Query         034029
Match_columns 105
No_of_seqs    95 out of 97
Neff          3.9 
Searched_HMMs 46136
Date          Fri Mar 29 08:59:37 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034029.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034029hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01102 Glycophorin_A:  Glycop  89.3    0.47   1E-05   34.6   3.3   36   13-49     59-94  (122)
  2 PF02439 Adeno_E3_CR2:  Adenovi  87.7     1.3 2.7E-05   26.8   3.8   30   21-50      7-36  (38)
  3 PF07204 Orthoreo_P10:  Orthore  86.0    0.52 1.1E-05   33.7   1.8   37   13-49     36-72  (98)
  4 PF05283 MGC-24:  Multi-glycosy  73.3     3.6 7.8E-05   32.0   2.8   22   20-41    161-182 (186)
  5 PF04277 OAD_gamma:  Oxaloaceta  73.0     3.3 7.2E-05   26.6   2.2   11   71-81     61-71  (79)
  6 TIGR00847 ccoS cytochrome oxid  72.7     6.8 0.00015   24.7   3.5   23   19-41      3-25  (51)
  7 TIGR00822 EII-Sor PTS system,   72.0     9.9 0.00022   30.8   5.2   27   18-44    205-235 (265)
  8 PF15347 PAG:  Phosphoprotein a  71.4     3.4 7.3E-05   35.9   2.5   23   22-44     17-39  (428)
  9 PF13214 DUF4022:  Protein of u  68.8     5.5 0.00012   27.3   2.6   16   25-40      8-23  (83)
 10 PF03597 CcoS:  Cytochrome oxid  68.5     9.8 0.00021   23.3   3.5   23   19-41      2-24  (45)
 11 PF12273 RCR:  Chitin synthesis  68.5     5.7 0.00012   28.0   2.8   10   33-42     12-21  (130)
 12 PF11174 DUF2970:  Protein of u  66.3      10 0.00022   24.1   3.4   19   16-34     28-46  (56)
 13 PF05151 PsbM:  Photosystem II   65.0     5.6 0.00012   23.1   1.8   14   30-43      6-19  (31)
 14 PF15048 OSTbeta:  Organic solu  63.7     8.6 0.00019   28.5   3.0   26   17-42     33-58  (125)
 15 PRK13592 ubiA prenyltransferas  62.1      10 0.00022   31.4   3.5   29   16-44    232-261 (299)
 16 PF02480 Herpes_gE:  Alphaherpe  60.3     2.9 6.2E-05   35.9   0.0   17   10-26    342-358 (439)
 17 PRK12785 fliL flagellar basal   60.2     8.7 0.00019   28.5   2.6   19   71-90     70-90  (166)
 18 PRK09757 PTS system N-acetylga  59.8      14 0.00031   29.9   3.9   28   18-45    206-238 (267)
 19 PF03229 Alpha_GJ:  Alphavirus   59.0      29 0.00062   25.8   5.0   39   10-49     72-118 (126)
 20 TIGR02976 phageshock_pspB phag  58.2     9.4  0.0002   25.7   2.2   29   21-49      3-31  (75)
 21 PF10215 Ost4:  Oligosaccaryltr  57.0      19 0.00041   21.2   3.1   18   23-40      7-24  (35)
 22 CHL00080 psbM photosystem II p  55.7      12 0.00027   22.1   2.2   13   29-41      5-17  (34)
 23 PF14575 EphA2_TM:  Ephrin type  55.6      12 0.00026   24.7   2.3   24   26-49      7-30  (75)
 24 PF01299 Lamp:  Lysosome-associ  55.0      11 0.00023   30.2   2.4   27   22-49    275-301 (306)
 25 TIGR03038 PS_II_psbM photosyst  54.0      14  0.0003   21.7   2.2   13   29-41      5-17  (33)
 26 PF09928 DUF2160:  Predicted sm  53.7      15 0.00033   25.8   2.7   22   14-35      3-24  (88)
 27 PRK14094 psbM photosystem II r  53.6      13 0.00028   23.7   2.1   13   29-41      5-17  (50)
 28 COG5416 Uncharacterized integr  52.8      20 0.00044   25.6   3.3   30   11-40     53-82  (98)
 29 PF12273 RCR:  Chitin synthesis  52.7     6.3 0.00014   27.8   0.7   20   28-47      4-23  (130)
 30 PF11980 DUF3481:  Domain of un  52.5      17 0.00037   25.5   2.8   20   21-40     18-37  (87)
 31 PRK04989 psbM photosystem II r  50.7      16 0.00036   21.7   2.1   13   29-41      5-17  (35)
 32 PF13295 DUF4077:  Domain of un  49.0     6.8 0.00015   29.8   0.4   28   20-47    113-140 (175)
 33 PF12911 OppC_N:  N-terminal TM  48.8      22 0.00047   21.1   2.6   15   24-38     20-34  (56)
 34 PF14914 LRRC37AB_C:  LRRC37A/B  48.7      23 0.00051   27.1   3.3   28   22-49    121-151 (154)
 35 PF01102 Glycophorin_A:  Glycop  48.3      29 0.00063   25.3   3.6   32   22-53     70-101 (122)
 36 PTZ00370 STEVOR; Provisional    48.1      21 0.00046   29.8   3.2   23   25-47    258-282 (296)
 37 TIGR01478 STEVOR variant surfa  48.0      22 0.00047   29.8   3.2   23   25-47    262-286 (295)
 38 PF15471 TMEM171:  Transmembran  47.5      40 0.00087   28.4   4.7   69   27-97    166-235 (319)
 39 PF05399 EVI2A:  Ectropic viral  46.6      20 0.00043   29.0   2.7   18   26-43    128-145 (227)
 40 PF06667 PspB:  Phage shock pro  45.4      32 0.00069   23.2   3.2   28   21-48      3-30  (75)
 41 PRK05419 putative sulfite oxid  45.2      31 0.00067   26.6   3.5   30   18-47    113-142 (205)
 42 PF06596 PsbX:  Photosystem II   44.3      39 0.00084   20.5   3.1   20   22-41     12-31  (39)
 43 PHA02909 hypothetical protein;  43.7      28 0.00061   23.2   2.7    9   37-45     49-57  (72)
 44 PHA03283 envelope glycoprotein  43.4      37  0.0008   30.6   4.1   26   19-44    397-424 (542)
 45 PRK05696 fliL flagellar basal   43.1      92   0.002   22.9   5.7   20   71-90     71-90  (170)
 46 PF06697 DUF1191:  Protein of u  42.8       6 0.00013   32.6  -0.8   59   10-85    208-267 (278)
 47 PF06305 DUF1049:  Protein of u  42.7      47   0.001   20.3   3.5   30   11-40     10-40  (68)
 48 PF09049 SNN_transmemb:  Stanni  42.3      70  0.0015   18.7   4.3   27   16-45      6-33  (33)
 49 COG4961 TadG Flp pilus assembl  42.3      27 0.00058   26.0   2.7   20   24-43     21-40  (185)
 50 PF14241 DUF4341:  Domain of un  41.2      44 0.00096   21.2   3.2   22   17-40      1-22  (62)
 51 COG3715 ManY Phosphotransferas  40.3      87  0.0019   25.7   5.6   13   17-29    204-216 (265)
 52 PF10873 DUF2668:  Protein of u  40.1      30 0.00066   26.5   2.7   29   23-52     67-95  (155)
 53 PF15330 SIT:  SHP2-interacting  40.0      45 0.00098   23.6   3.5   26   23-48      3-28  (107)
 54 PF07172 GRP:  Glycine rich pro  39.9      30 0.00065   24.0   2.5    6   41-46     22-27  (95)
 55 PF01998 DUF131:  Protein of un  39.6      17 0.00036   23.9   1.1   25   17-41     32-59  (64)
 56 PF14991 MLANA:  Protein melan-  39.5     9.8 0.00021   28.0   0.0   19   30-48     32-50  (118)
 57 PF02480 Herpes_gE:  Alphaherpe  39.0      10 0.00022   32.6   0.0   42    9-50    345-386 (439)
 58 PF05568 ASFV_J13L:  African sw  38.6      46   0.001   26.0   3.5   21   27-47     37-57  (189)
 59 PF15339 Afaf:  Acrosome format  38.5      44 0.00096   26.5   3.5   23   21-43    131-153 (200)
 60 PF05255 UPF0220:  Uncharacteri  38.4      41 0.00089   25.4   3.2   26   21-46    102-127 (166)
 61 PRK09458 pspB phage shock prot  37.9      35 0.00075   23.3   2.5   29   21-49      3-31  (75)
 62 PF03381 CDC50:  LEM3 (ligand-e  37.9      75  0.0016   25.4   4.8   35   13-47    239-273 (278)
 63 PRK07021 fliL flagellar basal   37.0 1.5E+02  0.0032   21.7   5.9   19   71-90     63-82  (162)
 64 PTZ00260 dolichyl-phosphate be  36.2 1.7E+02  0.0036   23.6   6.6   15   71-85     67-81  (333)
 65 KOG3626 Organic anion transpor  35.3      98  0.0021   28.8   5.6   27   20-46    673-699 (735)
 66 PHA00736 hypothetical protein   34.6      36 0.00079   23.2   2.2   14   22-35     57-70  (79)
 67 PF13807 GNVR:  G-rich domain o  34.6      80  0.0017   20.3   3.8   19   16-34     54-72  (82)
 68 PF12606 RELT:  Tumour necrosis  34.6 1.2E+02  0.0026   19.0   4.7   21   33-53     12-32  (50)
 69 COG4594 FecB ABC-type Fe3+-cit  34.3      83  0.0018   26.5   4.6   20   26-45      6-25  (310)
 70 PRK13726 conjugal transfer pil  34.0      83  0.0018   24.1   4.3   34   16-49      7-43  (188)
 71 PF10883 DUF2681:  Protein of u  33.5      50  0.0011   22.9   2.8   20   29-48      7-26  (87)
 72 PF06103 DUF948:  Bacterial pro  33.5      40 0.00088   22.0   2.2   12   32-43      5-16  (90)
 73 PF15240 Pro-rich:  Proline-ric  33.4      29 0.00064   27.0   1.8   13   29-41      2-14  (179)
 74 cd02435 CCC1 CCC1. CCC1: This   32.6      76  0.0017   25.1   4.0   30   19-48    173-207 (241)
 75 PF12048 DUF3530:  Protein of u  32.5      66  0.0014   25.9   3.7   16   73-90     61-76  (310)
 76 PF01794 Ferric_reduct:  Ferric  32.5      98  0.0021   20.1   4.0   27   18-44     76-102 (125)
 77 PF10826 DUF2551:  Protein of u  32.5      35 0.00076   23.7   1.8   18   24-41     44-61  (83)
 78 PF04906 Tweety:  Tweety;  Inte  32.4      90   0.002   26.4   4.6   12   32-43    371-382 (406)
 79 PF11143 DUF2919:  Protein of u  31.9      58  0.0013   24.2   3.1   23   25-48     57-79  (149)
 80 PF04976 DmsC:  DMSO reductase   31.6      75  0.0016   25.1   3.8   28   10-37    140-168 (276)
 81 COG4736 CcoQ Cbb3-type cytochr  31.6      92   0.002   20.3   3.6   27   22-48      5-31  (60)
 82 PF06800 Sugar_transport:  Suga  31.5      61  0.0013   26.4   3.4   32   12-47     94-125 (269)
 83 PF02411 MerT:  MerT mercuric t  31.4      97  0.0021   22.2   4.0   18   32-49     54-71  (116)
 84 PF13903 Claudin_2:  PMP-22/EMP  31.1      83  0.0018   21.5   3.6   25   22-46     73-97  (172)
 85 PLN00085 photosystem II reacti  30.5      43 0.00094   25.3   2.2   14   29-42     82-95  (149)
 86 PF05454 DAG1:  Dystroglycan (D  30.2      17 0.00037   30.0   0.0   13   37-49    164-176 (290)
 87 PF11353 DUF3153:  Protein of u  29.4      57  0.0012   24.8   2.7    7   10-16    177-183 (209)
 88 PRK10081 entericidin B membran  28.9      71  0.0015   20.1   2.6   21   26-46      6-26  (48)
 89 PF10717 ODV-E18:  Occlusion-de  28.0   1E+02  0.0022   21.5   3.5   10   32-41     34-43  (85)
 90 PRK10884 SH3 domain-containing  27.9      54  0.0012   25.5   2.4   17   21-38    174-190 (206)
 91 TIGR03363 VI_chp_8 type VI sec  27.7      30 0.00064   28.5   1.0    9   16-24    313-321 (353)
 92 PRK15065 PTS system mannose-sp  27.5   1E+02  0.0022   25.0   4.0   27   18-44    206-236 (262)
 93 TIGR03054 photo_alph_chp1 puta  27.3 1.4E+02   0.003   22.2   4.3   25   25-49      3-27  (135)
 94 cd01059 CCC1_like CCC1-related  27.1 1.3E+02  0.0028   21.5   4.1   30   19-48     79-114 (143)
 95 PF04133 Vps55:  Vacuolar prote  26.9      72  0.0016   23.0   2.8   18   30-47      7-24  (120)
 96 PLN00090 photosystem II reacti  26.7      57  0.0012   23.7   2.2   12   29-40     75-86  (113)
 97 CHL00066 psbH photosystem II p  26.6      94   0.002   21.2   3.1   21   26-46     43-63  (73)
 98 PF07589 VPEP:  PEP-CTERM motif  26.4      90  0.0019   16.7   2.4   11   32-42     10-20  (25)
 99 PF12259 DUF3609:  Protein of u  26.3      48   0.001   27.9   2.0   23   26-49    303-325 (361)
100 PF05915 DUF872:  Eukaryotic pr  25.9 1.7E+02  0.0037   20.9   4.5   27   19-45     39-65  (115)
101 PF13623 SurA_N_2:  SurA N-term  25.9 1.2E+02  0.0025   22.2   3.8   18   28-45     10-27  (145)
102 KOG0499 Cyclic nucleotide-gate  25.3      76  0.0016   29.7   3.2   32    9-40    418-449 (815)
103 PF01034 Syndecan:  Syndecan do  25.3      29 0.00063   23.0   0.4   12   33-44     24-35  (64)
104 PF01594 UPF0118:  Domain of un  25.1 1.1E+02  0.0024   23.5   3.7   26   21-46    302-327 (327)
105 TIGR03007 pepcterm_ChnLen poly  25.1 1.3E+02  0.0028   25.2   4.3   30   18-47    411-440 (498)
106 PF15345 TMEM51:  Transmembrane  25.0      38 0.00082   27.5   1.1   30   12-41     53-82  (233)
107 PTZ00201 amastin surface glyco  24.6 1.4E+02   0.003   23.2   4.2   25   21-45    153-177 (192)
108 PF06387 Calcyon:  D1 dopamine   24.4      57  0.0012   25.7   2.0   14   30-43     85-98  (186)
109 TIGR01167 LPXTG_anchor LPXTG-m  24.4 1.2E+02  0.0025   16.2   2.8    7   20-26     12-18  (34)
110 PF04964 Flp_Fap:  Flp/Fap pili  24.2      72  0.0016   19.1   2.0   13   27-39     14-26  (46)
111 PHA03231 glycoprotein BALF4; P  24.0      69  0.0015   30.2   2.7   24   23-46    704-727 (829)
112 TIGR02830 spore_III_AG stage I  23.7      72  0.0016   24.7   2.4   17   26-42      5-21  (186)
113 PRK02624 psbH photosystem II r  23.5 1.2E+02  0.0026   20.2   3.1   21   26-46     31-51  (64)
114 PRK13792 lysozyme inhibitor; P  23.5      42 0.00091   24.6   1.0   22   27-48      4-25  (127)
115 PF13908 Shisa:  Wnt and FGF in  23.3      36 0.00077   25.0   0.6   24   16-39     70-95  (179)
116 cd02434 Nodulin-21_like_3 Nodu  22.8 1.2E+02  0.0027   23.5   3.6   21   27-47    173-194 (225)
117 cd02437 CCC1_like_1 CCC1-relat  22.7 1.7E+02  0.0036   21.6   4.1   16   33-48    131-146 (175)
118 COG4885 Uncharacterized protei  22.5      76  0.0016   26.7   2.4   23   25-47    289-311 (312)
119 PF15470 DUF4637:  Domain of un  22.5      23 0.00049   27.4  -0.5   19    9-28     89-107 (173)
120 cd04821 PA_M28_1_2 PA_M28_1_2:  22.5      64  0.0014   24.1   1.9   16   68-83     44-59  (157)
121 PRK11486 flagellar biosynthesi  22.4 2.7E+02  0.0059   20.3   5.1   16   69-84     61-76  (124)
122 cd01324 cbb3_Oxidase_CcoQ Cyto  22.4   2E+02  0.0042   17.5   4.0   28   22-49      6-36  (48)
123 COG3847 Flp Flp pilus assembly  22.3      86  0.0019   20.4   2.2   14   27-40     21-34  (58)
124 TIGR03501 gamma_C_targ gammapr  22.2   1E+02  0.0023   16.9   2.2   17   30-46      5-21  (26)
125 PF11153 DUF2931:  Protein of u  22.2      72  0.0016   24.1   2.1   19   31-49      5-23  (216)
126 PF10577 UPF0560:  Uncharacteri  22.2 1.2E+02  0.0026   28.8   3.8   24   20-43    273-296 (807)
127 PLN00055 photosystem II reacti  21.8 1.3E+02  0.0028   20.5   3.1   21   26-46     43-63  (73)
128 TIGR03750 conj_TIGR03750 conju  21.8 1.6E+02  0.0034   21.2   3.7   28   19-46     41-70  (111)
129 PF00822 PMP22_Claudin:  PMP-22  21.5 1.6E+02  0.0034   20.3   3.6   30   22-51      3-34  (166)
130 PF06716 DUF1201:  Protein of u  21.4 1.7E+02  0.0038   18.7   3.4   27   20-46      7-34  (54)
131 cd02433 Nodulin-21_like_2 Nodu  21.2 1.9E+02  0.0041   22.8   4.3   27   20-46    171-202 (234)
132 cd07387 MPP_PolD2_C PolD2 (DNA  20.6      60  0.0013   26.0   1.4   16   77-92     97-112 (257)
133 PHA02337 putative high light i  20.6   2E+02  0.0043   17.0   3.7   21   19-40      4-24  (35)
134 PF09680 Tiny_TM_bacill:  Prote  20.4      68  0.0015   17.6   1.2   19   25-44      5-23  (24)
135 PRK13415 flagella biosynthesis  20.2 1.8E+02  0.0039   23.3   4.1   25    9-35     60-84  (219)
136 COG3197 FixS Uncharacterized p  20.1 1.3E+02  0.0028   19.7   2.6   19   20-38      4-22  (58)

