred             ccCC-CCEEEcccCCCCcCCCCCceecceeCCCCcEEEeecccccccCcceeeeeecccEEEeeeeeccCCCceeeEEEE
Q 034010            3 EFDG-RPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLR   81 (106)
Q Consensus         3 ~l~g-~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~~   81 (106)
                      ++.+ ++.|+|++|+||||.++|||||+|+|++|+||||++|+||+.|+.|+|.|+||+|+|+||+|+.|++.|||||+.
T Consensus         8 ~l~~~~~~y~C~~C~thla~~~dliSksf~gr~G~AyLf~~vvNv~~ge~e~R~mlTG~h~V~di~C~~C~~~~GWkYe~   87 (122)
T KOG3399|consen    8 MLEANHRLYSCAHCKTHLARHDDLISKSFRGRTGRAYLFNRVVNVIIGETEQRVMLTGLHTVADIFCVLCGTGLGWKYEH   87 (122)
T ss_pred             HhccCCceEeccCCcccccchhhccccccccCCCcchhhhhhhhheechHHHHHHHHhHHhhcchhhhhcCCCcceeeee
Confidence            3454 379999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecccCCceecCeEEEEeeccccc
Q 034010           82 AYDLKQKWKEGNFILEKFKMLKE  104 (106)
Q Consensus        82 A~e~sqkYKEGkfILE~~~i~~~  104 (106)
                      |||+||||||||||||+++|.++
T Consensus        88 a~e~sQkyKEGk~ilE~~~i~~~  110 (122)
T KOG3399|consen   88 AYEKSQKYKEGKFILELAEIFKP  110 (122)
T ss_pred             ccCchhhhcCcchHHHHHHhcCC
Confidence            99999999999999999999864


No 2  
>PF03226 Yippee-Mis18:  Yippee zinc-binding/DNA-binding /Mis18, centromere assembly;  InterPro: IPR004910 This entry represents the Yippee-like (YPEL) family of putative zinc-binding proteins which is highly conserved among eukaryotes. The first protein in this family to be characterised, the Yippee protein from Drosophila, was identified by yeast interaction trap screen as a protein that physically interacts with moth hemolin []. It was subsequently found to be a member of a highly conserved family of proteins found in diverse eukaryotes including plants, animals and fungi []. Mammals contain five members of this family, YPEL1 to YPEL5, while other organisms tend to contain only two or three members. The mammalian proteins all appear to localise in the nucleus. YPEL1-4 are located in an unknown structure located on or close to the mitotic apparatus in the mitotic phase, whereas in the interphase they are located in the nuclei and nucleoli. In contrast, YPEL5 is localised to the centrosome and nucleus during interphase and at the mitotic spindle during mitosis, suggesting a function distinct from that of YPEL1-4. The localisation of the YPEL proteins suggests a novel, thopugh still unknown, function involved in cell division.
Probab=100.00  E-value=5.6e-34  Score=192.24  Aligned_cols=88  Identities=43%  Similarity=0.836  Sum_probs=84.4

Q ss_pred             EEEcccCCCCcCCCCCceecceeCCCCcEEEeecccccccCcceeeeeeccc----EEEeeeeeccCCCceeeEEEEecc
Q 034010            9 FFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGM----YTIAKIYCSNCGQELGWHYLRAYD   84 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~----h~V~dI~C~~C~~~lGWkY~~A~e   84 (106)
                      +|.|++|++|||++++|+|  |+|+.|+||||+   ||..++++++.|+||.    |+|+||+|++|++.|||||+.|++
T Consensus         2 vf~C~~C~t~l~ds~~lvs--~~g~~~~a~l~~---~v~~~~~~~~~~~t~~~~~~~~~~~l~C~~C~~~lGwkY~~a~~   76 (96)
T PF03226_consen    2 VFQCKNCKTILADSNELVS--FHGREGKAYLFN---NVSNGVPVDRELMTGETGGDHTVRDLFCSGCNTILGWKYESAPE   76 (96)
T ss_pred             EEECCCCCCCcCCHHHhee--cCCCCccEEEEe---eeeecccccceEEEeeCCCCEEEEEeEcccCChhHCcEEEEcCH
Confidence            7999999999999999999  999999999998   7777888899999999    999999999999999999999999


Q ss_pred             cCCceecCeEEEEeeccc
Q 034010           85 LKQKWKEGNFILEKFKML  102 (106)
Q Consensus        85 ~sqkYKEGkfILE~~~i~  102 (106)
                      + |+||||+||||++.|.
T Consensus        77 ~-~~~k~g~file~~~i~   93 (96)
T PF03226_consen   77 E-QKYKEGKFILEKASIS   93 (96)
T ss_pred             h-HhhhCCEEEEEhhHEE
Confidence            9 9999999999999885


No 3  
>PF11648 RIG-I_C-RD:  C-terminal domain of RIG-I;  InterPro: IPR021673  This family of proteins represents the regulatory domain RD of RIG-I, a protein which initiates a signalling cascade that provides essential antiviral protection for the host. The RD domain binds viral RNA, activating the RIG-I ATPase by RNA-dependent dimerisation. The structure of RD contains a zinc-binding domain and is thought to confer ligand specificity []. ; GO: 0016817 hydrolase activity, acting on acid anhydrides; PDB: 2RQB_A 3GA3_A 2W4R_D 3EQT_A 2RQA_A 2RMJ_A 3NCU_A 2QFD_C 2QFB_D 3TMI_A ....
Probab=96.21  E-value=0.0023  Score=45.37  Aligned_cols=88  Identities=20%  Similarity=0.173  Sum_probs=59.4

Q ss_pred             EEEcccCCCCcCCCCCceecceeC--CCCcEEEeecccccccCcceeeeeecccEEEeeeeeccCCCceeeEEEEecccC
Q 034010            9 FFSCRNCLNPLAFHHDLISKTFKA--QTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLRAYDLK   86 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~liSk~f~G--~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~~A~e~s   86 (106)
                      .+-|++|.+.++..+||-.-.-+.  --.+.  |...+.+...|.+......+.+....|+|.+|+..+|-.+..---+=
T Consensus         4 ~llC~kC~~~~C~~~DIr~ie~~hhv~v~p~--F~~~~~~~~~~~~~~~~~~d~~~~~~I~C~~C~~~wG~~m~yk~~~L   81 (123)
T PF11648_consen    4 KLLCRKCKKFACSGSDIRKIENSHHVVVDPE--FWERYIVRPHPKPLQKSFGDWEPNGKIHCKNCGQDWGIMMKYKGVEL   81 (123)
T ss_dssp             EEEETTTTCEEEEGGGEEEETTTEEEE-SHH--HHCTEEEEECSSCTSEEESSSEEEEEEEETSTSBEEEEEEEETTEEE
T ss_pred             EEECCCCCceeEchhheEEecCCcEEEcCcc--ceeeEEeccCCccccceecceEeCCEEEcCCCChHhhhheEECCccc
Confidence            578999999999999986642110  01122  33566666666664445668899999999999999998776544444


Q ss_pred             CceecCeEEEEe
Q 034010           87 QKWKEGNFILEK   98 (106)
Q Consensus        87 qkYKEGkfILE~   98 (106)
                      .-.|.-.|.++.
T Consensus        82 P~L~iksfvv~~   93 (123)
T PF11648_consen   82 PCLKIKSFVVEL   93 (123)
T ss_dssp             EEE-GGGEEEEE
T ss_pred             cEEEeeeeeeee
Confidence            556666666443


