Citrus Sinensis ID: 034020

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100------
MKSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKARIYVPPSADNAAAAAVSNTQTEALVSSS
ccEEEEEEEEcccccEEEEEEEEEEccccccEEEEEEEcEEECccccccccccEEEEECcccccccccEEEEEEEEEcEEccccccccHHHHHccccccccccccc
MKSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKARIYVP***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSVVGLVVSNKMQKSVVVAVDRLFHHKVYNRYVKRTSKFMAHDENNQCNIGDRVRLDPSRPLSKHKHWAVAEILKKARIYVPPSADNAAAAAVSNTQTEALVSSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S17 One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.probableA7HM43
30S ribosomal protein S17 One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.probableA5D5G4
30S ribosomal protein S17 One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.probableQ0ID14

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QD7, chain I
Confidence level:very confident
Coverage over the Query: 2-81
View the alignment between query and template
View the model in PyMOL