No 1  
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=89.33  E-value=0.47  Score=34.55  Aligned_cols=36  Identities=14%  Similarity=0.250  Sum_probs=24.1

Q ss_pred             ccccCchHHHHHHHHHHHHHHHHHHHHHHHhhcccCC
Q 034029           13 DLWHSPIPYLFTSLALVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        13 ~~W~SPvPYLFgGLA~MlgLIAvALliLaCSy~K~~s   49 (105)
                      ..+..|+= ....|++|.|+|++.|||+-|-+|+...
T Consensus        59 h~fs~~~i-~~Ii~gv~aGvIg~Illi~y~irR~~Kk   94 (122)
T PF01102_consen   59 HRFSEPAI-IGIIFGVMAGVIGIILLISYCIRRLRKK   94 (122)
T ss_dssp             SSSS-TCH-HHHHHHHHHHHHHHHHHHHHHHHHHS--
T ss_pred             cCccccce-eehhHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            34555542 4456889999999999998888765533


No 2  
>PF02439 Adeno_E3_CR2:  Adenovirus E3 region protein CR2;  InterPro: IPR003470 Early region 3 (E3) of human adenoviruses (Ads) codes for proteins that appear to control viral interactions with the host []. This region called CR1 (conserved region 1) [] is found three times in Human adenovirus 19 (a subgroup D adenovirus) 49 kDa protein in the E3 region. CR1 is also found in the 20.1 Kd protein of subgroup B adenoviruses. The function of this 80 amino acid region is unknown. This region is probably a divergent immunoglobulin domain.
Probab=87.72  E-value=1.3  Score=26.82  Aligned_cols=30  Identities=13%  Similarity=0.443  Sum_probs=24.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcccCCC
Q 034029           21 YLFTSLALVLVLIAVALVLLLCSYHKRYSN   50 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALliLaCSy~K~~s~   50 (105)
                      -...|..+-+.+|.+..++-+|-|||...+
T Consensus         7 aIIv~V~vg~~iiii~~~~YaCcykk~~~~   36 (38)
T PF02439_consen    7 AIIVAVVVGMAIIIICMFYYACCYKKHRRQ   36 (38)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHcccccc
Confidence            356777888888888989999999997643


No 3  
>PF07204 Orthoreo_P10:  Orthoreovirus membrane fusion protein p10;  InterPro: IPR009854 This family consists of several Orthoreovirus membrane fusion protein p10 sequences. p10 is thought to be a multifunctional protein that plays a key role in virus-host interaction [].
Probab=85.97  E-value=0.52  Score=33.67  Aligned_cols=37  Identities=32%  Similarity=0.408  Sum_probs=29.1

Q ss_pred             ccccCchHHHHHHHHHHHHHHHHHHHHHHHhhcccCC
Q 034029           13 DLWHSPIPYLFTSLALVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        13 ~~W~SPvPYLFgGLA~MlgLIAvALliLaCSy~K~~s   49 (105)
                      +..-+=.|||-+|=+++|.||-++|+.-.|.+||.+.
T Consensus        36 S~~~ayWpyLA~GGG~iLilIii~Lv~CC~~K~K~~~   72 (98)
T PF07204_consen   36 SSFVAYWPYLAAGGGLILILIIIALVCCCRAKHKTSA   72 (98)
T ss_pred             ehHHhhhHHhhccchhhhHHHHHHHHHHhhhhhhhHh
Confidence            3455567999999898888888888887888888543


No 4  
>PF05283 MGC-24:  Multi-glycosylated core protein 24 (MGC-24);  InterPro: IPR007947 CD164 is a mucin-like receptor, or sialomucin, with specificity in receptor/ ligand interactions that depends on the structural characteristics of the mucin-like receptor. Its functions include mediating, or regulating, haematopoietic progenitor cell adhesion and the negative regulation of their growth and/or-differentiation. It exists in the native state as a disulphide- linked homodimer of two 80-85kDa subunits. It is usually expressed by CD34+ and CD341o/- haematopoietic stem cells and associated microenvironmental cells. It contains, in its extracellular region, two mucin domains (I and II) linked by a non-mucin domain, which has been predicted to contain intra- disulphide bridges. This receptor may play a key role in haematopoiesis by facilitating the adhesion of human CD34+ cells to bone marrow stroma and by negatively regulating CD34+ CD341o/- haematopoietic progenitor cell proliferation. These effects involve the CD164 class I and/or II epitopes recognised by the monoclonal antibodies (mAbs) 105A5 and 103B2/9E10. These epitopes are carbohydrate-dependent and are located on the N-terminal mucin domain I [, ]. It has been found that murine MGC-24v and rat endolyn share significant sequence similarities with human CD164. However, CD164 lacks the consensus glycosaminoglycan (GAG)-attachment site found in MGC-24; it is possible that GAG-association is responsible for the high molecular weight of the epithelial-derived MGC-24 glycoprotein [].  Genomic structure studies have placed CD164 within the mucin-subgroup that comprises multiple exons, and demonstrate the diverse chromosomal distribution of this family of molecules. Molecules with such multiple exons may have sophisticated regulatory mechanisms that involve not only post-translational modifications of the oligosaccharide side chains, but also differential exon usage. Although differences in the intron and exon sizes are seen between the mouse and human genes, the predicted proteins are similar in size and structure, maintaining functionally important motifs that regulate cell proliferation or subcellular distribution [].  CD164 is a gene whose expression depends on differential usage of poly- adenylation sites within the 3'-UTR. The conserved distribution of the 3.2- and 1.2-kb CD164 transcripts between mouse and human suggests that (i) a mechanism may exist to regulate tissue-specific polyadenylation, and (ii) differences in polyadenylation are important for the expression and function of CD164 in different tissues. Two other aspects of the structure of CD164 are of particular interest. First, it shares one of several conserved features of a cytokine-binding pocket - in this respect, it is notable that evidence exists for a class of cell-surface sialomucin modulators that directly interact with growth factor receptors to regulate their response to physiological ligands. Second, its cytoplasmic tail contains a C-terminal YHTL motif found in many endocytic membrane proteins or receptors. These Tyr-based motifs bind to adaptor proteins, which mediate the sorting of membrane proteins into transport vesicles from the plasma membrane to the endosomes, and between intracellular compartments. 
Probab=73.26  E-value=3.6  Score=31.96  Aligned_cols=22  Identities=18%  Similarity=0.329  Sum_probs=18.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHH
Q 034029           20 PYLFTSLALVLVLIAVALVLLL   41 (105)
Q Consensus        20 PYLFgGLA~MlgLIAvALliLa   41 (105)
                      .-++||+.+.|||+||+++++-
T Consensus       161 ~SFiGGIVL~LGv~aI~ff~~K  182 (186)
T PF05283_consen  161 ASFIGGIVLTLGVLAIIFFLYK  182 (186)
T ss_pred             hhhhhHHHHHHHHHHHHHHHhh
Confidence            3489999999999999887753


No 5  
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=73.05  E-value=3.3  Score=26.56  Aligned_cols=11  Identities=36%  Similarity=0.311  Sum_probs=6.6

Q ss_pred             CCCCeEEEEec
Q 034029           71 DPEPKVVVIMA   81 (105)
Q Consensus        71 ~~e~kivVIMA   81 (105)
                      +.++.+.||+|
T Consensus        61 ~~~~~vAaI~A   71 (79)
T PF04277_consen   61 DDPELVAAIAA   71 (79)
T ss_pred             CChHHHHHHHH
Confidence            55566666654


No 6  
>TIGR00847 ccoS cytochrome oxidase maturation protein, cbb3-type. CcoS from Rhodobacter capsulatus has been shown essential for incorporation of redox-active prosthetic groups (heme, Cu) into cytochrome cbb(3) oxidase. FixS of Bradyrhizobium japonicum appears to have the same function. Members of this family are found so far in organisms with a cbb3-type cytochrome oxidase, including Neisseria meningitidis, Helicobacter pylori, Campylobacter jejuni, Caulobacter crescentus, Bradyrhizobium japonicum, and Rhodobacter capsulatus.
Probab=72.68  E-value=6.8  Score=24.72  Aligned_cols=23  Identities=17%  Similarity=0.234  Sum_probs=18.5

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHH
Q 034029           19 IPYLFTSLALVLVLIAVALVLLL   41 (105)
Q Consensus        19 vPYLFgGLA~MlgLIAvALliLa   41 (105)
                      +-|+..++++++|+++++.++.+
T Consensus         3 il~~LIpiSl~l~~~~l~~f~Wa   25 (51)
T TIGR00847         3 ILTILIPISLLLGGVGLVAFLWS   25 (51)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHH
Confidence            45888899999998888777765


No 7  
>TIGR00822 EII-Sor PTS system, mannose/fructose/sorbose family, IIC component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. The Man (PTS splinter group) family is unique in several respects among PTS permease families. It is the only PTS family in which members possess a IID protein. It is the only PTS family in which the IIB constituent is phosphorylated on a histidyl rather than a cysteyl residue. Its permease members exhibit broad specificity for a range of sugars, rather than being specific for just one or a few sugars. The mannose permease of E. coli, for example, can transport and phosphorylate glucose, mannose, fructose, glucosamine,N-acetylglucosamine, and other sugars. Other members of this family can transport sorbose, fructose and N-acetylglucosamine. This family is specific for the sorbose-specific IIC subunits of this family of PTS transporters.
Probab=72.01  E-value=9.9  Score=30.82  Aligned_cols=27  Identities=11%  Similarity=0.193  Sum_probs=18.0

Q ss_pred             chHHHHHHHHHHHHH----HHHHHHHHHHhh
Q 034029           18 PIPYLFTSLALVLVL----IAVALVLLLCSY   44 (105)
Q Consensus        18 PvPYLFgGLA~MlgL----IAvALliLaCSy   44 (105)
                      =.||+|.|+.++--|    |++|++-+++.+
T Consensus       205 ~~~ff~lGF~laayl~l~~l~iAiig~~~A~  235 (265)
T TIGR00822       205 LMPFFYLGFLFAAYTDFSLLAFGAVGGAGAL  235 (265)
T ss_pred             hHHHHHHHHHHHHHhCCcHHHHHHHHHHHHH
Confidence            379999999876443    666665554444


No 8  
>PF15347 PAG:  Phosphoprotein associated with glycosphingolipid-enriched
Probab=71.39  E-value=3.4  Score=35.94  Aligned_cols=23  Identities=35%  Similarity=0.699  Sum_probs=20.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhh
Q 034029           22 LFTSLALVLVLIAVALVLLLCSY   44 (105)
Q Consensus        22 LFgGLA~MlgLIAvALliLaCSy   44 (105)
                      |.|+||++-.++-|.+||+.||-
T Consensus        17 lwgsLaav~~f~lis~LifLCsS   39 (428)
T PF15347_consen   17 LWGSLAAVTTFLLISFLIFLCSS   39 (428)
T ss_pred             eehHHHHHHHHHHHHHHHHHhhc
Confidence            67899999888888899999886


No 9  
>PF13214 DUF4022:  Protein of unknown function (DUF4022)
Probab=68.79  E-value=5.5  Score=27.34  Aligned_cols=16  Identities=25%  Similarity=0.532  Sum_probs=8.7

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034029           25 SLALVLVLIAVALVLL   40 (105)
Q Consensus        25 GLA~MlgLIAvALliL   40 (105)
                      |.--+|.++.+||++|
T Consensus         8 gm~~imsistlallll   23 (83)
T PF13214_consen    8 GMNHIMSISTLALLLL   23 (83)
T ss_pred             chhHHHHHHHHHHHHH
Confidence            4444555566666555


No 10 
>PF03597 CcoS:  Cytochrome oxidase maturation protein cbb3-type;  InterPro: IPR004714 Cytochrome cbb3 oxidases are found almost exclusively in Proteobacteria, and represent a distinctive class of proton-pumping respiratory haem-copper oxidases (HCO) that lack many of the key structural features that contribute to the reaction cycle of the intensely studied mitochondrial cytochrome c oxidase (CcO). Expression of cytochrome cbb3 oxidase allows human pathogens to colonise anoxic tissues and agronomically important diazotrophs to sustain nitrogen fixation []. Genes encoding a cytochrome cbb3 oxidase were initially designated fixNOQP (ccoNOQP), the ccoNOQP operon is always found close to a second gene cluster, known as fixGHIS (ccoGHIS) whose expression is necessary for the assembly of a functional cbb3 oxidase. On the basis of their derived amino acid sequences each of the four proteins encoded by the ccoGHIS operon are thought to be membrane-bound. It has been suggested that they may function in concert as a multi-subunit complex, possibly playing a role in the uptake and metabolism of copper required for the assembly of the binuclear centre of cytochrome cbb3 oxidase. 
Probab=68.54  E-value=9.8  Score=23.29  Aligned_cols=23  Identities=39%  Similarity=0.586  Sum_probs=17.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHH
Q 034029           19 IPYLFTSLALVLVLIAVALVLLL   41 (105)
Q Consensus        19 vPYLFgGLA~MlgLIAvALliLa   41 (105)
                      +-|+..++++++|+++++.++.+
T Consensus         2 ~l~~lip~sl~l~~~~l~~f~Wa   24 (45)
T PF03597_consen    2 ILYILIPVSLILGLIALAAFLWA   24 (45)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHH
Confidence            35788888888888887777665


No 11 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=68.45  E-value=5.7  Score=28.02  Aligned_cols=10  Identities=40%  Similarity=0.796  Sum_probs=3.9

Q ss_pred             HHHHHHHHHH
Q 034029           33 IAVALVLLLC   42 (105)
Q Consensus        33 IAvALliLaC   42 (105)
                      |.|.|++..|
T Consensus        12 i~l~~~~~~~   21 (130)
T PF12273_consen   12 ILLFLFLFYC   21 (130)
T ss_pred             HHHHHHHHHH
Confidence            3333333344


No 12 
>PF11174 DUF2970:  Protein of unknown function (DUF2970);  InterPro: IPR021344  This short family is conserved in Proteobacteria. The function is not known. 
Probab=66.34  E-value=10  Score=24.14  Aligned_cols=19  Identities=21%  Similarity=0.595  Sum_probs=14.4

Q ss_pred             cCchHHHHHHHHHHHHHHH
Q 034029           16 HSPIPYLFTSLALVLVLIA   34 (105)
Q Consensus        16 ~SPvPYLFgGLA~MlgLIA   34 (105)
                      .+|.||++.|+.+.+.+|+
T Consensus        28 ~~p~~~Ii~gii~~~~fV~   46 (56)
T PF11174_consen   28 GSPVHFIIVGIILAALFVA   46 (56)
T ss_pred             CCCchHHHHHHHHHHHHHH
Confidence            5799999999876665554