No 4  
>TIGR00357 methionine-R-sulfoxide reductase. This model describes a domain found in PilB, a protein important for pilin expression, N-terminal to a domain coextensive to with the known peptide methionine sulfoxide reductase (MsrA), a protein repair enzyme, of E. coli. Among the early completed genomes, this module is found if and only if MsrA is also found, whether N-terminal to MsrA (as for Helicobacter pylori), C-terminal (as for Treponema pallidum), or in a separate polypeptide. Although the function of this region is not clear, an auxiliary function to MsrA is suggested.
Probab=94.92  E-value=0.035  Score=40.51  Aligned_cols=68  Identities=22%  Similarity=0.444  Sum_probs=42.2

Q ss_pred             CCEEEcccCCCCcCCCCCceecceeCCCCcEEEeecccccccCcceeeeeecccEEEeeeeeccCCCceeeEEEE
Q 034010            7 RPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLR   81 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~~   81 (106)
                      +-+|.|+.|+++|-+.++    -|....|=.-.+..+-.-.+...+|..  -|+.. ..|.|.+|+.+||--...
T Consensus        38 ~G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~~V~~~~D~s--~gm~R-tEv~C~~Cg~HLGHVF~D  105 (134)
T TIGR00357        38 EGIYVDITCGEPLFSSED----KFDSGCGWPSFYKPISEEVVAYERDES--HGMIR-TEVRCRNCDAHLGHVFDD  105 (134)
T ss_pred             CeEEEccCCCCccccccc----hhcCCCCCcCcCcccCCCceEEeecCC--CCcEE-EEEEecCCCCccCcccCC
Confidence            458999999999987764    466666633333443111122333322  24443 579999999999975543


No 5  
>PRK00222 methionine sulfoxide reductase B; Provisional
Probab=94.86  E-value=0.027  Score=41.41  Aligned_cols=69  Identities=20%  Similarity=0.413  Sum_probs=42.9

Q ss_pred             CCCEEEcccCCCCcCCCCCceecceeCCCCcEEEeecccccccCcceeeeeecccEEEeeeeeccCCCceeeEEEE
Q 034010            6 GRPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLR   81 (106)
Q Consensus         6 g~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~~   81 (106)
                      .+-+|.|+.|+++|=+.++    -|....|=.-.+..+-.-.+...+|+  .-|+.. ..|.|..|+.+||--...
T Consensus        40 ~~G~Y~C~~Cg~pLF~S~~----Kf~Sg~GWPSF~~~i~~~~V~~~~D~--s~gm~R-tEv~C~~Cg~HLGHVF~D  108 (142)
T PRK00222         40 EKGIYVCIVCGEPLFSSDT----KFDSGCGWPSFTKPIDEEAIRELRDT--SHGMVR-TEVRCANCDSHLGHVFPD  108 (142)
T ss_pred             CCeEEEecCCCchhcCCcc----cccCCCCCcCcCcccCCCceEEeecc--CCCceE-EEEEeCCCCCccCcccCC
Confidence            3458999999999987743    46666774443444322222222332  123322 579999999999986644


No 6  
>PF01641 SelR:  SelR domain;  InterPro: IPR002579 Peptide methionine sulphoxide reductase (Msr) reverses the inactivation of many proteins due to the oxidation of critical methionine residues by reducing methionine sulphoxide, Met(O), to methionine []. It is present in most living organisms, and the cognate structural gene belongs to the so-called minimum gene set [, ]. The domains: MsrA and MsrB, reduce different epimeric forms of methionine sulphoxide. This group represents MsrB, the crystal structure of which has been determined to 1.8A []. The overall structure shows no resemblance to the structures of MsrA (IPR002569 from INTERPRO) from other organisms; though the active sites show approximate mirror symmetry. In each case, conserved amino acid motifs mediate the stereo-specific recognition and reduction of the substrate. Unlike the MsrA domain, the MsrB domain activates the cysteine or selenocysteine nucleophile through a unique Cys-Arg-Asp/Glu catalytic triad. The collapse of the reaction intermediate most likely results in the formation of a sulphenic or selenenic acid moiety. Regeneration of the active site occurs through a series of thiol-disulphide exchange steps involving another active site Cys residue and thioredoxin. In a number of pathogenic bacteria, including Neisseria gonorrhoeae, the MsrA and MsrB domains are fused; the MsrA being N-terminal to MsrB. This arrangement is reversed in Treponema pallidum. In N. gonorrhoeae and Neisseria meningitidis, a thioredoxin domain is fused to the N terminus. This may function to reduce the active sites of the downstream MsrA and MsrB domains. ; GO: 0008113 peptide-methionine-(S)-S-oxide reductase activity, 0055114 oxidation-reduction process; PDB: 1L1D_A 3E0O_D 2KZN_A 3HCG_B 3HCH_A 2L1U_A 3MAO_A 2K8D_A 3HCJ_A 3HCI_A ....
Probab=94.70  E-value=0.037  Score=39.81  Aligned_cols=72  Identities=21%  Similarity=0.414  Sum_probs=44.2

Q ss_pred             CCEEEcccCCCCcCCCCCceecceeCCCCcEEEeecccccccCcceeeeeecccEEEeeeeeccCCCceeeEEEEeccc
Q 034010            7 RPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLRAYDL   85 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~~A~e~   85 (106)
                      +-+|.|+.|+++|=+.+    .-|....|=.-.+..+..-.+...+|..  -|+. -..|.|.+|+.+||=-......+
T Consensus        35 ~G~Y~C~~Cg~pLF~S~----~Kf~Sg~GWPSF~~~i~~~~v~~~~D~s--~g~~-R~Ev~C~~Cg~HLGHVF~DGp~~  106 (124)
T PF01641_consen   35 EGIYVCAVCGTPLFSSD----TKFDSGCGWPSFWQPIPGDAVKEREDFS--HGMV-RTEVRCARCGSHLGHVFDDGPPP  106 (124)
T ss_dssp             SEEEEETTTS-EEEEGG----GEETSSSSSSEESSCSSTTSEEEEEEEC--TSSE-EEEEEETTTCCEEEEEESTSSTT
T ss_pred             CEEEEcCCCCCccccCc----ccccCCcCCccccCcCChHHEEEecccc--CCce-EEEEEecCCCCccccEeCCCCCC
Confidence            45899999999987654    3477677733334443332233333322  2444 45689999999999866655443


No 7  
>PRK05508 methionine sulfoxide reductase B; Provisional
Probab=94.13  E-value=0.067  Score=38.38  Aligned_cols=64  Identities=28%  Similarity=0.550  Sum_probs=42.2

Q ss_pred             CCEEEcccCCCCcCCCCCceecceeCCCCcEEEeecccccccCcceeeeeecccEEEeeeeeccCCCceeeEEE
Q 034010            7 RPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYL   80 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~   80 (106)
                      +-+|.|+.|+++|=+.++    -|....|=.-.+..+-|. +...+|..   |  .-..|.|+.|+.+||--..
T Consensus        31 ~G~Y~C~~Cg~pLF~S~~----KfdSg~GWPSF~~~i~~~-v~~~~D~~---~--~RtEv~C~~C~~HLGHVF~   94 (119)
T PRK05508         31 KGTYVCKQCGAPLYRSED----KFKSGCGWPSFDDEIKGA-VKRIPDAD---G--RRTEIVCANCGGHLGHVFE   94 (119)
T ss_pred             CeEEEecCCCCccccccc----cccCCCCCcccCcccccc-eEEEecCC---C--cEEEEEeCCCCCccCcccC
Confidence            458999999999987754    477777733334444332 33333433   2  2467999999999997543


No 8  
>PRK05550 bifunctional methionine sulfoxide reductase B/A protein; Provisional
Probab=92.88  E-value=0.096  Score=42.26  Aligned_cols=63  Identities=30%  Similarity=0.600  Sum_probs=42.3