No 13 
>PF05151 PsbM:  Photosystem II reaction centre M protein (PsbM);  InterPro: IPR007826 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbM found in PSII. PsbM is one of the most hydrophobic proteins in the thylakoid membrane. The function of this protein is unknown.; GO: 0015979 photosynthesis, 0019684 photosynthesis, light reaction, 0009523 photosystem II, 0016021 integral to membrane; PDB: 3A0H_m 3ARC_m 3A0B_M 3PRR_M 3PRQ_M 1S5L_M 4FBY_e 3BZ2_M 3BZ1_M 2AXT_M ....
Probab=64.97  E-value=5.6  Score=23.07  Aligned_cols=14  Identities=43%  Similarity=0.643  Sum_probs=10.0

Q ss_pred             HHHHHHHHHHHHHh
Q 034029           30 LVLIAVALVLLLCS   43 (105)
Q Consensus        30 lgLIAvALliLaCS   43 (105)
                      +|+||.||.|+.++
T Consensus         6 l~fiAtaLfi~iPt   19 (31)
T PF05151_consen    6 LAFIATALFILIPT   19 (31)
T ss_dssp             THHHHHHHHHHHHH
T ss_pred             hhHHHHHHHHHHHH
Confidence            57778888777654


No 14 
>PF15048 OSTbeta:  Organic solute transporter subunit beta protein
Probab=63.75  E-value=8.6  Score=28.49  Aligned_cols=26  Identities=23%  Similarity=0.356  Sum_probs=21.6

Q ss_pred             CchHHHHHHHHHHHHHHHHHHHHHHH
Q 034029           17 SPIPYLFTSLALVLVLIAVALVLLLC   42 (105)
Q Consensus        17 SPvPYLFgGLA~MlgLIAvALliLaC   42 (105)
                      ||--|-..+|+++..+|+|.||...=
T Consensus        33 tpWNysiL~Ls~vvlvi~~~LLgrsi   58 (125)
T PF15048_consen   33 TPWNYSILALSFVVLVISFFLLGRSI   58 (125)
T ss_pred             CCcchHHHHHHHHHHHHHHHHHHHHh
Confidence            45569999999999999999987643


No 15 
>PRK13592 ubiA prenyltransferase; Provisional
Probab=62.10  E-value=10  Score=31.40  Aligned_cols=29  Identities=7%  Similarity=0.126  Sum_probs=23.1

Q ss_pred             cCchHHH-HHHHHHHHHHHHHHHHHHHHhh
Q 034029           16 HSPIPYL-FTSLALVLVLIAVALVLLLCSY   44 (105)
Q Consensus        16 ~SPvPYL-FgGLA~MlgLIAvALliLaCSy   44 (105)
                      -||.||+ ++.++..+.+++.++++++|..
T Consensus       232 ~s~lp~~~~g~~g~~~l~~~~~~~l~~~~~  261 (299)
T PRK13592        232 TNFALLWNISHVGVVVLVLNVIWMTVQFEQ  261 (299)
T ss_pred             HhhHHHHHhhhhHHHHHHHHHHHHHHHHHH
Confidence            4789999 8877777777888888888863


No 16 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=60.30  E-value=2.9  Score=35.88  Aligned_cols=17  Identities=24%  Similarity=0.087  Sum_probs=0.0

Q ss_pred             CCcccccCchHHHHHHH
Q 034029           10 APIDLWHSPIPYLFTSL   26 (105)
Q Consensus        10 ~~~~~W~SPvPYLFgGL   26 (105)
                      ++...|.++.-.+.+++
T Consensus       342 ~~p~~~~~~~~~~l~vV  358 (439)
T PF02480_consen  342 APPSPRTSRGAALLGVV  358 (439)
T ss_dssp             -----------------
T ss_pred             CCCCCCCCcccchHHHH
Confidence            33345666655555554


No 17 
>PRK12785 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=60.17  E-value=8.7  Score=28.53  Aligned_cols=19  Identities=37%  Similarity=0.553  Sum_probs=13.3

Q ss_pred             CCCCeEEEEecCCCC--Cccce
Q 034029           71 DPEPKVVVIMAGDDK--PRYLA   90 (105)
Q Consensus        71 ~~e~kivVIMAGd~~--PTfLA   90 (105)
                      +.++ |+|=+++++.  ..||-
T Consensus        70 ~l~~-fvVNL~~~~~~~~ryLk   90 (166)
T PRK12785         70 DVPD-MLVNLAGDPGERVQYLK   90 (166)
T ss_pred             EcCC-EEEECCCCCCCcceEEE
Confidence            4444 9999988753  68874


No 18 
>PRK09757 PTS system N-acetylgalactosamine-specific transporter subunit IIC; Provisional
Probab=59.82  E-value=14  Score=29.85  Aligned_cols=28  Identities=29%  Similarity=0.397  Sum_probs=18.8

Q ss_pred             chHHHHHHHHHH--HH---HHHHHHHHHHHhhc
Q 034029           18 PIPYLFTSLALV--LV---LIAVALVLLLCSYH   45 (105)
Q Consensus        18 PvPYLFgGLA~M--lg---LIAvALliLaCSy~   45 (105)
                      =.||+|.|+.+.  ++   +|++|++-+++.+.
T Consensus       206 ~~~ff~lGF~l~ayl~~~~~i~iaiig~~iA~~  238 (267)
T PRK09757        206 YIPYLIAGFLFVCYIQVSNLLPVAVLGAGFAVY  238 (267)
T ss_pred             hHHHHHHHHHHHHHhCCccHHHHHHHHHHHHHH
Confidence            379999998764  22   47777766655553


No 19 
>PF03229 Alpha_GJ:  Alphavirus glycoprotein J;  InterPro: IPR004913 The exact function of the herpesvirus glycoprotein J is unknown, but it appears to play a role in the inhibition of apotosis of the host cell [].; GO: 0019050 suppression by virus of host apoptosis
Probab=58.99  E-value=29  Score=25.84  Aligned_cols=39  Identities=28%  Similarity=0.360  Sum_probs=21.3

Q ss_pred             CCcccccCc-----hHHHHHHHHHHHHHHHH---HHHHHHHhhcccCC
Q 034029           10 APIDLWHSP-----IPYLFTSLALVLVLIAV---ALVLLLCSYHKRYS   49 (105)
Q Consensus        10 ~~~~~W~SP-----vPYLFgGLA~MlgLIAv---ALliLaCSy~K~~s   49 (105)
                      .+..+|.+|     +|-++|||.+. .|+++   +||==.|-+|-++.
T Consensus        72 a~~sp~ps~p~d~aLp~VIGGLcaL-~LaamGA~~LLrR~cRr~arrR  118 (126)
T PF03229_consen   72 ASSSPGPSPPVDFALPLVIGGLCAL-TLAAMGAGALLRRCCRRAARRR  118 (126)
T ss_pred             CCCCCCCCCCcccchhhhhhHHHHH-HHHHHHHHHHHHHHHHHHHHhh
Confidence            334566665     57788888764 33333   33333666655443


No 20 
>TIGR02976 phageshock_pspB phage shock protein B. This model describes the PspB protein of the psp (phage shock protein) operon, as found in Escherichia coli and many related species. Expression of a phage protein called secretin protein IV, and a number of other stresses including ethanol, heat shock, and defects in protein secretion trigger sigma-54-dependent expression of the phage shock regulon. PspB is both a regulator and an effector protein of the phage shock response.
Probab=58.23  E-value=9.4  Score=25.67  Aligned_cols=29  Identities=24%  Similarity=0.505  Sum_probs=21.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcccCC
Q 034029           21 YLFTSLALVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALliLaCSy~K~~s   49 (105)
                      +.|..+-+++++|-||.+-|..-|++...
T Consensus         3 ~~fl~~Pliif~ifVap~wl~lHY~~k~~   31 (75)
T TIGR02976         3 IFFLAIPLIIFVIFVAPLWLILHYRSKRK   31 (75)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Confidence            45777777788888888888888875433


No 21 
>PF10215 Ost4:  Oligosaccaryltransferase  ;  InterPro: IPR018943  Ost4 is a very short, approximately 30 residues, enzyme found from fungi to vertebrates. It is a member of the ER oligosaccaryltansferase complex, 2.4.1.119 from EC, that catalyses the asparagine-linked glycosylation of proteins. It appears to be an integral membrane protein that mediates the en bloc transfer of a pre-assembled high-mannose oligosaccharide onto asparagine residues of nascent polypeptides as they enter the lumen of the rough endoplasmic reticulum. ; PDB: 1RKL_A 2LAT_A.
Probab=57.00  E-value=19  Score=21.18  Aligned_cols=18  Identities=33%  Similarity=0.442  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 034029           23 FTSLALVLVLIAVALVLL   40 (105)
Q Consensus        23 FgGLA~MlgLIAvALliL   40 (105)
                      ...||..||+.++.|+|+
T Consensus         7 L~~lan~lG~~~~~LIVl   24 (35)
T PF10215_consen    7 LYTLANFLGVAAMVLIVL   24 (35)
T ss_dssp             HHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            346788889988888886


No 22 
>CHL00080 psbM photosystem II protein M
Probab=55.70  E-value=12  Score=22.08  Aligned_cols=13  Identities=46%  Similarity=0.787  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHH
Q 034029           29 VLVLIAVALVLLL   41 (105)
Q Consensus        29 MlgLIAvALliLa   41 (105)
                      .+|+||.+|.|+.
T Consensus         5 ~lgfiAt~LFi~i   17 (34)
T CHL00080          5 ILAFIATALFILV   17 (34)
T ss_pred             HHHHHHHHHHHHH
Confidence            3677777777664


No 23 
>PF14575 EphA2_TM:  Ephrin type-A receptor 2 transmembrane domain; PDB: 3KUL_A 2XVD_A 2VX1_A 2VWV_A 2VX0_A 2VWY_A 2VWZ_A 2VWW_A 2VWU_A 2VWX_A ....
Probab=55.62  E-value=12  Score=24.74  Aligned_cols=24  Identities=25%  Similarity=0.642  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHHHhhcccCC
Q 034029           26 LALVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        26 LA~MlgLIAvALliLaCSy~K~~s   49 (105)
                      ++.++.|+++.++++.|.+++..+
T Consensus         7 ~~g~~~ll~~v~~~~~~~rr~~~~   30 (75)
T PF14575_consen    7 IVGVLLLLVLVIIVIVCFRRCKYS   30 (75)
T ss_dssp             HHHHHHHHHHHHHHHCCCTT----
T ss_pred             HHHHHHHHHhheeEEEEEeeEcCC
Confidence            444555555666667777666533


No 24 
>PF01299 Lamp:  Lysosome-associated membrane glycoprotein (Lamp);  InterPro: IPR002000 Lysosome-associated membrane glycoproteins (lamp) [] are integral membrane proteins, specific to lysosomes, and whose exact biological function is not yet clear. Structurally, the lamp proteins consist of two internally homologous lysosome-luminal domains separated by a proline-rich hinge region; at the C-terminal extremity there is a transmembrane region (TM) followed by a very short cytoplasmic tail (C). In each of the duplicated domains, there are two conserved disulphide bonds. This structure is schematically represented in the figure below.   +-----+ +-----+ +-----+ +-----+ | | | | | | | | xCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxxxCxxxxxCxxxxxxxxxxxxCxxxxxCxxxxxxxx +--------------------------++Hinge++--------------------------++TM++C+  In mammals, there are two closely related types of lamp: lamp-1 and lamp-2, which form major components of the lysosome membrane. In chicken lamp-1 is known as LEP100.  Also included in this entry is the macrophage protein CD68 (or macrosialin) [] is a heavily glycosylated integral membrane protein whose structure consists of a mucin-like domain followed by a proline-rich hinge; a single lamp-like domain; a transmembrane region and a short cytoplasmic tail.   Similar to CD68, mammalian lamp-3, which is expressed in lymphoid organs, dendritic cells and in lung, contains all the C-terminal regions but lacks the N-terminal lamp-like region []. In a lamp-family protein from nematodes [] only the part C-terminal to the hinge is conserved. ; GO: 0016020 membrane
Probab=55.01  E-value=11  Score=30.16  Aligned_cols=27  Identities=19%  Similarity=0.255  Sum_probs=16.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcccCC
Q 034029           22 LFTSLALVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        22 LFgGLA~MlgLIAvALliLaCSy~K~~s   49 (105)
                      +..|+++ .|||.+.|+.-.+.|||.+.
T Consensus       275 IaVG~~L-a~lvlivLiaYli~Rrr~~~  301 (306)
T PF01299_consen  275 IAVGAAL-AGLVLIVLIAYLIGRRRSRA  301 (306)
T ss_pred             HHHHHHH-HHHHHHHHHhheeEeccccc
Confidence            3455443 56666777777777777654


No 25 
>TIGR03038 PS_II_psbM photosystem II reaction center protein PsbM. Members of this protein family are the photosystem II reaction center M protein, product of the psbM gene, in Cyanobacteria and their derived organelles in plants. This model resembles Pfam model pfam05151 but has cutoffs set to avoid false-positive matches to similar (not necessarily homologous) sequences in species that are not photosynthetic.
Probab=53.96  E-value=14  Score=21.74  Aligned_cols=13  Identities=38%  Similarity=0.608  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHH
Q 034029           29 VLVLIAVALVLLL   41 (105)
Q Consensus        29 MlgLIAvALliLa   41 (105)
                      .+|+||.||.|+.
T Consensus         5 ~l~fiAt~Lfi~i   17 (33)
T TIGR03038         5 ILGFIATLLFILV   17 (33)
T ss_pred             HHHHHHHHHHHHH
Confidence            3567777776663


No 26 
>PF09928 DUF2160:  Predicted small integral membrane protein (DUF2160);  InterPro: IPR018678  The members of this family of hypothetical prokaryotic proteins have no known function. It is thought that they are transmembrane proteins, but their function has not been inferred yet. 
Probab=53.66  E-value=15  Score=25.77  Aligned_cols=22  Identities=32%  Similarity=0.629  Sum_probs=18.4

Q ss_pred             cccCchHHHHHHHHHHHHHHHH
Q 034029           14 LWHSPIPYLFTSLALVLVLIAV   35 (105)
Q Consensus        14 ~W~SPvPYLFgGLA~MlgLIAv   35 (105)
                      .|..|+--.|+++++||+..++
T Consensus         3 aWT~ptA~FF~~I~~~L~~mtv   24 (88)
T PF09928_consen    3 AWTWPTAIFFICIALMLAGMTV   24 (88)
T ss_pred             CcchHHHHHHHHHHHHHHHHHH
Confidence            3899999999999998877654


No 27 
>PRK14094 psbM photosystem II reaction center protein M; Provisional
Probab=53.61  E-value=13  Score=23.66  Aligned_cols=13  Identities=15%  Similarity=0.133  Sum_probs=8.4

Q ss_pred             HHHHHHHHHHHHH
Q 034029           29 VLVLIAVALVLLL   41 (105)
Q Consensus        29 MlgLIAvALliLa   41 (105)
                      .||+||.||.|+.
T Consensus         5 ~lgfiAtaLFi~i   17 (50)
T PRK14094          5 NFGFVASLLFVGV   17 (50)
T ss_pred             HHHHHHHHHHHHH
Confidence            3667777776664


No 28 
>COG5416 Uncharacterized integral membrane protein [Function unknown]
Probab=52.79  E-value=20  Score=25.61  Aligned_cols=30  Identities=23%  Similarity=0.316  Sum_probs=25.2

Q ss_pred             CcccccCchHHHHHHHHHHHHHHHHHHHHH
Q 034029           11 PIDLWHSPIPYLFTSLALVLVLIAVALVLL   40 (105)
Q Consensus        11 ~~~~W~SPvPYLFgGLA~MlgLIAvALliL   40 (105)
                      -+++|+=|.=-.+.|-++|-+||++.+.+-
T Consensus        53 lfg~~~~PLilvil~s~v~G~Li~~~~~~~   82 (98)
T COG5416          53 LFGQWELPLILVILGAAVVGALIAMFAGIA   82 (98)
T ss_pred             ecchhhhhHHHHHHHHHHHHHHHHHHHhHH
Confidence            457788888889999999999999887765


No 29 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=52.72  E-value=6.3  Score=27.82  Aligned_cols=20  Identities=25%  Similarity=0.486  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHHHHhhccc
Q 034029           28 LVLVLIAVALVLLLCSYHKR   47 (105)
Q Consensus        28 ~MlgLIAvALliLaCSy~K~   47 (105)
                      +.++||+++||+|+..++.+
T Consensus         4 l~~iii~~i~l~~~~~~~~~   23 (130)
T PF12273_consen    4 LFAIIIVAILLFLFLFYCHN   23 (130)
T ss_pred             eHHHHHHHHHHHHHHHHHHH
Confidence            44556666666666666654