Q ss_pred             CCEEEcccCCCCcCCCCCceecceeCCCC-cEEEeecccccccCcceeeeeecccEEEeeeeeccCCCceeeEEE
Q 034010            7 RPFFSCRNCLNPLAFHHDLISKTFKAQTG-QAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYL   80 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G-~AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~   80 (106)
                      +-+|.|+.|+++|=++++    -|....| ++| +..+-|-.. ..++..   |+  -..|.|..|+++||--..
T Consensus        34 ~G~y~c~~c~~~LF~s~~----Kf~sg~GWPsF-~~~~~~~~~-~~~d~~---~~--R~Ev~c~~c~~HLGHvF~   97 (283)
T PRK05550         34 KGVYLCRRCGAPLFRSED----KFNSGCGWPSF-DDEIPGAVK-RLPDAD---GR--RTEIVCANCGAHLGHVFE   97 (283)
T ss_pred             CcEEEcCCCCchhcCChh----hccCCCCCcCc-CcccCCccE-EEEcCC---Cc--eEEEEecCCCCccCcccC
Confidence            458999999999987653    4666777 454 555544322 222222   33  478999999999998554


No 9  
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional
Probab=90.92  E-value=0.28  Score=42.55  Aligned_cols=70  Identities=11%  Similarity=0.096  Sum_probs=43.8

Q ss_pred             CCCEEEcccCCCCcCCCCCceecceeCCCCcEEEeecccccccCcceeeeeecccEEEeeeeeccCCCceeeEEEEe
Q 034010            6 GRPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLRA   82 (106)
Q Consensus         6 g~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~~A   82 (106)
                      .+-+|.|+.|+++|=+++    .-|....|=.-.+..+-+-.+...+|.  .-|++. ..|.|+.|+.+||--....
T Consensus       415 ~~G~y~c~~c~~pLf~s~----~Kf~sg~GWPsF~~~i~~~~v~~~~d~--s~g~~R-~Ev~c~~c~~HLGHvf~dg  484 (521)
T PRK14018        415 KPGIYVDVVSGEPLFSSA----DKYDSGCGWPSFTRPIDAKVVTEHDDF--SYNMRR-TEVRSRAADSHLGHVFPDG  484 (521)
T ss_pred             CCEEEEecCCCCccccCc----ccccCCCCCcccCcccCcCceEEeecc--CCCceE-EEEEECCCCCcCCcccCCC
Confidence            345899999999998775    347666773333333322222223332  224443 4799999999999866543


No 10 
>PF14976 FAM72:  FAM72 protein
Probab=88.36  E-value=1.2  Score=33.22  Aligned_cols=62  Identities=23%  Similarity=0.437  Sum_probs=39.0

Q ss_pred             EEEcccCCCCcCCCCCceecceeCCCCcEEEeeccccccc----Ccceeeeeeccc--------EEEeeeeeccCCCcee
Q 034010            9 FFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVL----GRKEDKQMITGM--------YTIAKIYCSNCGQELG   76 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~----g~~e~r~m~TG~--------h~V~dI~C~~C~~~lG   76 (106)
                      +..|++|.+-|+...           =||.|..+ .|+..    -||....-.+|.        =.++|+-|..|+..||
T Consensus        15 ~L~C~~C~~~l~~Rg-----------MkAvLLad-t~ieLySTD~~P~~~v~~vg~~y~t~~C~C~~~d~aC~~CGn~vG   82 (150)
T PF14976_consen   15 ILCCKFCDQVLCNRG-----------MKAVLLAD-TNIELYSTDIPPTNCVDFVGSCYFTRTCKCKIQDIACLGCGNIVG   82 (150)
T ss_pred             EEECCCCCchhccch-----------hhheeecC-CccEEEecCCCCcccccccccceecccCceEeeeeeeecCCCeee
Confidence            468999998876532           25655554 33332    122222223333        3699999999999999


Q ss_pred             eEEEEe
Q 034010           77 WHYLRA   82 (106)
Q Consensus        77 WkY~~A   82 (106)
                      +.++..
T Consensus        83 YhV~~P   88 (150)
T PF14976_consen   83 YHVVVP   88 (150)
T ss_pred             eEEEEE
Confidence            988754


No 11 
>KOG0856 consensus Predicted pilin-like transcription factor [Posttranslational modification, protein turnover, chaperones]
Probab=88.26  E-value=0.67  Score=34.32  Aligned_cols=65  Identities=23%  Similarity=0.486  Sum_probs=39.3

Q ss_pred             CCEEEcccCCCCcCCCCCceecceeCCCC-cEEEeecccccccCcceeeee-ecccEEEeeeeeccCCCceeeEEE
Q 034010            7 RPFFSCRNCLNPLAFHHDLISKTFKAQTG-QAYMFSNAMNVVLGRKEDKQM-ITGMYTIAKIYCSNCGQELGWHYL   80 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G-~AyLf~~v~Nv~~g~~e~r~m-~TG~h~V~dI~C~~C~~~lGWkY~   80 (106)
                      +-+|.|..|.++|-...    .-|....| +|| |+.+ +  .|....+.. .-|.+ =.+|.|..|+.+||--.+
T Consensus        52 ~GvY~C~~C~~pLykS~----tKfdsgcGWPAF-~e~i-~--~gaI~r~~d~s~~~~-R~Ev~Ca~C~~HLGHVF~  118 (146)
T KOG0856|consen   52 EGVYVCAGCGTPLYKST----TKFDSGCGWPAF-FEAI-G--PGAITRTPDNSRGGR-RTEVSCATCGGHLGHVFK  118 (146)
T ss_pred             CceEEEeecCCcccccc----ccccCCCCCchh-hhcc-C--CCceeeccccCCCCc-ceEEEEeecCCceeeeec
Confidence            46999999999997754    35766666 454 3322 1  222111111 11122 357899999999997544


No 12 
>COG0229 Conserved domain frequently associated with peptide methionine sulfoxide reductase [Posttranslational modification, protein turnover, chaperones]
Probab=83.09  E-value=2.2  Score=31.49  Aligned_cols=65  Identities=26%  Similarity=0.492  Sum_probs=41.5

Q ss_pred             CCEEEcccCCCCcCCCCCceecceeCCCCcEEEeecccccccCcceeeeeecccEEEeeeeeccCCCceeeE
Q 034010            7 RPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWH   78 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWk   78 (106)
                      +-+|.|+.|+.+|=++++    -|....|=--.+..+.+-.+...+|+  .-|++. ..|.|.+|+++||--
T Consensus        40 ~GiY~c~~cg~pLF~S~~----KfdSgcGWPSF~~pi~~~~I~~~~D~--S~gM~R-tEVrc~~c~sHLGHV  104 (140)
T COG0229          40 KGIYVCIVCGEPLFSSED----KFDSGCGWPSFTKPISPDAITYKEDR--SHGMVR-TEVRCANCDSHLGHV  104 (140)
T ss_pred             CceEEeecCCCccccccc----cccCCCCCccccccCCcccceEeecc--CCCcEE-EEEEecCCCCccccc
Confidence            459999999999977654    46666663222344333333334443  335544 368999999999963


No 13 
>PF09814 HECT_2:  HECT-like Ubiquitin-conjugating enzyme (E2)-binding;  InterPro: IPR019193 This entry consists of E3 ubiquitin-protein ligases which accept ubiquitin from specific E2 ubiquitin-conjugating enzymes, and transfer it to substrates, generally promoting their degradation by the proteasome [].
Probab=77.69  E-value=4.5  Score=32.17  Aligned_cols=17  Identities=41%  Similarity=0.864  Sum_probs=13.8

Q ss_pred             EEEcccCCCCcCCCCCc
Q 034010            9 FFSCRNCLNPLAFHHDL   25 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~l   25 (106)
                      .+.|++|++.|.....+
T Consensus       106 ~~~C~~C~~~li~~~~~  122 (354)
T PF09814_consen  106 SLCCRNCKNPLIPSRNF  122 (354)
T ss_pred             EEECCCCCCcccCcccc
Confidence            69999999999766543


No 14 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=54.46  E-value=5.2  Score=28.61  Aligned_cols=25  Identities=28%  Similarity=0.579  Sum_probs=21.6

Q ss_pred             CEEEcccCCCCcCCCCCceecceeC
Q 034010            8 PFFSCRNCLNPLAFHHDLISKTFKA   32 (106)
Q Consensus         8 ~~y~C~~C~thLa~~~~liSk~f~G   32 (106)
                      |...|-+|++||+...++--|.|+-
T Consensus        84 r~D~CM~C~~pLTLd~~legkef~~  108 (114)
T PF11023_consen   84 RVDACMHCKEPLTLDPSLEGKEFDE  108 (114)
T ss_pred             hhhccCcCCCcCccCchhhcchhhH
Confidence            5679999999999999998887763


No 15 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=47.47  E-value=11  Score=19.34  Aligned_cols=14  Identities=21%  Similarity=0.603  Sum_probs=11.1

Q ss_pred             CCCCEEEcccCCCC
Q 034010            5 DGRPFFSCRNCLNP   18 (106)
Q Consensus         5 ~g~~~y~C~~C~th   18 (106)
                      .|++.|.|..|..-
T Consensus        10 ~~~k~~~C~~C~k~   23 (26)
T PF13465_consen   10 TGEKPYKCPYCGKS   23 (26)
T ss_dssp             SSSSSEEESSSSEE
T ss_pred             CCCCCCCCCCCcCe
Confidence            36789999999753


No 16 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=46.01  E-value=6.3  Score=32.05  Aligned_cols=22  Identities=32%  Similarity=0.544  Sum_probs=19.3

Q ss_pred             CCCCEEEcccCCCCcCCCCCce
Q 034010            5 DGRPFFSCRNCLNPLAFHHDLI   26 (106)
Q Consensus         5 ~g~~~y~C~~C~thLa~~~~li   26 (106)
                      -|+++|+|.+|+.-+|..+.|-
T Consensus       211 TGEKPF~C~hC~kAFADRSNLR  232 (279)
T KOG2462|consen  211 TGEKPFSCPHCGKAFADRSNLR  232 (279)
T ss_pred             cCCCCccCCcccchhcchHHHH
Confidence            4889999999999999888775


No 17 
>PRK05417 glutathione-dependent formaldehyde-activating enzyme; Provisional
Probab=42.21  E-value=27  Score=26.68  Aligned_cols=35  Identities=20%  Similarity=0.239  Sum_probs=21.2

Q ss_pred             ccccCcceeeeeecccEEEeeeeeccCCCceeeEEE
Q 034010           45 NVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYL   80 (106)
Q Consensus        45 Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~   80 (106)
                      .+..|+...+...+|. .+.--||..|++.|-+..+
T Consensus        74 ~it~g~~~l~~y~ss~-~i~R~FC~~CGS~L~~~~e  108 (191)
T PRK05417         74 TVTANGDKLKVVDESA-TIQRHACKECGVHMYGRIE  108 (191)
T ss_pred             EEEeCCcceEEEeCCC-CeEeeeCCCCCCccccccc
Confidence            3433544333333333 3455599999999988776


No 18 
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=40.45  E-value=20  Score=25.26  Aligned_cols=22  Identities=23%  Similarity=0.572  Sum_probs=16.5

Q ss_pred             EEEeeeeeccCCCceeeEEEEe
Q 034010           61 YTIAKIYCSNCGQELGWHYLRA   82 (106)
Q Consensus        61 h~V~dI~C~~C~~~lGWkY~~A   82 (106)
                      ..+.-.||..|+++|-|+....
T Consensus        65 ~~~~r~FC~~CGs~l~~~~~~~   86 (133)
T COG3791          65 GSAGRGFCPTCGSPLFWRGPDE   86 (133)
T ss_pred             CCCCCeecccCCCceEEecCCC
Confidence            3344449999999999986554


No 19 
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=39.99  E-value=35  Score=21.11  Aligned_cols=31  Identities=19%  Similarity=0.356  Sum_probs=16.6

Q ss_pred             cCcceeeeeecccEEEeeeeeccCCCceeeE
Q 034010           48 LGRKEDKQMITGMYTIAKIYCSNCGQELGWH   78 (106)
Q Consensus        48 ~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWk   78 (106)
                      .|+..-+........+.-.+|.+|++.|.+.
T Consensus        31 ~g~~~l~~y~~s~~~~~r~FC~~CGs~l~~~   61 (92)
T PF04828_consen   31 SGSENLKEYQFSGKGVERYFCPTCGSPLFSE   61 (92)
T ss_dssp             E-GGGEEEC--TTSSCEEEEETTT--EEEEE
T ss_pred             eccccceEEEeCCCcCcCcccCCCCCeeecc
Confidence            4544444344233445558999999999976


No 20 
>TIGR02820 formald_GSH S-(hydroxymethyl)glutathione synthase. The formation of S-(hydroxymethyl)glutathione synthase from glutathione and formaldehyde occurs naturally, but this enzyme speeds its formation in some species as part of a pathway of formaldehyde detoxification.
Probab=38.05  E-value=51  Score=25.04  Aligned_cols=34  Identities=15%  Similarity=0.153  Sum_probs=20.0

Q ss_pred             ccccCcceeeeeecccEEEeeeeeccCCCceeeEE
Q 034010           45 NVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHY   79 (106)
Q Consensus        45 Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY   79 (106)
                      .+..|+........|.+..+ -||..|++.|-+..
T Consensus        70 ~i~~G~~~l~~Y~ss~~~~R-~FC~~CGS~L~~~~  103 (182)
T TIGR02820        70 TVTANGDKLKVVDASATIQR-HACKGCGTHMYGRI  103 (182)
T ss_pred             EEecCCcceEEEeCCCCEEe-ecCCCCCCcccccc
Confidence            34345444333334545444 49999999996654


No 21 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=37.87  E-value=19  Score=20.25  Aligned_cols=14  Identities=29%  Similarity=0.797  Sum_probs=7.3

Q ss_pred             eeccCCCceeeEEE
Q 034010           67 YCSNCGQELGWHYL   80 (106)
Q Consensus        67 ~C~~C~~~lGWkY~   80 (106)
                      ||..|++.|-++..
T Consensus         2 fC~~CG~~l~~~ip   15 (34)
T PF14803_consen    2 FCPQCGGPLERRIP   15 (34)
T ss_dssp             B-TTT--B-EEE--
T ss_pred             ccccccChhhhhcC
Confidence            89999999988876


No 22 
>PF10955 DUF2757:  Protein of unknown function (DUF2757);  InterPro: IPR020115 This entry contains proteins with no known function.
Probab=37.44  E-value=13  Score=24.68  Aligned_cols=16  Identities=19%  Similarity=0.553  Sum_probs=13.6

Q ss_pred             EEEcccCCCCcCCCCC
Q 034010            9 FFSCRNCLNPLAFHHD   24 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~   24 (106)
                      .|.|+||++.+..-+.
T Consensus         4 ~Y~CRHCg~~IG~i~~   19 (76)
T PF10955_consen    4 HYYCRHCGTKIGTIDA   19 (76)
T ss_pred             EEEecCCCCEEEEeec
Confidence            4999999999987665