No 30 
>PF11980 DUF3481:  Domain of unknown function (DUF3481);  InterPro: IPR022579  This domain of unknown function is located in the C terminus of the eukaryotic neuropilin receptor family of proteins. It is found in association with PF00754 from PFAM, PF00431 from PFAM and PF00629 from PFAM. There are two completely conserved residues (Y and E) that may be functionally important.
Probab=52.51  E-value=17  Score=25.48  Aligned_cols=20  Identities=30%  Similarity=0.517  Sum_probs=14.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 034029           21 YLFTSLALVLVLIAVALVLL   40 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALliL   40 (105)
                      |++.|=++.+.|++++|.++
T Consensus        18 yiiA~gga~llL~~v~l~vv   37 (87)
T PF11980_consen   18 YIIAMGGALLLLVAVCLGVV   37 (87)
T ss_pred             HHHhhccHHHHHHHHHHHHH
Confidence            57777777888888885544


No 31 
>PRK04989 psbM photosystem II reaction center protein M; Provisional
Probab=50.72  E-value=16  Score=21.68  Aligned_cols=13  Identities=31%  Similarity=0.381  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHHHH
Q 034029           29 VLVLIAVALVLLL   41 (105)
Q Consensus        29 MlgLIAvALliLa   41 (105)
                      .+|+||.+|.|+.
T Consensus         5 ~lgfiAt~Lfi~i   17 (35)
T PRK04989          5 DLGFVASLLFVLV   17 (35)
T ss_pred             HHHHHHHHHHHHH
Confidence            3566666666653


No 32 
>PF13295 DUF4077:  Domain of unknown function (DUF4077)
Probab=49.01  E-value=6.8  Score=29.81  Aligned_cols=28  Identities=39%  Similarity=0.640  Sum_probs=23.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhccc
Q 034029           20 PYLFTSLALVLVLIAVALVLLLCSYHKR   47 (105)
Q Consensus        20 PYLFgGLA~MlgLIAvALliLaCSy~K~   47 (105)
                      -||---|.++||-+|+.|....||||..
T Consensus       113 iylserlvvilggvavvltfilcsywpe  140 (175)
T PF13295_consen  113 IYLSERLVVILGGVAVVLTFILCSYWPE  140 (175)
T ss_pred             HHHHhHHHHhcccchheeehhhhhcChH
Confidence            3556677888899999999999999974


No 33 
>PF12911 OppC_N:  N-terminal TM domain of oligopeptide transport permease C
Probab=48.82  E-value=22  Score=21.15  Aligned_cols=15  Identities=27%  Similarity=0.616  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHHHHHH
Q 034029           24 TSLALVLVLIAVALV   38 (105)
Q Consensus        24 gGLA~MlgLIAvALl   38 (105)
                      .|+.+++.+|.+|++
T Consensus        20 ~gl~il~~~vl~ai~   34 (56)
T PF12911_consen   20 IGLIILLILVLLAIF   34 (56)
T ss_pred             HHHHHHHHHHHHHHH
Confidence            344444444444433


No 34 
>PF14914 LRRC37AB_C:  LRRC37A/B like protein 1 C-terminal domain
Probab=48.71  E-value=23  Score=27.10  Aligned_cols=28  Identities=21%  Similarity=0.517  Sum_probs=19.4

Q ss_pred             HHHHHH---HHHHHHHHHHHHHHHhhcccCC
Q 034029           22 LFTSLA---LVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        22 LFgGLA---~MlgLIAvALliLaCSy~K~~s   49 (105)
                      |.+++.   +++.||.+.-||-.||||+.+.
T Consensus       121 lilaisvtvv~~iliii~CLiei~shr~a~~  151 (154)
T PF14914_consen  121 LILAISVTVVVMILIIIFCLIEICSHRRASE  151 (154)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhcccccc
Confidence            455544   4456777888888999988554


No 35 
>PF01102 Glycophorin_A:  Glycophorin A;  InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Glycophorin A (PAS-2) and glycophorin B (PAS-3) belong to the MNS blood group system and are associated with antigens that include M/N, S/s, U, He, Mi(a), M(c), Vw, Mur, M(g), Vr, M(e), Mt(a), St(a), Ri(a), Cl(a), Ny(a), Hut, Hil, M(v), Far, Mit, Dantu, Hop, Nob, En(a), ENKT, amongst others. Glycophorin A is the major sialoglycoprotein of the erythrocyte membrane []. Structurally, glycophorin A consists of an N-terminal extracellular domain, heavily glycosylated on serine and threonine residues, followed by a transmembrane region and a C-terminal cytoplasmic domain. Other glycophorins in this entry such as Glycophorin B and Glycophorin E represent minor sialoglycoproteins in the erythrocyte membrane.; GO: 0016021 integral to membrane; PDB: 2KPF_B 1AFO_B 2KPE_A.
Probab=48.29  E-value=29  Score=25.27  Aligned_cols=32  Identities=19%  Similarity=0.143  Sum_probs=17.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcccCCCCCC
Q 034029           22 LFTSLALVLVLIAVALVLLLCSYHKRYSNSSS   53 (105)
Q Consensus        22 LFgGLA~MlgLIAvALliLaCSy~K~~s~s~~   53 (105)
                      .||-+|.++|+|++.+..+-=-++|...+...
T Consensus        70 i~gv~aGvIg~Illi~y~irR~~Kk~~~~~~p  101 (122)
T PF01102_consen   70 IFGVMAGVIGIILLISYCIRRLRKKSSSDVQP  101 (122)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHS---------
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHhccCCCCCCC
Confidence            47777777788887777777778888765554


No 36 
>PTZ00370 STEVOR; Provisional
Probab=48.13  E-value=21  Score=29.85  Aligned_cols=23  Identities=43%  Similarity=0.865  Sum_probs=16.0

Q ss_pred             HHH-HHHHHHHHHHHHH-HHhhccc
Q 034029           25 SLA-LVLVLIAVALVLL-LCSYHKR   47 (105)
Q Consensus        25 GLA-~MlgLIAvALliL-aCSy~K~   47 (105)
                      |+| +.|-++||.|+|| .|=|||+
T Consensus       258 giaalvllil~vvliilYiwlyrrR  282 (296)
T PTZ00370        258 GIAALVLLILAVVLIILYIWLYRRR  282 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            444 4556689999998 7777664


No 37 
>TIGR01478 STEVOR variant surface antigen, stevor family. This model represents the stevor branch of the rifin/stevor family (pfam02009) of predicted variant surface antigens as found in Plasmodium falciparum. This model is based on a set of stevor sequences kindly provided by Matt Berriman from the Sanger Center. This is a global model and assesses a penalty for incomplete sequence. Additional fragmentary sequences may be found with the fragment model and a cutoff of 8 bits.
Probab=48.05  E-value=22  Score=29.79  Aligned_cols=23  Identities=39%  Similarity=0.857  Sum_probs=16.0

Q ss_pred             HHH-HHHHHHHHHHHHH-HHhhccc
Q 034029           25 SLA-LVLVLIAVALVLL-LCSYHKR   47 (105)
Q Consensus        25 GLA-~MlgLIAvALliL-aCSy~K~   47 (105)
                      |+| +.|-++||.|+|| .|=|||+
T Consensus       262 giaalvllil~vvliiLYiWlyrrR  286 (295)
T TIGR01478       262 GIAALVLIILTVVLIILYIWLYRRR  286 (295)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            444 4556689999998 7777664


No 38 
>PF15471 TMEM171:  Transmembrane protein family 171
Probab=47.47  E-value=40  Score=28.42  Aligned_cols=69  Identities=14%  Similarity=0.228  Sum_probs=34.4

Q ss_pred             HHHHHHHHHHHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCC-CCCCCCeEEEEecCCCCCccceeccCCCC
Q 034029           27 ALVLVLIAVALVLLLCSYHKRYSNSSSGNGRDQENQPAVLPK-VLDPEPKVVVIMAGDDKPRYLATQATISS   97 (105)
Q Consensus        27 A~MlgLIAvALliLaCSy~K~~s~s~~~~~~d~ek~~~~~~~-~~~~e~kivVIMAGd~~PTfLAkP~~s~s   97 (105)
                      +..+.|+.+-..+.|+-.+|..-+.+.+..+.||......+. ++.-.+  .||+-=---|-|++.+.++..
T Consensus       166 GPlIVl~GLCFFVVAHvKKr~nln~~qd~se~Ee~~~qs~Ep~qVTVGD--aViiFPPPPPPYF~ess~~a~  235 (319)
T PF15471_consen  166 GPLIVLVGLCFFVVAHVKKRNNLNGSQDASESEEGQTQSTEPVQVTVGD--AVIIFPPPPPPYFPESSASAV  235 (319)
T ss_pred             hhHHHHHhhhhhheeeeeeccCCCcccCccccccCCCCCCCCEEEEecC--EEEEcCCccCCCCCCCCcccc
Confidence            344556666777888888776554443222223222211111 111111  144444557888887765543


No 39 
>PF05399 EVI2A:  Ectropic viral integration site 2A protein (EVI2A);  InterPro: IPR008608 This family contains several mammalian ectropic viral integration site 2A (EVI2A) proteins. The function of this protein is unknown although it is thought to be a membrane protein and may function as an oncogene in retrovirus induced myeloid tumours [, ].; GO: 0016021 integral to membrane
Probab=46.60  E-value=20  Score=29.01  Aligned_cols=18  Identities=33%  Similarity=0.938  Sum_probs=14.4

Q ss_pred             HHHHHHHHHHHHHHHHHh
Q 034029           26 LALVLVLIAVALVLLLCS   43 (105)
Q Consensus        26 LA~MlgLIAvALliLaCS   43 (105)
                      .|..+.||-+|.|+|.|.
T Consensus       128 ~amLIClIIIAVLfLICT  145 (227)
T PF05399_consen  128 MAMLICLIIIAVLFLICT  145 (227)
T ss_pred             hhHHHHHHHHHHHHHHHH
Confidence            456677899999999995


No 40 
>PF06667 PspB:  Phage shock protein B;  InterPro: IPR009554 This family consists of several bacterial phage shock protein B (PspB) sequences. The phage shock protein (psp) operon is induced in response to heat, ethanol, osmotic shock and infection by filamentous bacteriophages []. Expression of the operon requires the alternative sigma factor sigma54 and the transcriptional activator PspF. In addition, PspA plays a negative regulatory role, and the integral-membrane proteins PspB and PspC play a positive one [].; GO: 0006355 regulation of transcription, DNA-dependent, 0009271 phage shock
Probab=45.43  E-value=32  Score=23.18  Aligned_cols=28  Identities=25%  Similarity=0.561  Sum_probs=19.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcccC
Q 034029           21 YLFTSLALVLVLIAVALVLLLCSYHKRY   48 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALliLaCSy~K~~   48 (105)
                      +.|...-+++++|-||.+-|..-|++..
T Consensus         3 ~~fl~~plivf~ifVap~WL~lHY~sk~   30 (75)
T PF06667_consen    3 FEFLFVPLIVFMIFVAPIWLILHYRSKW   30 (75)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            4566666677777777777777776543


No 41 
>PRK05419 putative sulfite oxidase subunit YedZ; Reviewed
Probab=45.24  E-value=31  Score=26.61  Aligned_cols=30  Identities=27%  Similarity=0.405  Sum_probs=25.9

Q ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHhhccc
Q 034029           18 PIPYLFTSLALVLVLIAVALVLLLCSYHKR   47 (105)
Q Consensus        18 PvPYLFgGLA~MlgLIAvALliLaCSy~K~   47 (105)
                      ..||+..|+.+++.|+.+|+.-.-..++|.
T Consensus       113 ~~~~i~~G~ia~~lLl~LaiTS~~~~~rrL  142 (205)
T PRK05419        113 KRPYITVGMAAFLILLPLALTSTRASQRRL  142 (205)
T ss_pred             hchHHHHHHHHHHHHHHHHHHhhHHHHHHH
Confidence            468999999999999999999888887754


No 42 
>PF06596 PsbX:  Photosystem II reaction centre X protein (PsbX);  InterPro: IPR009518 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  The low molecular weight transmembrane protein PsbX found in PSII is associated with the oxygen-evolving complex. Its expression is light-regulated. PsbX appears to be involved in the regulation of the amount of PSII [], and may be involved in the binding or turnover of quinone molecules at the Qb (PsbA) site [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0016020 membrane; PDB: 3ARC_x 3A0H_X 3A0B_X 3PRR_X 1S5L_x 4FBY_j 3PRQ_X 3KZI_X 3BZ2_X 3BZ1_X.
Probab=44.27  E-value=39  Score=20.46  Aligned_cols=20  Identities=30%  Similarity=0.453  Sum_probs=14.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 034029           22 LFTSLALVLVLIAVALVLLL   41 (105)
Q Consensus        22 LFgGLA~MlgLIAvALliLa   41 (105)
                      |+.|-++.++.|++||+...
T Consensus        12 l~aG~~iVv~~i~~ali~VS   31 (39)
T PF06596_consen   12 LVAGAVIVVIPIAGALIFVS   31 (39)
T ss_dssp             HHHHH-HHHHHHHHHHHHHH
T ss_pred             HHhhhhhhhhhhhhheEEEe
Confidence            66777788888998888653


No 43 
>PHA02909 hypothetical protein; Provisional
Probab=43.71  E-value=28  Score=23.23  Aligned_cols=9  Identities=44%  Similarity=1.003  Sum_probs=6.7

Q ss_pred             HHHHHHhhc
Q 034029           37 LVLLLCSYH   45 (105)
Q Consensus        37 LliLaCSy~   45 (105)
                      ..||||||-
T Consensus        49 ftilacsyv   57 (72)
T PHA02909         49 FTILACSYV   57 (72)
T ss_pred             HHHHHHHHH
Confidence            357899984


No 44 
>PHA03283 envelope glycoprotein E; Provisional
Probab=43.35  E-value=37  Score=30.61  Aligned_cols=26  Identities=23%  Similarity=0.350  Sum_probs=22.4

Q ss_pred             hHH--HHHHHHHHHHHHHHHHHHHHHhh
Q 034029           19 IPY--LFTSLALVLVLIAVALVLLLCSY   44 (105)
Q Consensus        19 vPY--LFgGLA~MlgLIAvALliLaCSy   44 (105)
                      -+|  +++|+.+..||+.++|.+.+|-+
T Consensus       397 ~~~l~~~~~~~~~~~~~~~~l~vw~c~~  424 (542)
T PHA03283        397 RHYLAFLLAIICTCAALLVALVVWGCIL  424 (542)
T ss_pred             cccchhHHHHHHHHHHHHHHHhhhheee
Confidence            556  58888899999999999999987


No 45 
>PRK05696 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=43.06  E-value=92  Score=22.94  Aligned_cols=20  Identities=15%  Similarity=0.248  Sum_probs=15.7

Q ss_pred             CCCCeEEEEecCCCCCccce
Q 034029           71 DPEPKVVVIMAGDDKPRYLA   90 (105)
Q Consensus        71 ~~e~kivVIMAGd~~PTfLA   90 (105)
                      +.+|.|+|=++|+.+-.||-
T Consensus        71 ~l~~~fvvNl~~~~~~ryLk   90 (170)
T PRK05696         71 PMPRPFVFNVPGNGRDRLVQ   90 (170)
T ss_pred             ecCCCEEEEecCCCCceEEE
Confidence            44567999999888888885


No 46 
>PF06697 DUF1191:  Protein of unknown function (DUF1191);  InterPro: IPR010605 This family contains hypothetical plant proteins of unknown function.
Probab=42.76  E-value=6  Score=32.60  Aligned_cols=59  Identities=12%  Similarity=0.184  Sum_probs=30.3

Q ss_pred             CCcccccCchHHHHHH-HHHHHHHHHHHHHHHHHhhcccCCCCCCCCCCCCCCCCCCCCCCCCCCCeEEEEecCCCC
Q 034029           10 APIDLWHSPIPYLFTS-LALVLVLIAVALVLLLCSYHKRYSNSSSGNGRDQENQPAVLPKVLDPEPKVVVIMAGDDK   85 (105)
Q Consensus        10 ~~~~~W~SPvPYLFgG-LA~MlgLIAvALliLaCSy~K~~s~s~~~~~~d~ek~~~~~~~~~~~e~kivVIMAGd~~   85 (105)
                      ...|.|.     +.+| .+-.++|+-++++++.+.++|...--            +++|...+.+|..=+.|.|+.+
T Consensus       208 ~~~~~W~-----iv~g~~~G~~~L~ll~~lv~~~vr~krk~k~------------~eMEr~A~~gE~L~~~~VG~sr  267 (278)
T PF06697_consen  208 KRSWWWK-----IVVGVVGGVVLLGLLSLLVAMLVRYKRKKKI------------EEMERRAEEGEALQMSWVGGSR  267 (278)
T ss_pred             CcceeEE-----EEEEehHHHHHHHHHHHHHHhhhhhhHHHHH------------HHHHHhhccCceeeeEEEcccc
Confidence            4556676     3333 22222345555666777776643210            1222333445555588888876