No 23 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=37.25  E-value=22  Score=20.19  Aligned_cols=27  Identities=11%  Similarity=0.226  Sum_probs=21.5

Q ss_pred             eeeeeccCCCce-eeEEEEecccCCcee
Q 034010           64 AKIYCSNCGQEL-GWHYLRAYDLKQKWK   90 (106)
Q Consensus        64 ~dI~C~~C~~~l-GWkY~~A~e~sqkYK   90 (106)
                      -||.|..|.+.- --|.-+...-.|+|.
T Consensus         4 i~v~CP~C~s~~~v~k~G~~~~G~qryr   31 (36)
T PF03811_consen    4 IDVHCPRCQSTEGVKKNGKSPSGHQRYR   31 (36)
T ss_pred             EeeeCCCCCCCCcceeCCCCCCCCEeEe
Confidence            478999999988 777777777777774


No 24 
>TIGR00037 eIF_5A translation initiation factor eIF-5A. Observed in eukaryotes and archaea.
Probab=36.99  E-value=38  Score=24.11  Aligned_cols=31  Identities=16%  Similarity=0.108  Sum_probs=25.9

Q ss_pred             eCCCCcEEEeecccccccCcceeeeeecccE
Q 034010           31 KAQTGQAYMFSNAMNVVLGRKEDKQMITGMY   61 (106)
Q Consensus        31 ~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h   61 (106)
                      .|+||.|+.--.+.|+..|..-+..+.++--
T Consensus        35 pGkhG~A~vr~k~knl~tG~~~e~~f~s~~~   65 (130)
T TIGR00037        35 PGKHGHAKARVVAIGIFTGKKLEFVSPSTSK   65 (130)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEECCCCE
Confidence            6889999999999999999988777665543


No 25 
>PRK11586 napB nitrate reductase cytochrome C550 subunit; Provisional
Probab=33.34  E-value=27  Score=26.05  Aligned_cols=28  Identities=21%  Similarity=0.407  Sum_probs=24.6

Q ss_pred             CCEEEcccCCCCcCCCCCceecceeCCC
Q 034010            7 RPFFSCRNCLNPLAFHHDLISKTFKAQT   34 (106)
Q Consensus         7 ~~~y~C~~C~thLa~~~~liSk~f~G~~   34 (106)
                      ++.|-|..|+++=+...-||.-.|....
T Consensus       118 prRYfCtQCHVPQada~PLV~N~F~~~~  145 (149)
T PRK11586        118 PRRYFCLQCHVPQADTAPIVGNTFTPSK  145 (149)
T ss_pred             ccceeeccccCccccCccCCCCCccchh
Confidence            5789999999999999999999997544


No 26 
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=31.88  E-value=23  Score=20.48  Aligned_cols=15  Identities=33%  Similarity=0.713  Sum_probs=11.3

Q ss_pred             EEEcccCCCCcCCCC
Q 034010            9 FFSCRNCLNPLAFHH   23 (106)
Q Consensus         9 ~y~C~~C~thLa~~~   23 (106)
                      -|.|..|+.+|...+
T Consensus        26 Cf~C~~C~~~l~~~~   40 (58)
T PF00412_consen   26 CFKCSKCGKPLNDGD   40 (58)
T ss_dssp             TSBETTTTCBTTTSS
T ss_pred             ccccCCCCCccCCCe
Confidence            468888888887665


No 27 
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=31.25  E-value=8.1  Score=25.65  Aligned_cols=16  Identities=25%  Similarity=0.696  Sum_probs=14.8

Q ss_pred             EeeeeeccCCCceeeE
Q 034010           63 IAKIYCSNCGQELGWH   78 (106)
Q Consensus        63 V~dI~C~~C~~~lGWk   78 (106)
                      ||-+-|..|++.+|+-
T Consensus        50 vRGlLC~~CN~~lG~~   65 (81)
T PF02945_consen   50 VRGLLCRSCNTALGKV   65 (81)
T ss_dssp             EEEEEEHHHHHHHHHC
T ss_pred             chhhhhhHHhhhhccc
Confidence            9999999999999974


No 28 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=31.03  E-value=20  Score=18.67  Aligned_cols=13  Identities=38%  Similarity=0.971  Sum_probs=10.6

Q ss_pred             CEEEcccCCCCcC
Q 034010            8 PFFSCRNCLNPLA   20 (106)
Q Consensus         8 ~~y~C~~C~thLa   20 (106)
                      .-|.|..|+..|+
T Consensus        26 ~Cf~C~~C~~~L~   38 (39)
T smart00132       26 ECFKCSKCGKPLG   38 (39)
T ss_pred             cCCCCcccCCcCc
Confidence            3488999999886


No 29 
>KOG2272 consensus Focal adhesion protein PINCH-1, contains LIM domains [Signal transduction mechanisms; Cytoskeleton]
Probab=29.02  E-value=32  Score=28.27  Aligned_cols=33  Identities=27%  Similarity=0.616  Sum_probs=24.8

Q ss_pred             CCCCEEEcccCCCCcCCCCCceecceeCCCCcEEEee
Q 034010            5 DGRPFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFS   41 (106)
Q Consensus         5 ~g~~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~   41 (106)
                      .|.-.|.|-.|+.|+-. +.|   .|+|..--+|.|+
T Consensus       133 ~~~g~YvC~KCh~~iD~-~~l---~fr~d~yH~yHFk  165 (332)
T KOG2272|consen  133 KGRGRYVCQKCHAHIDE-QPL---TFRGDPYHPYHFK  165 (332)
T ss_pred             cccceeehhhhhhhccc-ccc---cccCCCCCcccee
Confidence            34458999999999877 333   3778877888887


No 30 
>KOG2324 consensus Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=28.80  E-value=45  Score=28.75  Aligned_cols=13  Identities=31%  Similarity=0.457  Sum_probs=10.2

Q ss_pred             ceeeEEEEecccC
Q 034010           74 ELGWHYLRAYDLK   86 (106)
Q Consensus        74 ~lGWkY~~A~e~s   86 (106)
                      .||=||-+++...
T Consensus       271 ~LG~kYS~~lna~  283 (457)
T KOG2324|consen  271 LLGTKYSKPLNAK  283 (457)
T ss_pred             EeccccccccCce
Confidence            6888888887765


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=28.71  E-value=6  Score=19.96  Aligned_cols=18  Identities=22%  Similarity=0.427  Sum_probs=13.2

Q ss_pred             EEEcccCCCCcCCCCCce
Q 034010            9 FFSCRNCLNPLAFHHDLI   26 (106)
Q Consensus         9 ~y~C~~C~thLa~~~~li   26 (106)
                      +|.|..|+.-+.+.+.++
T Consensus         1 ~~~C~~C~~~F~~~~~l~   18 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALR   18 (27)
T ss_dssp             SEEETTTTEEESSHHHHH
T ss_pred             CCCCCccCCccCChhHHH
Confidence            488999988777665544


No 32 
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=28.69  E-value=33  Score=24.78  Aligned_cols=18  Identities=28%  Similarity=0.724  Sum_probs=15.2

Q ss_pred             CEEEcccCCCCcCCCCCc
Q 034010            8 PFFSCRNCLNPLAFHHDL   25 (106)
Q Consensus         8 ~~y~C~~C~thLa~~~~l   25 (106)
                      +.|.|.+|+.+|..+.+-
T Consensus        27 ~~~tC~~Cg~~L~lh~~~   44 (128)
T PF11682_consen   27 DHWTCHSCGCPLILHPGT   44 (128)
T ss_pred             CeEEEecCCceEEEecCC
Confidence            679999999999888543


No 33 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=28.46  E-value=19  Score=18.61  Aligned_cols=11  Identities=45%  Similarity=1.253  Sum_probs=6.5

Q ss_pred             eeeeccCCCce
Q 034010           65 KIYCSNCGQEL   75 (106)
Q Consensus        65 dI~C~~C~~~l   75 (106)
                      +-||..|++.|
T Consensus        16 ~~fC~~CG~~L   26 (26)
T PF13248_consen   16 AKFCPNCGAKL   26 (26)
T ss_pred             cccChhhCCCC
Confidence            44666666543


No 34 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=28.05  E-value=22  Score=21.81  Aligned_cols=35  Identities=26%  Similarity=0.426  Sum_probs=24.2

Q ss_pred             eecccccccCcceeeeeecccEEEeeeeeccCCCceeeEE
Q 034010           40 FSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHY   79 (106)
Q Consensus        40 f~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY   79 (106)
                      |++++.+..|..+     |+...---+-|.+|.++=|---
T Consensus         2 ~Dki~d~L~G~d~-----~~~~~r~aLIC~~C~~hNGla~   36 (54)
T PF10058_consen    2 FDKILDVLLGDDP-----TSPSNRYALICSKCFSHNGLAP   36 (54)
T ss_pred             hHHHHHHHhCCCC-----ccccCceeEECcccchhhcccc
Confidence            5678888888776     3333333456999999998743


No 35 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=27.96  E-value=8.2  Score=18.65  Aligned_cols=16  Identities=19%  Similarity=0.588  Sum_probs=11.9

Q ss_pred             EEcccCCCCcCCCCCc
Q 034010           10 FSCRNCLNPLAFHHDL   25 (106)
Q Consensus        10 y~C~~C~thLa~~~~l   25 (106)
                      |.|..|+..++..++|
T Consensus         1 y~C~~C~~~f~~~~~l   16 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNL   16 (23)
T ss_dssp             EEETTTTEEESSHHHH
T ss_pred             CCCCCCCCccCCHHHH
Confidence            7899998877766554


No 36 
>PF04246 RseC_MucC:  Positive regulator of sigma(E), RseC/MucC;  InterPro: IPR007359 This bacterial family of integral membrane proteins represents a positive regulator of the sigma(E) transcription factor, namely RseC/MucC. The sigma(E) transcription factor is up-regulated by cell envelope protein misfolding, and regulates the expression of genes that are collectively termed ECF (devoted to Extra-Cellular Functions) []. In Pseudomonas aeruginosa, derepression of sigma(E) is associated with the alginate-overproducing phenotype characteristic of chronic respiratory tract colonization in cystic fibrosis patients. The mechanism by which RseC/MucC positively regulates the sigma(E) transcription factor is unknown. RseC is also thought to have a role in thiamine biosynthesis in Salmonella typhimurium []. In addition, this family also includes an N-terminal part of RnfF, a Rhodobacter capsulatus protein, of unknown function, that is essential for nitrogen fixation. This protein also contains a domain found in ApbE protein IPR003374 from INTERPRO, which is itself involved in thiamine biosynthesis.
Probab=27.10  E-value=86  Score=21.70  Aligned_cols=45  Identities=16%  Similarity=0.338  Sum_probs=33.5

Q ss_pred             CEEEcccCCCCcCCCCCceecceeCCCCcEEEeecccccccCccee
Q 034010            8 PFFSCRNCLNPLAFHHDLISKTFKAQTGQAYMFSNAMNVVLGRKED   53 (106)
Q Consensus         8 ~~y~C~~C~thLa~~~~liSk~f~G~~G~AyLf~~v~Nv~~g~~e~   53 (106)
                      +.=.|.+|+..=.-...++++.+.++. .-+...+-.|+..|+..+
T Consensus        15 r~saC~~C~~~~~Cg~~~~~~~~~~~~-~~~~~~~~~~~~~GD~V~   59 (135)
T PF04246_consen   15 RSSACGSCSASGGCGTGLLAKLFSGKP-ITFRAPNPIGAKVGDRVE   59 (135)
T ss_pred             cCCcCcccCCCCCCCcchhhhhcCCCc-EEEEecCCCCCCCCCEEE
Confidence            334699998776677778888888877 666667777888887654


No 37 
>PF10246 MRP-S35:  Mitochondrial ribosomal protein MRP-S35;  InterPro: IPR019375 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This is a family of short mitochondrial ribosomal proteins, less than 200 amino acids long. MRP-S35 was proposed as a more appropriate name to this group of proteins [].
Probab=26.67  E-value=41  Score=23.66  Aligned_cols=45  Identities=20%  Similarity=0.228  Sum_probs=28.6

Q ss_pred             cccccCcceeeeeeccc--EEEeeeeeccCCCceeeEEE----EecccCCceecCe
Q 034010           44 MNVVLGRKEDKQMITGM--YTIAKIYCSNCGQELGWHYL----RAYDLKQKWKEGN   93 (106)
Q Consensus        44 ~Nv~~g~~e~r~m~TG~--h~V~dI~C~~C~~~lGWkY~----~A~e~sqkYKEGk   93 (106)
                      -=+..|+++++. ++|.  |+|.|-    =---+|||..    +.-.++++|..|-
T Consensus        15 ~fi~lG~~~gk~-V~G~I~hvv~dd----LYIDfG~KFhcVc~rp~~~~~~y~~G~   65 (104)
T PF10246_consen   15 PFIQLGDPEGKI-VIGKIFHVVDDD----LYIDFGGKFHCVCKRPAVNGEKYVRGS   65 (104)
T ss_pred             hhhhcCCccCCE-EEEEEEEEecCc----eEEEeCCceeEEEecccccccccccCC
Confidence            334578888775 6676  777652    1123588864    3345778899984


No 38 
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=26.13  E-value=29  Score=23.22  Aligned_cols=23  Identities=26%  Similarity=0.517  Sum_probs=18.0

Q ss_pred             EcccCCCCcCCCCCceecceeCCCCcEEEee
Q 034010           11 SCRNCLNPLAFHHDLISKTFKAQTGQAYMFS   41 (106)
Q Consensus        11 ~C~~C~thLa~~~~liSk~f~G~~G~AyLf~   41 (106)
                      .|.+|+.+++..+        ...|+||+.-
T Consensus        10 ~C~~CG~d~~~~~--------adDgPA~fvi   32 (86)
T PF06170_consen   10 RCPHCGLDYSHAR--------ADDGPAYFVI   32 (86)
T ss_pred             cccccCCccccCC--------cCccchhHHH
Confidence            6999999998776        4567887654


No 39 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=26.01  E-value=23  Score=18.08  Aligned_cols=10  Identities=50%  Similarity=1.341  Sum_probs=5.7

Q ss_pred             eeeccCCCce
Q 034010           66 IYCSNCGQEL   75 (106)
Q Consensus        66 I~C~~C~~~l   75 (106)
                      .+|..|++.|
T Consensus        14 ~fC~~CG~~l   23 (23)
T PF13240_consen   14 KFCPNCGTPL   23 (23)
T ss_pred             cchhhhCCcC
Confidence            3566666543