No 47 
>PF06305 DUF1049:  Protein of unknown function (DUF1049);  InterPro: IPR010445 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=42.71  E-value=47  Score=20.34  Aligned_cols=30  Identities=23%  Similarity=0.276  Sum_probs=16.8

Q ss_pred             CcccccCchHH-HHHHHHHHHHHHHHHHHHH
Q 034029           11 PIDLWHSPIPY-LFTSLALVLVLIAVALVLL   40 (105)
Q Consensus        11 ~~~~W~SPvPY-LFgGLA~MlgLIAvALliL   40 (105)
                      .+..|+.+.|. +...+++.+|.|...|+.+
T Consensus        10 ~~~~~~~~~pl~l~il~~f~~G~llg~l~~~   40 (68)
T PF06305_consen   10 NFLFGQFPLPLGLLILIAFLLGALLGWLLSL   40 (68)
T ss_pred             EEEeeeccchHHHHHHHHHHHHHHHHHHHHH
Confidence            34567777775 4455555566655554443


No 48 
>PF09049 SNN_transmemb:  Stannin transmembrane;  InterPro: IPR015135 This region consists of a single highly hydrophobic transmembrane helix that transverses the lipid bilayer at a 20 degree angle with respect to the membrane normal. It contains a conserved cysteine residue (Cys32) that, together with Cys34 found in the stannin unstructured linker domain, constitutes the putative trimethyltin-binding site that resides at the end of the transmembrane domain close to the lipid/solvent interface []. ; PDB: 1ZZA_A.
Probab=42.27  E-value=70  Score=18.66  Aligned_cols=27  Identities=41%  Similarity=0.735  Sum_probs=14.5

Q ss_pred             cCchHHHHHHHHHHHHHHHHH-HHHHHHhhc
Q 034029           16 HSPIPYLFTSLALVLVLIAVA-LVLLLCSYH   45 (105)
Q Consensus        16 ~SPvPYLFgGLA~MlgLIAvA-LliLaCSy~   45 (105)
                      |||+-   |-.-...-|||+| |-+|.|-.|
T Consensus         6 hsptt---gvvti~viliavaalg~licgcw   33 (33)
T PF09049_consen    6 HSPTT---GVVTIIVILIAVAALGALICGCW   33 (33)
T ss_dssp             TTTHH---HHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCc---cEEEehhHHHHHHHHhhhheecC
Confidence            56653   3334445567765 445666544


No 49 
>COG4961 TadG Flp pilus assembly protein TadG [Intracellular trafficking and secretion]
Probab=42.26  E-value=27  Score=25.97  Aligned_cols=20  Identities=30%  Similarity=0.441  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHh
Q 034029           24 TSLALVLVLIAVALVLLLCS   43 (105)
Q Consensus        24 gGLA~MlgLIAvALliLaCS   43 (105)
                      |..|++++||+.-|++|.+-
T Consensus        21 Ga~AVeFAlvap~ll~l~~g   40 (185)
T COG4961          21 GAAAVEFALVAPPLLLLVFG   40 (185)
T ss_pred             chHHHHHHHHHHHHHHHHHH
Confidence            56789999999999888764


No 50 
>PF14241 DUF4341:  Domain of unknown function (DUF4341)
Probab=41.16  E-value=44  Score=21.22  Aligned_cols=22  Identities=36%  Similarity=0.490  Sum_probs=14.6

Q ss_pred             CchHHHHHHHHHHHHHHHHHHHHH
Q 034029           17 SPIPYLFTSLALVLVLIAVALVLL   40 (105)
Q Consensus        17 SPvPYLFgGLA~MlgLIAvALliL   40 (105)
                      ||.+.++||+  ++|+-++.|+.+
T Consensus         1 Tp~~~l~GG~--lIGla~~~ll~~   22 (62)
T PF14241_consen    1 TPWSALIGGL--LIGLAASLLLLL   22 (62)
T ss_pred             CccHHHHHHH--HHHHHHHHHHHH
Confidence            5788888885  556655555544


No 51 
>COG3715 ManY Phosphotransferase system, mannose/fructose/N-acetylgalactosamine-specific component IIC [Carbohydrate transport and metabolism]
Probab=40.33  E-value=87  Score=25.74  Aligned_cols=13  Identities=31%  Similarity=0.741  Sum_probs=10.3

Q ss_pred             CchHHHHHHHHHH
Q 034029           17 SPIPYLFTSLALV   29 (105)
Q Consensus        17 SPvPYLFgGLA~M   29 (105)
                      .=.||+|.|+.+.
T Consensus       204 ~~~pff~lGFv~a  216 (265)
T COG3715         204 ELIPFFFLGFVLA  216 (265)
T ss_pred             chhHHHHHHHHHH
Confidence            3479999998765


No 52 
>PF10873 DUF2668:  Protein of unknown function (DUF2668);  InterPro: IPR022640  Members in this family of proteins are annotated as cysteine and tyrosine-rich protein 1, however currently no function is known []. 
Probab=40.10  E-value=30  Score=26.51  Aligned_cols=29  Identities=14%  Similarity=0.322  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhcccCCCCC
Q 034029           23 FTSLALVLVLIAVALVLLLCSYHKRYSNSS   52 (105)
Q Consensus        23 FgGLA~MlgLIAvALliLaCSy~K~~s~s~   52 (105)
                      .+|..++||+||. ..|..|-+.|++++++
T Consensus        67 VfgiVfimgvva~-i~icvCmc~kn~rgsR   95 (155)
T PF10873_consen   67 VFGIVFIMGVVAG-IAICVCMCMKNSRGSR   95 (155)
T ss_pred             ehhhHHHHHHHHH-HHHHHhhhhhcCCCcc
Confidence            4677788888774 4566777777665444


No 53 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=39.95  E-value=45  Score=23.57  Aligned_cols=26  Identities=23%  Similarity=0.379  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhcccC
Q 034029           23 FTSLALVLVLIAVALVLLLCSYHKRY   48 (105)
Q Consensus        23 FgGLA~MlgLIAvALliLaCSy~K~~   48 (105)
                      ..++-++|-||.++.-|++|-..|+.
T Consensus         3 Ll~il~llLll~l~asl~~wr~~~rq   28 (107)
T PF15330_consen    3 LLGILALLLLLSLAASLLAWRMKQRQ   28 (107)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            44555566677788888888776654


No 54 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=39.87  E-value=30  Score=23.96  Aligned_cols=6  Identities=0%  Similarity=-0.114  Sum_probs=2.4

Q ss_pred             HHhhcc
Q 034029           41 LCSYHK   46 (105)
Q Consensus        41 aCSy~K   46 (105)
                      ..+-+.
T Consensus        22 evaa~~   27 (95)
T PF07172_consen   22 EVAARE   27 (95)
T ss_pred             hhhhHH
Confidence            344333


No 55 
>PF01998 DUF131:  Protein of unknown function DUF131;  InterPro: IPR002849 This archaebacterial protein family has no known function. The proteins are predicted to contain two transmembrane helices.
Probab=39.62  E-value=17  Score=23.85  Aligned_cols=25  Identities=36%  Similarity=0.758  Sum_probs=14.5

Q ss_pred             CchHHHHHH---HHHHHHHHHHHHHHHH
Q 034029           17 SPIPYLFTS---LALVLVLIAVALVLLL   41 (105)
Q Consensus        17 SPvPYLFgG---LA~MlgLIAvALliLa   41 (105)
                      =|+|-.||.   ++..+.++|+.|++++
T Consensus        32 GPIPIvFGs~~~~~~~~~ilaiil~i~~   59 (64)
T PF01998_consen   32 GPIPIVFGSSPRIAKIAMILAIILMILA   59 (64)
T ss_pred             ecccEEEcCCHHHHHHHHHHHHHHHHHH
Confidence            378888874   4555555555555543


No 56 
>PF14991 MLANA:  Protein melan-A; PDB: 2GTZ_F 2GT9_F 3MRO_P 2GUO_C 3MRQ_P 2GTW_C 3L6F_C 3MRP_P.
Probab=39.54  E-value=9.8  Score=28.02  Aligned_cols=19  Identities=42%  Similarity=0.642  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHhhcccC
Q 034029           30 LVLIAVALVLLLCSYHKRY   48 (105)
Q Consensus        30 lgLIAvALliLaCSy~K~~   48 (105)
                      |.+|-..|||+-|-|.|.+
T Consensus        32 L~VILgiLLliGCWYckRR   50 (118)
T PF14991_consen   32 LIVILGILLLIGCWYCKRR   50 (118)
T ss_dssp             -------------------
T ss_pred             HHHHHHHHHHHhheeeeec
Confidence            3344445666777765543


No 57 
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=38.98  E-value=10  Score=32.61  Aligned_cols=42  Identities=14%  Similarity=0.216  Sum_probs=0.0

Q ss_pred             CCCcccccCchHHHHHHHHHHHHHHHHHHHHHHHhhcccCCC
Q 034029            9 TAPIDLWHSPIPYLFTSLALVLVLIAVALVLLLCSYHKRYSN   50 (105)
Q Consensus         9 ~~~~~~W~SPvPYLFgGLA~MlgLIAvALliLaCSy~K~~s~   50 (105)
                      ..+...|..-+-.+.|+.++++.++.++++++.|.+||....
T Consensus       345 ~~~~~~~~~~l~vVlgvavlivVv~viv~vc~~~rrrR~~~~  386 (439)
T PF02480_consen  345 SPRTSRGAALLGVVLGVAVLIVVVGVIVWVCLRCRRRRRQRD  386 (439)
T ss_dssp             ------------------------------------------
T ss_pred             CCCCCcccchHHHHHHHHHHHHHHHHHhheeeeehhcccccc
Confidence            456677888888888877777777777888888877765443


No 58 
>PF05568 ASFV_J13L:  African swine fever virus J13L protein;  InterPro: IPR008385 This family consists of several African swine fever virus (ASFV) j13L proteins [, , ].
Probab=38.60  E-value=46  Score=25.96  Aligned_cols=21  Identities=33%  Similarity=0.781  Sum_probs=14.1

Q ss_pred             HHHHHHHHHHHHHHHHhhccc
Q 034029           27 ALVLVLIAVALVLLLCSYHKR   47 (105)
Q Consensus        27 A~MlgLIAvALliLaCSy~K~   47 (105)
                      +..+-+|-+-+||..||+||.
T Consensus        37 aIvVliiiiivli~lcssRKk   57 (189)
T PF05568_consen   37 AIVVLIIIIIVLIYLCSSRKK   57 (189)
T ss_pred             HHHHHHHHHHHHHHHHhhhhH
Confidence            333444566677888999886


No 59 
>PF15339 Afaf:  Acrosome formation-associated factor
Probab=38.52  E-value=44  Score=26.50  Aligned_cols=23  Identities=17%  Similarity=0.349  Sum_probs=19.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHh
Q 034029           21 YLFTSLALVLVLIAVALVLLLCS   43 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALliLaCS   43 (105)
                      =|..|+.+|-.||-+.||++.|.
T Consensus       131 kLmLGIsLmTl~lfv~Ll~~c~a  153 (200)
T PF15339_consen  131 KLMLGISLMTLFLFVILLAFCSA  153 (200)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Confidence            38899999999998888888764


No 60 
>PF05255 UPF0220:  Uncharacterised protein family (UPF0220);  InterPro: IPR007919 This family of proteins is functionally uncharacterised.
Probab=38.44  E-value=41  Score=25.44  Aligned_cols=26  Identities=27%  Similarity=0.387  Sum_probs=22.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcc
Q 034029           21 YLFTSLALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALliLaCSy~K   46 (105)
                      .||.|+++|.|=++-|+-||.=-|-.
T Consensus       102 ~LFigf~l~fggl~~s~~vli~~yv~  127 (166)
T PF05255_consen  102 WLFIGFALSFGGLAGSVWVLILKYVV  127 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhccccc
Confidence            69999999999999999999865544


No 61 
>PRK09458 pspB phage shock protein B; Provisional
Probab=37.90  E-value=35  Score=23.25  Aligned_cols=29  Identities=24%  Similarity=0.438  Sum_probs=23.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcccCC
Q 034029           21 YLFTSLALVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALliLaCSy~K~~s   49 (105)
                      ++|.+.-+++++|-||.+=|..-|+....
T Consensus         3 ~~fl~~PliiF~ifVaPiWL~LHY~sk~~   31 (75)
T PRK09458          3 ALFLAIPLTIFVLFVAPIWLWLHYRSKRQ   31 (75)
T ss_pred             chHHHHhHHHHHHHHHHHHHHHhhccccc
Confidence            67888888999999999999888866443


No 62 
>PF03381 CDC50:  LEM3 (ligand-effect modulator 3) family / CDC50 family;  InterPro: IPR005045 Members of this family have no known function. They have predicted transmembrane helices.; GO: 0016020 membrane
Probab=37.89  E-value=75  Score=25.45  Aligned_cols=35  Identities=3%  Similarity=0.067  Sum_probs=25.2

Q ss_pred             ccccCchHHHHHHHHHHHHHHHHHHHHHHHhhccc
Q 034029           13 DLWHSPIPYLFTSLALVLVLIAVALVLLLCSYHKR   47 (105)
Q Consensus        13 ~~W~SPvPYLFgGLA~MlgLIAvALliLaCSy~K~   47 (105)
                      ...+--..++|..+++...++++.|+++-+.+-|.
T Consensus       239 Ggkn~~Lgi~ylvvg~i~~v~~i~~~~~~~~~~r~  273 (278)
T PF03381_consen  239 GGKNYFLGIAYLVVGGICLVLAIIFLIIHYFKPRK  273 (278)
T ss_pred             CccccHHHHHHHHHHHHHHHHHHHHHHHHHhCCCC
Confidence            33455567788888888888888888887765443


No 63 
>PRK07021 fliL flagellar basal body-associated protein FliL; Reviewed
Probab=37.03  E-value=1.5e+02  Score=21.71  Aligned_cols=19  Identities=32%  Similarity=0.323  Sum_probs=13.4

Q ss_pred             CCCCeEEEEe-cCCCCCccce
Q 034029           71 DPEPKVVVIM-AGDDKPRYLA   90 (105)
Q Consensus        71 ~~e~kivVIM-AGd~~PTfLA   90 (105)
                      +.+ .|+|=+ .+++..+||-
T Consensus        63 ~L~-~f~VNL~~~~~~~rylk   82 (162)
T PRK07021         63 PLE-TFTVNLQPDDDADRVLY   82 (162)
T ss_pred             ecC-CEEEEcCCCCCCceEEE
Confidence            444 488888 5666788875


No 64 
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional
Probab=36.23  E-value=1.7e+02  Score=23.56  Aligned_cols=15  Identities=7%  Similarity=0.388  Sum_probs=10.8

Q ss_pred             CCCCeEEEEecCCCC
Q 034029           71 DPEPKVVVIMAGDDK   85 (105)
Q Consensus        71 ~~e~kivVIMAGd~~   85 (105)
                      +.+++|-|||+--+.
T Consensus        67 ~~~~~isVVIP~yNe   81 (333)
T PTZ00260         67 DSDVDLSIVIPAYNE   81 (333)
T ss_pred             CCCeEEEEEEeeCCC
Confidence            567788899885444


No 65 
>KOG3626 consensus Organic anion transporter [Secondary metabolites biosynthesis, transport and catabolism]
Probab=35.27  E-value=98  Score=28.80  Aligned_cols=27  Identities=22%  Similarity=0.424  Sum_probs=22.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhcc
Q 034029           20 PYLFTSLALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        20 PYLFgGLA~MlgLIAvALliLaCSy~K   46 (105)
                      =|.|.||.+++.+|++.++|+.---||
T Consensus       673 r~~y~gl~~~~~~~~~i~~i~~~~v~r  699 (735)
T KOG3626|consen  673 RYRYLGLHIILKVIALILLIIDLYVWR  699 (735)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            478999999999999988888665555


No 66 
>PHA00736 hypothetical protein
Probab=34.65  E-value=36  Score=23.22  Aligned_cols=14  Identities=36%  Similarity=0.525  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHH
Q 034029           22 LFTSLALVLVLIAV   35 (105)
Q Consensus        22 LFgGLA~MlgLIAv   35 (105)
                      ||-|+++++||||=
T Consensus        57 lfwgi~vifgliag   70 (79)
T PHA00736         57 LFWGITVIFGLIAG   70 (79)
T ss_pred             HHHHHHHHHHHHHH
Confidence            78899999999974


No 67 
>PF13807 GNVR:  G-rich domain on putative tyrosine kinase
Probab=34.63  E-value=80  Score=20.33  Aligned_cols=19  Identities=42%  Similarity=0.413  Sum_probs=14.3