No 40 
>PF03150 CCP_MauG:  Di-haem cytochrome c peroxidase;  InterPro: IPR004852 This is a group of distinct cytochrome c peroxidases (CCPs) that contain two haem groups. Similar to other cytochrome c peroxidases, they reduce hydrogen peroxide to water using c-type haem as an oxidizable substrate. However, since they possess two, instead of one, haem prosthetic groups, bacterial CCPs reduce hydrogen peroxide without the need to generate semi-stable free radicals. The two haem groups have significantly different redox potentials. The high potential (+320 mV) haem feeds electrons from electron shuttle proteins to the low potential (-330 mV) haem, where peroxide is reduced (indeed, the low potential site is known as the peroxidatic site) []. The CCP protein itself is structured into two domains, each containing one c-type haem group, with a calcium-binding site at the domain interface. This family also includes MauG proteins, whose similarity to di-haem CCP was previously recognised [].; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 1IQC_A 2VHD_B 1EB7_A 3RN0_A 3SVW_B 3RMZ_A 3SJL_B 3PXW_A 3SLE_B 3PXS_A ....
Probab=25.86  E-value=17  Score=26.49  Aligned_cols=21  Identities=29%  Similarity=0.540  Sum_probs=12.6

Q ss_pred             cCCCCEEEcccCCCCcCCCCC
Q 034010            4 FDGRPFFSCRNCLNPLAFHHD   24 (106)
Q Consensus         4 l~g~~~y~C~~C~thLa~~~~   24 (106)
                      |++....+|+.||.+=....+
T Consensus        17 LS~~~~~SCasCH~~~~~~td   37 (159)
T PF03150_consen   17 LSGDGTVSCASCHDPEHGFTD   37 (159)
T ss_dssp             GSTTSS--HHHHS-TTTTTS-
T ss_pred             cCCCcCcCchhhCCCcccCCc
Confidence            677889999999987533333


No 41 
>TIGR03791 TTQ_mauG tryptophan tryptophylquinone biosynthesis enzyme MauG. Members of this protein family are the tryptophan tryptophylquinone biosynthesis (TTQ) enzyme MauG, as found in Methylobacterium extorquens and related species. This protein is required to complete the maturation of the TTQ cofactor in the methylamine dehydrogenase light (beta) chain.
Probab=24.74  E-value=47  Score=26.66  Aligned_cols=32  Identities=19%  Similarity=0.263  Sum_probs=22.1

Q ss_pred             cCCCCEEEcccCCCCcCCCCC--ceecceeCCCC
Q 034010            4 FDGRPFFSCRNCLNPLAFHHD--LISKTFKAQTG   35 (106)
Q Consensus         4 l~g~~~y~C~~C~thLa~~~~--liSk~f~G~~G   35 (106)
                      |++....+|+.|+.+-.-..+  .+|.+..|+.|
T Consensus        18 LS~~~~~SCasCH~p~~~~~d~~~~s~G~~g~~~   51 (291)
T TIGR03791        18 LSRDGSMSCATCHNPGLGWSDGLILALGADGVEH   51 (291)
T ss_pred             cCCCCCcCchhcCCccccCCCCcccccCCCCCCC
Confidence            778889999999998554333  35655555444


No 42 
>PLN03107 eukaryotic translation initiation factor 5A; Provisional
Probab=24.36  E-value=92  Score=23.03  Aligned_cols=31  Identities=16%  Similarity=0.239  Sum_probs=26.4

Q ss_pred             eCCCCcEEEeecccccccCcceeeeeecccE
Q 034010           31 KAQTGQAYMFSNAMNVVLGRKEDKQMITGMY   61 (106)
Q Consensus        31 ~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~h   61 (106)
                      .|+||.|+.--.+.|+..|...+....++--
T Consensus        49 pGKHG~A~vr~k~knl~TG~k~e~~f~s~~~   79 (159)
T PLN03107         49 TGKHGHAKCHFVAIDIFTGKKLEDIVPSSHN   79 (159)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEecCCCE
Confidence            7999999999999999999998877766553


No 43 
>cd02669 Peptidase_C19M A subfamily of Peptidase C19. Peptidase C19 contains ubiquitinyl hydrolases. They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyze bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin. The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome.
Probab=24.31  E-value=61  Score=27.00  Aligned_cols=53  Identities=25%  Similarity=0.313  Sum_probs=31.2

Q ss_pred             cCCCCEEEcccCCCCcCCCCCceecceeCCCCc--EEEeecccccccCcceeeeeecccEEEeeeeeccCCCcee
Q 034010            4 FDGRPFFSCRNCLNPLAFHHDLISKTFKAQTGQ--AYMFSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELG   76 (106)
Q Consensus         4 l~g~~~y~C~~C~thLa~~~~liSk~f~G~~G~--AyLf~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lG   76 (106)
                      +..+.+|.|-.|+           +-|.|+.|.  ||.-..-.|-.+    --.+.|     .++||-.|+..|.
T Consensus        23 ~~~~n~~~CL~cg-----------~~~~g~~~~~ha~~H~~~~~H~~----~v~l~t-----~~~yc~~~~~~v~   77 (440)
T cd02669          23 LSNLNVYACLVCG-----------KYFQGRGKGSHAYTHSLEDNHHV----FLNLET-----LKFYCLPDNYEII   77 (440)
T ss_pred             CCCCcEEEEcccC-----------CeecCCCCCcHHHHHhhccCCCE----EEECCC-----CCEEEeCCCCEEe
Confidence            4556789999998           677777554  444322111111    111122     7899999988765


No 44 
>PF13842 Tnp_zf-ribbon_2:  DDE_Tnp_1-like zinc-ribbon
Probab=24.17  E-value=64  Score=17.64  Aligned_cols=15  Identities=27%  Similarity=0.680  Sum_probs=12.4

Q ss_pred             CEEEcccCCCCcCCC
Q 034010            8 PFFSCRNCLNPLAFH   22 (106)
Q Consensus         8 ~~y~C~~C~thLa~~   22 (106)
                      ..|.|..|..+|...
T Consensus        15 T~~~C~~C~v~lC~~   29 (32)
T PF13842_consen   15 TRYMCSKCDVPLCVE   29 (32)
T ss_pred             eEEEccCCCCcccCC
Confidence            579999999888754


No 45 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=23.97  E-value=43  Score=19.23  Aligned_cols=14  Identities=14%  Similarity=0.562  Sum_probs=9.8

Q ss_pred             EEEcccCCCCcCCC
Q 034010            9 FFSCRNCLNPLAFH   22 (106)
Q Consensus         9 ~y~C~~C~thLa~~   22 (106)
                      .|.|.+|++.+...
T Consensus         3 ~y~C~~CG~~~~~~   16 (46)
T PRK00398          3 EYKCARCGREVELD   16 (46)
T ss_pred             EEECCCCCCEEEEC
Confidence            57888888766543


No 46 
>COG3043 NapB Nitrate reductase cytochrome c-type subunit [Energy production and conversion]
Probab=23.70  E-value=53  Score=24.64  Aligned_cols=30  Identities=30%  Similarity=0.489  Sum_probs=25.4

Q ss_pred             CCCEEEcccCCCCcCCCCCceecceeCCCC
Q 034010            6 GRPFFSCRNCLNPLAFHHDLISKTFKAQTG   35 (106)
Q Consensus         6 g~~~y~C~~C~thLa~~~~liSk~f~G~~G   35 (106)
                      .+|.|-|..|+.+=|...-|+--.|.--.|
T Consensus       123 SPRRYFClQCHVPQaD~kPlV~N~F~p~~~  152 (155)
T COG3043         123 SPRRYFCLQCHVPQADVKPLVGNTFKPMKG  152 (155)
T ss_pred             CccceeeeecccccccccccCCCCcccchh
Confidence            378899999999999999999988875443


No 47 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=22.82  E-value=67  Score=18.49  Aligned_cols=12  Identities=25%  Similarity=0.769  Sum_probs=7.0