Q ss_pred             cCchHHHHHHHHHHHHHHH
Q 034029           16 HSPIPYLFTSLALVLVLIA   34 (105)
Q Consensus        16 ~SPvPYLFgGLA~MlgLIA   34 (105)
                      .+|-.-++..+|+++||+.
T Consensus        54 ~~P~~~lil~l~~~~Gl~l   72 (82)
T PF13807_consen   54 VSPKRALILALGLFLGLIL   72 (82)
T ss_pred             CCCcHHHHHHHHHHHHHHH
Confidence            3566778888888888854


No 68 
>PF12606 RELT:  Tumour necrosis factor receptor superfamily member 19;  InterPro: IPR022248 The members of tumor necrosis factor receptor (TNFR) superfamily have been designated as the "guardians of the immune system" due to their roles in immune cell proliferation, differentiation, activation, and death (apoptosis).  RELT (receptor expressed in lymphoid tissues) is a member of the TNFR superfamily. The messenger RNA of RELT is especially abundant in hematologic tissues such as spleen, lymph node, and peripheral blood leukocytes as well as in leukemias and lymphomas. RELT is able to activate the NF-kappaB pathway and selectively binds tumor necrosis factor receptor-associated factor 1 []. RELT like proteins 1 and 2 (RELL1 and RELL2) are two RELT homologues that bind to RELT. The expression of RELL1 at the mRNA level is ubiquitous, whereas expression of RELL2 mRNA is more restricted to particular tissues [].
Probab=34.55  E-value=1.2e+02  Score=19.02  Aligned_cols=21  Identities=24%  Similarity=0.371  Sum_probs=12.8

Q ss_pred             HHHHHHHHHHhhcccCCCCCC
Q 034029           33 IAVALVLLLCSYHKRYSNSSS   53 (105)
Q Consensus        33 IAvALliLaCSy~K~~s~s~~   53 (105)
                      |.+-|.++.|.--|..+...+
T Consensus        12 v~~lLg~~I~~~~K~ygYkht   32 (50)
T PF12606_consen   12 VMGLLGLSICTTLKAYGYKHT   32 (50)
T ss_pred             HHHHHHHHHHHHhhccccccc
Confidence            344456677877776665444


No 69 
>COG4594 FecB ABC-type Fe3+-citrate transport system, periplasmic component [Inorganic ion transport and metabolism]
Probab=34.28  E-value=83  Score=26.54  Aligned_cols=20  Identities=30%  Similarity=0.567  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHHHHHHHhhc
Q 034029           26 LALVLVLIAVALVLLLCSYH   45 (105)
Q Consensus        26 LA~MlgLIAvALliLaCSy~   45 (105)
                      .+.|++|+..-||+-+||-.
T Consensus         6 ~~~i~~lll~lllva~C~~s   25 (310)
T COG4594           6 TAIILTLLLLLLLVAACSSS   25 (310)
T ss_pred             hHHHHHHHHHHHHHHHhcCc
Confidence            46788999888999999865


No 70 
>PRK13726 conjugal transfer pilus assembly protein TraE; Provisional
Probab=33.98  E-value=83  Score=24.13  Aligned_cols=34  Identities=18%  Similarity=0.122  Sum_probs=25.8

Q ss_pred             cCchHHH---HHHHHHHHHHHHHHHHHHHHhhcccCC
Q 034029           16 HSPIPYL---FTSLALVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        16 ~SPvPYL---FgGLA~MlgLIAvALliLaCSy~K~~s   49 (105)
                      +|-.=++   |.+|+..+.|+.++.++|++.-|+...
T Consensus         7 ~~~~~~~~~~~~~l~~l~~~~~~~~v~l~~~~~~~~~   43 (188)
T PRK13726          7 LSTSRVMAIAFIFLSVLIVLSLSVNVIQGVNNYRLQN   43 (188)
T ss_pred             ccchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            3344455   888888888888999999999887543


No 71 
>PF10883 DUF2681:  Protein of unknown function (DUF2681);  InterPro: IPR020274 This entry contains membrane proteins with no known function.
Probab=33.54  E-value=50  Score=22.87  Aligned_cols=20  Identities=25%  Similarity=0.084  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHhhcccC
Q 034029           29 VLVLIAVALVLLLCSYHKRY   48 (105)
Q Consensus        29 MlgLIAvALliLaCSy~K~~   48 (105)
                      .+|++++.++|++.-+||..
T Consensus         7 v~~~~~v~~~i~~y~~~k~~   26 (87)
T PF10883_consen    7 VGGVGAVVALILAYLWWKVK   26 (87)
T ss_pred             HHHHHHHHHHHHHHHHHHHH
Confidence            44677788888888888863


No 72 
>PF06103 DUF948:  Bacterial protein of unknown function (DUF948);  InterPro: IPR009293 This family consists of bacterial sequences several of which are thought to be general stress proteins.
Probab=33.46  E-value=40  Score=22.01  Aligned_cols=12  Identities=25%  Similarity=0.437  Sum_probs=6.0

Q ss_pred             HHHHHHHHHHHh
Q 034029           32 LIAVALVLLLCS   43 (105)
Q Consensus        32 LIAvALliLaCS   43 (105)
                      ++|+|+++|++.
T Consensus         5 I~Aiaf~vLvi~   16 (90)
T PF06103_consen    5 IAAIAFAVLVIF   16 (90)
T ss_pred             HHHHHHHHHHHH
Confidence            445555555443


No 73 
>PF15240 Pro-rich:  Proline-rich
Probab=33.42  E-value=29  Score=27.01  Aligned_cols=13  Identities=54%  Similarity=0.754  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHH
Q 034029           29 VLVLIAVALVLLL   41 (105)
Q Consensus        29 MlgLIAvALliLa   41 (105)
                      .|.|..||||+|.
T Consensus         2 LlVLLSvALLALS   14 (179)
T PF15240_consen    2 LLVLLSVALLALS   14 (179)
T ss_pred             hhHHHHHHHHHhh
Confidence            3567889999885


No 74 
>cd02435 CCC1 CCC1. CCC1: This domain is present in the CCC1, an iron and manganese transporter of Saccharomyces cerevisiae. CCC1 is a transmembrane protein that is located in the vacuole and transfers the iron and manganese ions from the cytosol to the vacuole. This domain may be unique to certain fungi and plants.
Probab=32.59  E-value=76  Score=25.07  Aligned_cols=30  Identities=27%  Similarity=0.399  Sum_probs=17.2

Q ss_pred             hHHHHH-----HHHHHHHHHHHHHHHHHHhhcccC
Q 034029           19 IPYLFT-----SLALVLVLIAVALVLLLCSYHKRY   48 (105)
Q Consensus        19 vPYLFg-----GLA~MlgLIAvALliLaCSy~K~~   48 (105)
                      +||+|.     ++...+++-.++|+++-+.+-+.+
T Consensus       173 lPy~~~~~~~~a~~~si~l~~~aL~ilG~~~s~~s  207 (241)
T cd02435         173 LPYFFVSTVGEALLLSVIVTLVALFVFGYVKTWFT  207 (241)
T ss_pred             HHHHHccchhHHHHHHHHHHHHHHHHHHHHHHhhc
Confidence            478773     455555555666666655554443


No 75 
>PF12048 DUF3530:  Protein of unknown function (DUF3530);  InterPro: IPR022529  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 272 to 336 amino acids in length. These proteins are distantly related to alpa/beta hydrolases so they may act as enzymes. 
Probab=32.53  E-value=66  Score=25.91  Aligned_cols=16  Identities=31%  Similarity=0.630  Sum_probs=10.5

Q ss_pred             CCeEEEEecCCCCCccce
Q 034029           73 EPKVVVIMAGDDKPRYLA   90 (105)
Q Consensus        73 e~kivVIMAGd~~PTfLA   90 (105)
                      .+.|+-|.+||++  |||
T Consensus        61 ~~e~~~L~~~~~~--fla   76 (310)
T PF12048_consen   61 ADEVQWLQAGEER--FLA   76 (310)
T ss_pred             HhhcEEeecCCEE--EEE
Confidence            3677777777763  554


No 76 
>PF01794 Ferric_reduct:  Ferric reductase like transmembrane component;  InterPro: IPR013130 This family includes a common region in the transmembrane proteins mammalian cytochrome b-245 heavy chain (gp91-phox), ferric reductase transmembrane component in yeast and respiratory burst oxidase from Arabidopsis thaliana. This may be a family of flavocytochromes capable of moving electrons across the plasma membrane [] that include a potential FAD binding domain. Mutations in the sequence of cytochrome b-245 heavy chain (gp91-phox) lead to the X-linked chronic granulomatous disease. The bacteriocidal ability of phagocytic cells is reduced and is characterised by the absence of a functional plasma membrane associated NADPH oxidase [].; GO: 0005506 iron ion binding, 0009055 electron carrier activity, 0016491 oxidoreductase activity, 0050660 flavin adenine dinucleotide binding, 0016021 integral to membrane
Probab=32.48  E-value=98  Score=20.14  Aligned_cols=27  Identities=22%  Similarity=0.326  Sum_probs=19.0

Q ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHhh
Q 034029           18 PIPYLFTSLALVLVLIAVALVLLLCSY   44 (105)
Q Consensus        18 PvPYLFgGLA~MlgLIAvALliLaCSy   44 (105)
                      .-+|...|+.+++.++.+++.-+..-|
T Consensus        76 ~~~~~~~G~~a~~~l~~l~~tS~~~~R  102 (125)
T PF01794_consen   76 TGPYNLTGIIALLLLLILAVTSFPWIR  102 (125)
T ss_pred             HhhHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            346667788777777777776666666


No 77 
>PF10826 DUF2551:  Protein of unknown function (DUF2551) ;  InterPro: IPR020501 This entry contains proteins with no known function.
Probab=32.47  E-value=35  Score=23.68  Aligned_cols=18  Identities=28%  Similarity=0.250  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 034029           24 TSLALVLVLIAVALVLLL   41 (105)
Q Consensus        24 gGLA~MlgLIAvALliLa   41 (105)
                      =|.|+|+|+|+-=|=||-
T Consensus        44 ~~VasMVG~i~SrlGIL~   61 (83)
T PF10826_consen   44 RGVASMVGLIHSRLGILS   61 (83)
T ss_pred             HHHHHHHHHHHHhhhhee
Confidence            488999999999888884


No 78 
>PF04906 Tweety:  Tweety;  InterPro: IPR006990 None of the members of the tweety (tty) family have been functionally characterised. However, they are considered to be transmembrane proteins with five potential membrane-spanning regions. A number of potential functions have been suggested on the basis of homology to the yeast FTR1 and FTH1 iron transporter proteins and the mammalian neurotensin receptors 1 and 2 in that they have a similar hydrophobicity profiles although there is no detectable sequence homology to the tweety-related proteins. It has been proposed that the tweety-related proteins could be involved in transport of iron or other divalent cations or alternatively that they may be membrane-bound receptors [].
Probab=32.41  E-value=90  Score=26.37  Aligned_cols=12  Identities=33%  Similarity=0.730  Sum_probs=6.2

Q ss_pred             HHHHHHHHHHHh
Q 034029           32 LIAVALVLLLCS   43 (105)
Q Consensus        32 LIAvALliLaCS   43 (105)
                      |.|++|.++.|+
T Consensus       371 l~al~f~~~v~~  382 (406)
T PF04906_consen  371 LAALLFSILVCV  382 (406)
T ss_pred             HHHHHHHHHHHH
Confidence            344555555555


No 79 
>PF11143 DUF2919:  Protein of unknown function (DUF2919);  InterPro: IPR021318  This bacterial family of proteins has no known function. Some members are annotated as YfeZ however this cannot be confirmed. 
Probab=31.95  E-value=58  Score=24.17  Aligned_cols=23  Identities=35%  Similarity=0.333  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccC
Q 034029           25 SLALVLVLIAVALVLLLCSYHKRY   48 (105)
Q Consensus        25 GLA~MlgLIAvALliLaCSy~K~~   48 (105)
                      .+|..+|+.|+.++ +.+++|+..
T Consensus        57 ~lgL~~g~Pall~~-~l~~~R~~~   79 (149)
T PF11143_consen   57 YLGLAAGLPALLLM-LLSGRRHRS   79 (149)
T ss_pred             HHHHHHhHHHHHHH-HHHccCCCC
Confidence            46677899999888 888888743


No 80 
>PF04976 DmsC:  DMSO reductase anchor subunit (DmsC);  InterPro: IPR007059 The terminal electron transfer enzyme dimethyl sulphoxide reductase of Escherichia coli is a heterotrimeric enzyme composed of a membrane extrinsic catalytic dimer (DmsAB) and a membrane intrinsic polytopic anchor subunit (DmsC) []. This family represents DmsC.; GO: 0019645 anaerobic electron transport chain, 0016021 integral to membrane
Probab=31.63  E-value=75  Score=25.13  Aligned_cols=28  Identities=32%  Similarity=0.444  Sum_probs=19.9

Q ss_pred             CCcccccCchHH-HHHHHHHHHHHHHHHH
Q 034029           10 APIDLWHSPIPY-LFTSLALVLVLIAVAL   37 (105)
Q Consensus        10 ~~~~~W~SPvPY-LFgGLA~MlgLIAvAL   37 (105)
                      ..+..||+|..+ .|.|-++++|.+..++
T Consensus       140 ~~vp~W~~~~T~~~f~~tal~~G~~l~~~  168 (276)
T PF04976_consen  140 TTVPAWNSPWTPISFLGTALLLGAALAAL  168 (276)
T ss_pred             cchhcccCchHHHHHHHHHHHHHHHHHHH
Confidence            455679888655 7888888888865543


No 81 
>COG4736 CcoQ Cbb3-type cytochrome oxidase, subunit 3 [Posttranslational modification, protein turnover, chaperones]
Probab=31.60  E-value=92  Score=20.25  Aligned_cols=27  Identities=19%  Similarity=0.205  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcccC
Q 034029           22 LFTSLALVLVLIAVALVLLLCSYHKRY   48 (105)
Q Consensus        22 LFgGLA~MlgLIAvALliLaCSy~K~~   48 (105)
                      .+-|.+--.|+|++.|+.+++-||-.+
T Consensus         5 ~~~~~a~a~~t~~~~l~fiavi~~ayr   31 (60)
T COG4736           5 MMRGFADAWGTIAFTLFFIAVIYFAYR   31 (60)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhc
Confidence            466778888999999988888776554


No 82 
>PF06800 Sugar_transport:  Sugar transport protein;  InterPro: IPR010651 This is a family of bacterial sugar transporters approximately 300 residues long. Members include glucose uptake proteins [], ribose transport proteins, and several putative and hypothetical membrane proteins probably involved in sugar transport across bacterial membranes.; GO: 0015144 carbohydrate transmembrane transporter activity, 0034219 carbohydrate transmembrane transport, 0016021 integral to membrane
Probab=31.46  E-value=61  Score=26.41  Aligned_cols=32  Identities=34%  Similarity=0.620  Sum_probs=23.7

Q ss_pred             cccccCchHHHHHHHHHHHHHHHHHHHHHHHhhccc
Q 034029           12 IDLWHSPIPYLFTSLALVLVLIAVALVLLLCSYHKR   47 (105)
Q Consensus        12 ~~~W~SPvPYLFgGLA~MlgLIAvALliLaCSy~K~   47 (105)
                      +..|++..-+++|-+|+.+-++.+.|    +|+++.
T Consensus        94 fgEW~~~~~~~~G~~Al~liiiGv~l----ts~~~~  125 (269)
T PF06800_consen   94 FGEWTTTTQKIIGFLALVLIIIGVIL----TSYQDK  125 (269)
T ss_pred             cCCCCCcchHHHHHHHHHHHHHHHHH----hccccc
Confidence            57799999999888888777776654    455443


No 83 
>PF02411 MerT:  MerT mercuric transport protein;  InterPro: IPR003457 MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerA).; GO: 0015097 mercury ion transmembrane transporter activity, 0015694 mercury ion transport, 0016020 membrane
Probab=31.38  E-value=97  Score=22.20  Aligned_cols=18  Identities=28%  Similarity=0.578  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHhhcccCC
Q 034029           32 LIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        32 LIAvALliLaCSy~K~~s   49 (105)
                      +|+++|++|...+|+...
T Consensus        54 fi~~tl~~lg~a~~~~yr   71 (116)
T PF02411_consen   54 FIALTLLFLGYAFWRLYR   71 (116)
T ss_pred             HHHHHHHHHHHHHHHHHc
Confidence            688899999999888654


No 84 
>PF13903 Claudin_2:  PMP-22/EMP/MP20/Claudin tight junction
Probab=31.11  E-value=83  Score=21.48  Aligned_cols=25  Identities=28%  Similarity=0.385  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHhhcc
Q 034029           22 LFTSLALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        22 LFgGLA~MlgLIAvALliLaCSy~K   46 (105)
                      .|..+++++.++|+-+.++.|-+++
T Consensus        73 ~~~~l~~~~~~~a~~~~~~~~~~~~   97 (172)
T PF13903_consen   73 AFLILGLLLLLFAFVFALIGFCKRS   97 (172)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhccc
Confidence            4555566666666655555554443