Q ss_pred             CCCEEEcccCCC
Q 034010            6 GRPFFSCRNCLN   17 (106)
Q Consensus         6 g~~~y~C~~C~t   17 (106)
                      +...|.|+.|+.
T Consensus        34 ~~~~~~C~~C~~   45 (46)
T PF12760_consen   34 TRGRYRCKACRK   45 (46)
T ss_pred             CCCeEECCCCCC
Confidence            345666666654


No 48 
>cd07973 Spt4 Transcription elongation factor Spt4. Spt4 is a transcription elongation factor. Three transcription-elongation factors Spt4, Spt5, and Spt6, are conserved among eukaryotes and are essential for transcription via the modulation of chromatin structure. It is known that Spt4, Spt5, and Spt6 are general transcription-elongation factors, controlling transcription both positively and negatively in important regulatory and developmental roles.   Spt4 functions entirely in the context of the Spt4-Spt5 heterodimer and it has been found only as a complex to Spt5 in Yeast and Human. Spt4 is a small protein that has zinc finger at the N-terminus.   Spt5 is a large protein that has several interesting structural features of an acidic N-terminus, a single NGN domain, five or six KOW domains, and a set of simple C-termianl repeats. Spt4 binds to Spt5 NGN domain. Unlike Spt5, Spt4 is not essential for viability in yeast, however Spt4 is critical for normal function of the Spt4-Spt5 compl
Probab=22.57  E-value=39  Score=23.24  Aligned_cols=22  Identities=27%  Similarity=0.549  Sum_probs=13.7

Q ss_pred             EcccCCCCcCCCCC------ceecceeC
Q 034010           11 SCRNCLNPLAFHHD------LISKTFKA   32 (106)
Q Consensus        11 ~C~~C~thLa~~~~------liSk~f~G   32 (106)
                      .|.+|...|...++      -.|.+|.|
T Consensus        22 gCpnC~~~l~~~g~~~~v~~~tT~~f~G   49 (98)
T cd07973          22 GCPNCEGYLDMKGNHERVYDCTSPNFEG   49 (98)
T ss_pred             CCCCCcchhccCCCccccccccCCCcce
Confidence            68899766544443      35666765


No 49 
>PRK03999 translation initiation factor IF-5A; Provisional
Probab=22.54  E-value=1.1e+02  Score=21.71  Aligned_cols=30  Identities=17%  Similarity=0.104  Sum_probs=24.3

Q ss_pred             eCCCCcEEEeecccccccCcceeeeeeccc
Q 034010           31 KAQTGQAYMFSNAMNVVLGRKEDKQMITGM   60 (106)
Q Consensus        31 ~G~~G~AyLf~~v~Nv~~g~~e~r~m~TG~   60 (106)
                      .|+||.|+.--.+.|+..|...+....++-
T Consensus        34 pGkhg~a~vr~k~knL~tG~~~e~~~~s~d   63 (129)
T PRK03999         34 PGKHGSAKARIVAIGIFDGQKRSLVQPVDA   63 (129)
T ss_pred             CCCCCcEEEEEEEEECCCCCEEEEEecCCC
Confidence            688899999899999999987766666554


No 50 
>TIGR01053 LSD1 zinc finger domain, LSD1 subclass. This model describes a putative zinc finger domain found in three closely spaced copies in Arabidopsis protein LSD1 and in two copies in other proteins from the same species. The motif resembles CxxCRxxLMYxxGASxVxCxxC
Probab=22.15  E-value=63  Score=17.74  Aligned_cols=17  Identities=18%  Similarity=0.247  Sum_probs=13.6

Q ss_pred             cccCCCCEEEcccCCCC
Q 034010            2 AEFDGRPFFSCRNCLNP   18 (106)
Q Consensus         2 ~~l~g~~~y~C~~C~th   18 (106)
                      .|..|-+.+.|+.|++.
T Consensus        12 ~yP~gA~~vrCs~C~~v   28 (31)
T TIGR01053        12 MYPRGASSVRCALCQTV   28 (31)
T ss_pred             ecCCCCCeEECCCCCeE
Confidence            46678888999999874


No 51 
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=21.02  E-value=61  Score=17.48  Aligned_cols=13  Identities=23%  Similarity=0.639  Sum_probs=10.6

Q ss_pred             CEEEcccCCCCcC
Q 034010            8 PFFSCRNCLNPLA   20 (106)
Q Consensus         8 ~~y~C~~C~thLa   20 (106)
                      .+|.|.+|++-+.
T Consensus         6 ~~ykC~~Cgniv~   18 (34)
T TIGR00319         6 QVYKCEVCGNIVE   18 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            5899999998663


No 52 
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=20.91  E-value=53  Score=18.79  Aligned_cols=12  Identities=33%  Similarity=0.969  Sum_probs=7.2

Q ss_pred             CEEEcccCCCCc
Q 034010            8 PFFSCRNCLNPL   19 (106)
Q Consensus         8 ~~y~C~~C~thL   19 (106)
                      .+|.|.+|++-+
T Consensus         5 ~~YkC~~CGniV   16 (36)
T PF06397_consen    5 EFYKCEHCGNIV   16 (36)
T ss_dssp             EEEE-TTT--EE
T ss_pred             cEEEccCCCCEE
Confidence            589999998754


No 53 
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=20.91  E-value=62  Score=17.49  Aligned_cols=13  Identities=23%  Similarity=0.616  Sum_probs=10.4

Q ss_pred             CEEEcccCCCCcC
Q 034010            8 PFFSCRNCLNPLA   20 (106)
Q Consensus         8 ~~y~C~~C~thLa   20 (106)
                      .+|.|.+|++-+.
T Consensus         3 ~~ykC~~CGniv~   15 (34)
T cd00974           3 EVYKCEICGNIVE   15 (34)
T ss_pred             cEEEcCCCCcEEE
Confidence            5899999988663


No 54 
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=20.49  E-value=52  Score=20.30  Aligned_cols=11  Identities=64%  Similarity=1.350  Sum_probs=9.8

Q ss_pred             eeccCCCceee
Q 034010           67 YCSNCGQELGW   77 (106)
Q Consensus        67 ~C~~C~~~lGW   77 (106)
                      +|.+|+..||-
T Consensus        54 ~Cp~C~~~lg~   64 (67)
T smart00714       54 YCPNCGAFLGT   64 (67)
T ss_pred             ECCCCCCEeEE
Confidence            69999999985


No 55 
>PF14353 CpXC:  CpXC protein
Probab=20.45  E-value=45  Score=22.86  Aligned_cols=46  Identities=15%  Similarity=0.354  Sum_probs=29.7

Q ss_pred             eecccccccCcceeeeeecccEEEeeeeeccCCCceeeEEEEecccCC
Q 034010           40 FSNAMNVVLGRKEDKQMITGMYTIAKIYCSNCGQELGWHYLRAYDLKQ   87 (106)
Q Consensus        40 f~~v~Nv~~g~~e~r~m~TG~h~V~dI~C~~C~~~lGWkY~~A~e~sq   87 (106)
                      +-..+|+...|.-...+++|.-  -...|.+|+...---|.--|.+-+
T Consensus        15 v~~~I~~~~~p~l~e~il~g~l--~~~~CP~Cg~~~~~~~p~lY~D~~   60 (128)
T PF14353_consen   15 VWTSINADEDPELKEKILDGSL--FSFTCPSCGHKFRLEYPLLYHDPE   60 (128)
T ss_pred             EEeEEcCcCCHHHHHHHHcCCc--CEEECCCCCCceecCCCEEEEcCC
Confidence            4467888877765555667763  334799999977655554444433


Done!