No 85 
>PLN00085 photosystem II reaction center protein M (PsbM); Provisional
Probab=30.54  E-value=43  Score=25.28  Aligned_cols=14  Identities=36%  Similarity=0.567  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHH
Q 034029           29 VLVLIAVALVLLLC   42 (105)
Q Consensus        29 MlgLIAvALliLaC   42 (105)
                      .||+||.+|.||.=
T Consensus        82 iLgfIAtaLFIlIP   95 (149)
T PLN00085         82 ILGVIATALFIIIP   95 (149)
T ss_pred             HHHHHHHHHHHHHH
Confidence            58889999888743


No 86 
>PF05454 DAG1:  Dystroglycan (Dystrophin-associated glycoprotein 1);  InterPro: IPR008465 Dystroglycan is one of the dystrophin-associated glycoproteins, which is encoded by a 5.5 kb transcript in Homo sapiens. The protein product is cleaved into two non-covalently associated subunits, [alpha] (N-terminal) and [beta] (C-terminal). In skeletal muscle the dystroglycan complex works as a transmembrane linkage between the extracellular matrix and the cytoskeleton [alpha]-dystroglycan is extracellular and binds to merosin ([alpha]-2 laminin) in the basement membrane, while [beta]-dystroglycan is a transmembrane protein and binds to dystrophin, which is a large rod-like cytoskeletal protein, absent in Duchenne muscular dystrophy patients. Dystrophin binds to intracellular actin cables. In this way, the dystroglycan complex, which links the extracellular matrix to the intracellular actin cables, is thought to provide structural integrity in muscle tissues. The dystroglycan complex is also known to serve as an agrin receptor in muscle, where it may regulate agrin-induced acetylcholine receptor clustering at the neuromuscular junction. There is also evidence which suggests the function of dystroglycan as a part of the signal transduction pathway because it is shown that Grb2, a mediator of the Ras-related signal pathway, can interact with the cytoplasmic domain of dystroglycan. In general, aberrant expression of dystrophin-associated protein complex underlies the pathogenesis of Duchenne muscular dystrophy, Becker muscular dystrophy and severe childhood autosomal recessive muscular dystrophy. Interestingly, no genetic disease has been described for either [alpha]- or [beta]-dystroglycan. Dystroglycan is widely distributed in non-muscle tissues as well as in muscle tissues. During epithelial morphogenesis of kidney, the dystroglycan complex is shown to act as a receptor for the basement membrane. Dystroglycan expression in Mus musculus brain and neural retina has also been reported. However, the physiological role of dystroglycan in non-muscle tissues has remained unclear [].; PDB: 1EG4_P.
Probab=30.21  E-value=17  Score=29.95  Aligned_cols=13  Identities=23%  Similarity=0.529  Sum_probs=0.0

Q ss_pred             HHHHHHhhcccCC
Q 034029           37 LVLLLCSYHKRYS   49 (105)
Q Consensus        37 LliLaCSy~K~~s   49 (105)
                      +++..|.|||+.+
T Consensus       164 iIa~icyrrkR~G  176 (290)
T PF05454_consen  164 IIACICYRRKRKG  176 (290)
T ss_dssp             -------------
T ss_pred             HHHHHhhhhhhcc
Confidence            3344555555544


No 87 
>PF11353 DUF3153:  Protein of unknown function (DUF3153);  InterPro: IPR021499  This family of proteins with unknown function appear to be restricted to Cyanobacteria. Some members are annotated as membrane proteins however this cannot be confirmed. 
Probab=29.43  E-value=57  Score=24.75  Aligned_cols=7  Identities=14%  Similarity=-0.159  Sum_probs=4.5

Q ss_pred             CCccccc
Q 034029           10 APIDLWH   16 (105)
Q Consensus        10 ~~~~~W~   16 (105)
                      ..+|.|+
T Consensus       177 ~~~w~pn  183 (209)
T PF11353_consen  177 ASFWVPN  183 (209)
T ss_pred             EEEEecc
Confidence            4557777


No 88 
>PRK10081 entericidin B membrane lipoprotein; Provisional
Probab=28.91  E-value=71  Score=20.07  Aligned_cols=21  Identities=19%  Similarity=0.512  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHHhhcc
Q 034029           26 LALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        26 LA~MlgLIAvALliLaCSy~K   46 (105)
                      +++|+.+++.++++-+|---+
T Consensus         6 i~~i~~~l~~~~~l~~CnTv~   26 (48)
T PRK10081          6 IAAIFSVLVLSTVLTACNTTR   26 (48)
T ss_pred             HHHHHHHHHHHHHHhhhhhhh
Confidence            567777788888888895544


No 89 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=27.96  E-value=1e+02  Score=21.54  Aligned_cols=10  Identities=30%  Similarity=0.800  Sum_probs=4.3

Q ss_pred             HHHHHHHHHH
Q 034029           32 LIAVALVLLL   41 (105)
Q Consensus        32 LIAvALliLa   41 (105)
                      |+-++||||.
T Consensus        34 LVIIiLlIml   43 (85)
T PF10717_consen   34 LVIIILLIML   43 (85)
T ss_pred             HHHHHHHHHH
Confidence            3334445444


No 90 
>PRK10884 SH3 domain-containing protein; Provisional
Probab=27.94  E-value=54  Score=25.53  Aligned_cols=17  Identities=12%  Similarity=0.352  Sum_probs=12.9

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 034029           21 YLFTSLALVLVLIAVALV   38 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALl   38 (105)
                      |+.||+.+.+||| +.|+
T Consensus       174 f~~Gg~v~~~Gll-lGli  190 (206)
T PRK10884        174 FMYGGGVAGIGLL-LGLL  190 (206)
T ss_pred             HHHchHHHHHHHH-HHHH
Confidence            6788999999988 4444


No 91 
>TIGR03363 VI_chp_8 type VI secretion-associated protein, ImpA family. This protein family is one of two related families in type VI secretion systems that contain an ImpA-related N-terminal domain (pfam06812).
Probab=27.65  E-value=30  Score=28.48  Aligned_cols=9  Identities=67%  Similarity=1.449  Sum_probs=7.6

Q ss_pred             cCchHHHHH
Q 034029           16 HSPIPYLFT   24 (105)
Q Consensus        16 ~SPvPYLFg   24 (105)
                      |||||||.=
T Consensus       313 hSPvp~Ll~  321 (353)
T TIGR03363       313 HSPVPYLIE  321 (353)
T ss_pred             CCcHHHHHH
Confidence            899999863


No 92 
>PRK15065 PTS system mannose-specific transporter subunit IIC; Provisional
Probab=27.46  E-value=1e+02  Score=25.00  Aligned_cols=27  Identities=15%  Similarity=0.437  Sum_probs=18.8

Q ss_pred             chHHHHHHHHHHHHH----HHHHHHHHHHhh
Q 034029           18 PIPYLFTSLALVLVL----IAVALVLLLCSY   44 (105)
Q Consensus        18 PvPYLFgGLA~MlgL----IAvALliLaCSy   44 (105)
                      =.||+|.|+.+.--|    +++|++-.++.+
T Consensus       206 ~~~ff~lGFvl~ayl~l~~l~iAiig~~iA~  236 (262)
T PRK15065        206 LMPFFYLGFVLAAFTNLNLIALGVIGVVLAL  236 (262)
T ss_pred             hHHHHHHHHHHHHHhCCcHHHHHHHHHHHHH
Confidence            379999999876444    666666555554


No 93 
>TIGR03054 photo_alph_chp1 putative photosynthetic complex assembly protein. In twenty or so anoxygenic photosynthetic alpha-Proteobacteria known so far, a gene for a member of this protein family is present and is found in the vicinity of puhA, which encodes a component of the photosynthetic reaction center, and other genes associated with photosynthesis. This protein family is suggested, consequently, as a probable assembly factor for the photosynthetic reaction center, but its seems its actual function has not yet been demonstrated.
Probab=27.30  E-value=1.4e+02  Score=22.18  Aligned_cols=25  Identities=16%  Similarity=0.174  Sum_probs=21.2

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcccCC
Q 034029           25 SLALVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        25 GLA~MlgLIAvALliLaCSy~K~~s   49 (105)
                      -|-+|++|+.+++.+.+.+++....
T Consensus         3 ~l~a~~~Lvl~~~~lva~a~~Tg~~   27 (135)
T TIGR03054         3 LLIAMLGLVLLTFALVAFAVLTGVG   27 (135)
T ss_pred             HHHHHHHHHHHHHHHhheeeecCCC
Confidence            4678999999999999999988444


No 94 
>cd01059 CCC1_like CCC1-related family of proteins. CCC1_like: This protein family includes the proteins related to CCC1, a yeast vacuole transmembrane protein responsible for the iron and manganese transport from the cytosol into vacuole. It also includes the proteins similar to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation.
Probab=27.09  E-value=1.3e+02  Score=21.49  Aligned_cols=30  Identities=40%  Similarity=0.518  Sum_probs=15.7

Q ss_pred             hHHHHHH---HHHHHHH---HHHHHHHHHHhhcccC
Q 034029           19 IPYLFTS---LALVLVL---IAVALVLLLCSYHKRY   48 (105)
Q Consensus        19 vPYLFgG---LA~MlgL---IAvALliLaCSy~K~~   48 (105)
                      .||+|..   ++..+.+   ..++|+++.....|.+
T Consensus        79 lp~~~~~~~~~a~~~si~~~~~~~l~~~g~~~~~~~  114 (143)
T cd01059          79 LPYLLLPAGSLALAVSVALVVALALFLLGAFVAKLG  114 (143)
T ss_pred             HHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHhC
Confidence            4787763   3444433   3455555555555543


No 95 
>PF04133 Vps55:  Vacuolar protein sorting 55 ;  InterPro: IPR007262 Vps55 is involved in the secretion of the Golgi form of the soluble vacuolar carboxypeptidase Y, but not the trafficking of the membrane-bound vacuolar alkaline phosphatase. Both Vps55 and obesity receptor gene-related protein are important for functioning membrane trafficking to the vacuole/lysosome of eukaryotic cells [].
Probab=26.93  E-value=72  Score=23.00  Aligned_cols=18  Identities=33%  Similarity=0.593  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHhhccc
Q 034029           30 LVLIAVALVLLLCSYHKR   47 (105)
Q Consensus        30 lgLIAvALliLaCSy~K~   47 (105)
                      ++-|++-|+||+|.-+|+
T Consensus         7 ~~aiG~lL~IL~CAL~~n   24 (120)
T PF04133_consen    7 FLAIGFLLVILSCALYKN   24 (120)
T ss_pred             HHHHHHHHHHHHHHHhcc
Confidence            455788899999988776


No 96 
>PLN00090 photosystem II reaction center M protein; Provisional
Probab=26.68  E-value=57  Score=23.71  Aligned_cols=12  Identities=33%  Similarity=0.229  Sum_probs=7.5

Q ss_pred             HHHHHHHHHHHH
Q 034029           29 VLVLIAVALVLL   40 (105)
Q Consensus        29 MlgLIAvALliL   40 (105)
                      .+|+||.+|.||
T Consensus        75 iLafIATaLFIl   86 (113)
T PLN00090         75 FGAYLAVALGTF   86 (113)
T ss_pred             HHHHHHHHHHHH
Confidence            456666666665


No 97 
>CHL00066 psbH photosystem II protein H
Probab=26.59  E-value=94  Score=21.18  Aligned_cols=21  Identities=29%  Similarity=0.532  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHhhcc
Q 034029           26 LALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        26 LA~MlgLIAvALliLaCSy~K   46 (105)
                      .++.|+|+|+.|+|+.=-|..
T Consensus        43 Mgv~m~lf~vfl~iiLeiyNs   63 (73)
T CHL00066         43 MGVAMALFAVFLSIILEIYNS   63 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHhCc
Confidence            467788999999988755543


No 98 
>PF07589 VPEP:  PEP-CTERM motif;  InterPro: IPR013424  This entry describes a 25-residue region including an invariant Pro-Glu-Pro (PEP) motif, a thirteen residue strongly hydrophobic sequence likely to span the membrane, and a five-residue strongly basic motif that often contains four Arg residues. In most cases, this motif is found within nine residues of the C-terminal end of the protein. Proteins containing this motif typically have signal sequences at the N terminus [].
Probab=26.36  E-value=90  Score=16.69  Aligned_cols=11  Identities=27%  Similarity=0.395  Sum_probs=4.4

Q ss_pred             HHHHHHHHHHH
Q 034029           32 LIAVALVLLLC   42 (105)
Q Consensus        32 LIAvALliLaC   42 (105)
                      |+.+.|+.++.
T Consensus        10 l~~~gl~~l~~   20 (25)
T PF07589_consen   10 LLGLGLLGLAF   20 (25)
T ss_pred             HHHHHHHHHHH
Confidence            33334444444


No 99 
>PF12259 DUF3609:  Protein of unknown function (DUF3609);  InterPro: IPR022048  This domain family is found in eukaryotes and viruses, and is typically between 348 and 360 amino acids in length. 
Probab=26.26  E-value=48  Score=27.92  Aligned_cols=23  Identities=30%  Similarity=0.332  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHHHHHHHHhhcccCC
Q 034029           26 LALVLVLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        26 LA~MlgLIAvALliLaCSy~K~~s   49 (105)
                      ....++||++ |+.|+|-|++.++
T Consensus       303 v~~~~vli~v-l~~~~~~~~~~~~  325 (361)
T PF12259_consen  303 VCGAIVLIIV-LISLAWLYRTFRR  325 (361)
T ss_pred             hhHHHHHHHH-HHHHHhheeehHH


No 100
>PF05915 DUF872:  Eukaryotic protein of unknown function (DUF872);  InterPro: IPR008590 This entry represents several uncharacterised eukaryotic transmembrane proteins. The function of this currently unknown.
Probab=25.92  E-value=1.7e+02  Score=20.88  Aligned_cols=27  Identities=22%  Similarity=0.426  Sum_probs=22.1

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHhhc
Q 034029           19 IPYLFTSLALVLVLIAVALVLLLCSYH   45 (105)
Q Consensus        19 vPYLFgGLA~MlgLIAvALliLaCSy~   45 (105)
                      .|+--..||+.|.+++..|+++.+--+
T Consensus        39 ~pwK~I~la~~Lli~G~~li~~g~l~~   65 (115)
T PF05915_consen   39 IPWKSIALAVFLLIFGTVLIIIGLLLF   65 (115)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            568889999999999999888876544


No 101
>PF13623 SurA_N_2:  SurA N-terminal domain
Probab=25.91  E-value=1.2e+02  Score=22.24  Aligned_cols=18  Identities=22%  Similarity=0.508  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHHhhc
Q 034029           28 LVLVLIAVALVLLLCSYH   45 (105)
Q Consensus        28 ~MlgLIAvALliLaCSy~   45 (105)
                      +++++|++||+...=+-.
T Consensus        10 lLi~vIglAL~aFIv~d~   27 (145)
T PF13623_consen   10 LLIIVIGLALFAFIVGDF   27 (145)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            456778888877755543


No 102
>KOG0499 consensus Cyclic nucleotide-gated cation channel CNCG4 [Inorganic ion transport and metabolism; Signal transduction mechanisms]
Probab=25.31  E-value=76  Score=29.75  Aligned_cols=32  Identities=9%  Similarity=0.110  Sum_probs=25.2

Q ss_pred             CCCcccccCchHHHHHHHHHHHHHHHHHHHHH
Q 034029            9 TAPIDLWHSPIPYLFTSLALVLVLIAVALVLL   40 (105)
Q Consensus         9 ~~~~~~W~SPvPYLFgGLA~MlgLIAvALliL   40 (105)
                      .|+...=++-.=|+|--++-|||+.+|||||=
T Consensus       418 iG~~P~P~~~~E~Vf~~~~w~mGVFvFslliG  449 (815)
T KOG0499|consen  418 IGGLPEPQTLFEIVFQLLNWFMGVFVFSLLIG  449 (815)
T ss_pred             hcCCCCcchHHHHHHHHHHHHHHHHHHHHHHH
Confidence            34444445566799999999999999999984


No 103
>PF01034 Syndecan:  Syndecan domain;  InterPro: IPR001050 The syndecans are transmembrane proteoglycans which are involved in the organisation of cytoskeleton and/or actin microfilaments, and have important roles as cell surface receptors during cell-cell and/or cell-matrix interactions [, ]. Structurally, these proteins consist of four separate domains:   A signal sequence; An extracellular domain (ectodomain) of variable length whose sequence is not evolutionary conserved in the various forms of syndecans. The ectodomain contains the sites of attachment of the heparan sulphate glycosaminoglycan side chains;  A transmembrane region;  A highly conserved cytoplasmic domain of about 30 to 35 residues, which could interact with cytoskeletal proteins.    The proteins known to belong to this family are:    Syndecan 1.  Syndecan 2 or fibroglycan.  Syndecan 3 or neuroglycan or N-syndecan.  Syndecan 4 or amphiglycan or ryudocan.  Drosophila syndecan.   Caenorhabditis elegans probable syndecan (F57C7.3).    Syndecan-4, a transmembrane heparan sulphate proteoglycan, is a coreceptor with integrins in cell adhesion. It has been suggested to form a ternary signalling complex with protein kinase Calpha and phosphatidylinositol 4,5-bisphosphate (PIP2). Structural studies have demonstrated that the cytoplasmic domain undergoes a conformational transition and forms a symmetric dimer in the presence of phospholipid activator PIP2, and whose overall structure in solution exhibits a twisted clamp shape having a cavity in the centre of dimeric interface. In addition, it has been observed that the syndecan-4 variable domain interacts, strongly, not only with fatty acyl groups but also the anionic head group of PIP2. These findings indicate that PIP2 promotes oligomerisation of the syndecan-4 cytoplasmic domain for transmembrane signalling and cell-matrix adhesion [, ].; GO: 0008092 cytoskeletal protein binding, 0016020 membrane; PDB: 1EJQ_B 1EJP_B 1YBO_C 1OBY_Q.
Probab=25.28  E-value=29  Score=23.01  Aligned_cols=12  Identities=33%  Similarity=0.490  Sum_probs=0.0

Q ss_pred             HHHHHHHHHHhh
Q 034029           33 IAVALVLLLCSY   44 (105)
Q Consensus        33 IAvALliLaCSy   44 (105)
                      .|+.|++|.+.|
T Consensus        24 ~ailLIlf~iyR   35 (64)
T PF01034_consen   24 FAILLILFLIYR   35 (64)
T ss_dssp             ------------
T ss_pred             HHHHHHHHHHHH
Confidence            344444444444


No 104
>PF01594 UPF0118:  Domain of unknown function DUF20;  InterPro: IPR002549  This is a family of hypothetical proteins. A number of the sequence records state they are transmembrane proteins or putative permeases. It is not clear what source suggested that these proteins might be permeases and this information should be treated with caution.
Probab=25.09  E-value=1.1e+02  Score=23.51  Aligned_cols=26  Identities=23%  Similarity=0.379  Sum_probs=21.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhcc
Q 034029           21 YLFTSLALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALliLaCSy~K   46 (105)
                      ++||-+++++|....+++...+-.||
T Consensus       302 ~~fG~~G~il~~pi~~~~~~~~~~~~  327 (327)
T PF01594_consen  302 YLFGFIGLILAPPILAVIKAIFEEYR  327 (327)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHHhC
Confidence            57888888999988888888777664


No 105
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily. Members of this protein family belong to the family of polysaccharide chain length determinant proteins (pfam02706). All are found in species that encode the PEP-CTERM/exosortase system predicted to act in protein sorting in a number of Gram-negative bacteria, and are found near the epsH homolog that is the putative exosortase gene.
Probab=25.07  E-value=1.3e+02  Score=25.15  Aligned_cols=30  Identities=23%  Similarity=0.007  Sum_probs=23.0

Q ss_pred             chHHHHHHHHHHHHHHHHHHHHHHHhhccc
Q 034029           18 PIPYLFTSLALVLVLIAVALVLLLCSYHKR   47 (105)
Q Consensus        18 PvPYLFgGLA~MlgLIAvALliLaCSy~K~   47 (105)
                      |-+-++.++++++|++.-..+++...++..
T Consensus       411 P~~~~~l~~g~~~Gl~lg~~~~~l~e~ld~  440 (498)
T TIGR03007       411 PNRPLLMLAGLLGGLGAGIGLAFLLSQLRP  440 (498)
T ss_pred             CcHHHHHHHHHHHHHHHHHHHHHHHHHhcC
Confidence            666688888899998777777777777654


No 106
>PF15345 TMEM51:  Transmembrane protein 51
Probab=25.02  E-value=38  Score=27.46  Aligned_cols=30  Identities=13%  Similarity=0.308  Sum_probs=24.2

Q ss_pred             cccccCchHHHHHHHHHHHHHHHHHHHHHH
Q 034029           12 IDLWHSPIPYLFTSLALVLVLIAVALVLLL   41 (105)
Q Consensus        12 ~~~W~SPvPYLFgGLA~MlgLIAvALliLa   41 (105)
                      ...=.+-|-|+..|-++||.|+++-|-|--
T Consensus        53 ~ksKt~SVAyVLVG~Gv~LLLLSICL~IR~   82 (233)
T PF15345_consen   53 LKSKTFSVAYVLVGSGVALLLLSICLSIRD   82 (233)
T ss_pred             ccceeEEEEEehhhHHHHHHHHHHHHHHHH
Confidence            344556799999999999999998887754


No 107
>PTZ00201 amastin surface glycoprotein; Provisional
Probab=24.65  E-value=1.4e+02  Score=23.22  Aligned_cols=25  Identities=20%  Similarity=0.523  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhc
Q 034029           21 YLFTSLALVLVLIAVALVLLLCSYH   45 (105)
Q Consensus        21 YLFgGLA~MlgLIAvALliLaCSy~   45 (105)
                      |-+.=.|-.|-+|.+.++.|-|...
T Consensus       153 F~Llv~AW~L~iinii~lllp~~~~  177 (192)
T PTZ00201        153 FALLVVAWILDILNIIFLLLPCTVP  177 (192)
T ss_pred             HHHHHHHHHHHHHHHHHHHhccccC
Confidence            3444467778899999999999433


No 108
>PF06387 Calcyon:  D1 dopamine receptor-interacting protein (calcyon);  InterPro: IPR009431 This family consists of several D1 dopamine receptor-interacting (calcyon) proteins. D1/D5 dopamine receptors in the basal ganglia, hippocampus, and cerebral cortex modulate motor, reward, and cognitive behaviour. D1-like dopamine receptors likely modulate neocortical and hippocampal neuronal excitability and synaptic function via Ca2+ as well as cAMP-dependent signalling []. Defective calcyon proteins have been implicated in both attention-deficit/hyperactivity disorder (ADHD) [] and schizophrenia.; GO: 0050780 dopamine receptor binding, 0007212 dopamine receptor signaling pathway, 0016021 integral to membrane
Probab=24.42  E-value=57  Score=25.71  Aligned_cols=14  Identities=50%  Similarity=0.615  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHHh
Q 034029           30 LVLIAVALVLLLCS   43 (105)
Q Consensus        30 lgLIAvALliLaCS   43 (105)
                      -+||++||..|+|=
T Consensus        85 t~lI~~alAfl~Cv   98 (186)
T PF06387_consen   85 TRLIAFALAFLGCV   98 (186)
T ss_pred             hHHHHHHHHHHHHH
Confidence            36788888888887


No 109
>TIGR01167 LPXTG_anchor LPXTG-motif cell wall anchor domain. A common feature of this proteins containing this domain appears to be a high proportion of charged and zwitterionic residues immediatedly upstream of the LPXTG motif. This model differs from other descriptions of the LPXTG region by including a portion of that upstream charged region.
Probab=24.35  E-value=1.2e+02  Score=16.20  Aligned_cols=7  Identities=29%  Similarity=0.325  Sum_probs=3.3

Q ss_pred             HHHHHHH
Q 034029           20 PYLFTSL   26 (105)
Q Consensus        20 PYLFgGL   26 (105)
                      -+.+.|+
T Consensus        12 ~~~~~G~   18 (34)
T TIGR01167        12 LLLLLGL   18 (34)
T ss_pred             HHHHHHH
Confidence            3444454


No 110
>PF04964 Flp_Fap:  Flp/Fap pilin component;  InterPro: IPR007047  This entry is for the fimbriae associated protein Flp/Fap pilin component.
Probab=24.20  E-value=72  Score=19.14  Aligned_cols=13  Identities=54%  Similarity=0.751  Sum_probs=8.6

Q ss_pred             HHHHHHHHHHHHH
Q 034029           27 ALVLVLIAVALVL   39 (105)
Q Consensus        27 A~MlgLIAvALli   39 (105)
                      |++.++|+++++.
T Consensus        14 ali~alia~~ii~   26 (46)
T PF04964_consen   14 ALIAALIAVAIIA   26 (46)
T ss_pred             HHHHHHHHHHHHH
Confidence            5567777777663


No 111
>PHA03231 glycoprotein BALF4; Provisional
Probab=24.04  E-value=69  Score=30.24  Aligned_cols=24  Identities=33%  Similarity=0.470  Sum_probs=18.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhcc
Q 034029           23 FTSLALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        23 FgGLA~MlgLIAvALliLaCSy~K   46 (105)
                      ||||+.+|.+||+-++++.=.+|.
T Consensus       704 FGg~~iillvia~vv~v~l~~rr~  727 (829)
T PHA03231        704 FGGLAIGLLVIAVLVAVFLAYRRV  727 (829)
T ss_pred             hHHHHHHHHHHHHhhhhhHHHHHH
Confidence            899999988888777666555543


No 112
>TIGR02830 spore_III_AG stage III sporulation protein AG. CC A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is found in a spore formation operon and is designated stage III sporulation protein AG.
Probab=23.67  E-value=72  Score=24.69  Aligned_cols=17  Identities=35%  Similarity=0.579  Sum_probs=12.3

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 034029           26 LALVLVLIAVALVLLLC   42 (105)
Q Consensus        26 LA~MlgLIAvALliLaC   42 (105)
                      +.+.|+||+++|||+.=
T Consensus         5 ~l~il~l~GvlLli~s~   21 (186)
T TIGR02830         5 YLLVLLLIGLLLLIVSS   21 (186)
T ss_pred             HHHHHHHHHHHHHHhhc
Confidence            34567788888888764


No 113
>PRK02624 psbH photosystem II reaction center protein H; Provisional
Probab=23.53  E-value=1.2e+02  Score=20.22  Aligned_cols=21  Identities=33%  Similarity=0.634  Sum_probs=15.7

Q ss_pred             HHHHHHHHHHHHHHHHHhhcc
Q 034029           26 LALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        26 LA~MlgLIAvALliLaCSy~K   46 (105)
                      .++.|+|+++.|+|+.=-|..
T Consensus        31 Mgv~m~Lf~vFl~iiLeIYNs   51 (64)
T PRK02624         31 MAVFMVLFLVFLLIILQIYNQ   51 (64)
T ss_pred             HHHHHHHHHHHHHHHHHHhCc
Confidence            466788899999888755543


No 114
>PRK13792 lysozyme inhibitor; Provisional
Probab=23.47  E-value=42  Score=24.61  Aligned_cols=22  Identities=41%  Similarity=0.513  Sum_probs=17.1

Q ss_pred             HHHHHHHHHHHHHHHHhhcccC
Q 034029           27 ALVLVLIAVALVLLLCSYHKRY   48 (105)
Q Consensus        27 A~MlgLIAvALliLaCSy~K~~   48 (105)
                      ++++.|+++++|+-+||.-...
T Consensus         4 ~l~~ll~~~~~lLsaCs~~~~~   25 (127)
T PRK13792          4 ALWLLLAAVPVVLVACGGSDDD   25 (127)
T ss_pred             HHHHHHHHHHhheecccCCCCC
Confidence            3567788888889999987654


No 115
>PF13908 Shisa:  Wnt and FGF inhibitory regulator
Probab=23.30  E-value=36  Score=25.01  Aligned_cols=24  Identities=21%  Similarity=0.495  Sum_probs=10.2

Q ss_pred             cCchHHHHHHH--HHHHHHHHHHHHH
Q 034029           16 HSPIPYLFTSL--ALVLVLIAVALVL   39 (105)
Q Consensus        16 ~SPvPYLFgGL--A~MlgLIAvALli   39 (105)
                      ++|.-|+..++  ++++|+|+|.++|
T Consensus        70 ~~p~~~~~~~iivgvi~~Vi~Iv~~I   95 (179)
T PF13908_consen   70 YDPPIYFITGIIVGVICGVIAIVVLI   95 (179)
T ss_pred             cCccccceeeeeeehhhHHHHHHHhH
Confidence            45665522222  2344444444433


No 116
>cd02434 Nodulin-21_like_3 Nodulin-21 and CCC1-related protein family. Nodulin-21_like_3: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter.
Probab=22.82  E-value=1.2e+02  Score=23.45  Aligned_cols=21  Identities=33%  Similarity=0.362  Sum_probs=10.8

Q ss_pred             HHHHHH-HHHHHHHHHHhhccc
Q 034029           27 ALVLVL-IAVALVLLLCSYHKR   47 (105)
Q Consensus        27 A~MlgL-IAvALliLaCSy~K~   47 (105)
                      ...+++ -.++|+++-+..-+.
T Consensus       173 ~~s~~~~~~~~L~~~G~~~~~~  194 (225)
T cd02434         173 ALSILIFVAFTLFLLGSFKSKL  194 (225)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHh
Confidence            334444 455666665554443


No 117
>cd02437 CCC1_like_1 CCC1-related protein family. CCC1_like_1: This is a protein family closely related to CCC1, a family of proteins involved in iron and manganese transport. Yeast CCC1 is a vacuole transmembrane protein responsible for the iron and manganese accumulation in vacuole.
Probab=22.71  E-value=1.7e+02  Score=21.61  Aligned_cols=16  Identities=19%  Similarity=0.044  Sum_probs=7.9

Q ss_pred             HHHHHHHHHHhhcccC
Q 034029           33 IAVALVLLLCSYHKRY   48 (105)
Q Consensus        33 IAvALliLaCSy~K~~   48 (105)
                      ..++|.++-+.+.|.+
T Consensus       131 ~~~~L~~~G~~~~~~~  146 (175)
T cd02437         131 VLAILFILGLVIGKIS  146 (175)
T ss_pred             HHHHHHHHHHHHHHHc
Confidence            3444555555555543


No 118
>COG4885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=22.53  E-value=76  Score=26.73  Aligned_cols=23  Identities=30%  Similarity=0.352  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHHHHHHHHHhhccc
Q 034029           25 SLALVLVLIAVALVLLLCSYHKR   47 (105)
Q Consensus        25 GLA~MlgLIAvALliLaCSy~K~   47 (105)
                      |+...++|||+++..||--+|++
T Consensus       289 GF~~~~aL~Av~~~~~a~~rRrs  311 (312)
T COG4885         289 GFEVVFALMAVAGVALARKRRRS  311 (312)
T ss_pred             CcHHHHHHHHHHHHHHHHHHhhc
Confidence            77888999999988887666653


No 119
>PF15470 DUF4637:  Domain of unknown function (DUF4637)
Probab=22.50  E-value=23  Score=27.44  Aligned_cols=19  Identities=32%  Similarity=0.436  Sum_probs=13.2

Q ss_pred             CCCcccccCchHHHHHHHHH
Q 034029            9 TAPIDLWHSPIPYLFTSLAL   28 (105)
Q Consensus         9 ~~~~~~W~SPvPYLFgGLA~   28 (105)
                      -++||-|-||.- |++||++
T Consensus        89 dsgFWgwlsPfa-Ll~gl~a  107 (173)
T PF15470_consen   89 DSGFWGWLSPFA-LLGGLAA  107 (173)
T ss_pred             cCCchhhhcHHH-HhccccC
Confidence            379999999853 4555543


No 120
>cd04821 PA_M28_1_2 PA_M28_1_2: Protease-associated (PA) domain, peptidase family M28, subfamily-1, subgroup 2. A subgroup of PA-domain containing proteins belonging to the peptidase family M28. Family M28 contains aminopeptidases and carboxypeptidases, and has co-catalytic zinc ions. The PA domain is an insert domain in a diverse fraction of proteases. The significance of the PA domain to many of the proteins in which it is inserted is undetermined. It may be a protein-protein interaction domain. At peptidase active sites, the PA domain may participate in substrate binding and/or promoting conformational changes, which influence the stability and accessibility of the site to substrate. Proteins into which the PA domain is inserted include the following members of the peptidase family M28: i) prostate-specific membrane antigen (PSMA), ii) yeast aminopeptidase Y, and ii) human TfR (transferrin receptor)1 and human TfR2. The proteins listed above belong to other subgroups; relatively litt
Probab=22.47  E-value=64  Score=24.06  Aligned_cols=16  Identities=50%  Similarity=0.592  Sum_probs=13.4

Q ss_pred             CCCCCCCeEEEEecCC
Q 034029           68 KVLDPEPKVVVIMAGD   83 (105)
Q Consensus        68 ~~~~~e~kivVIMAGd   83 (105)
                      +.+|-+.|||||+.||
T Consensus        44 ~g~DVkGKiVvvl~~~   59 (157)
T cd04821          44 KGLDVKGKTVVILVND   59 (157)
T ss_pred             cCCCcCCcEEEEEcCC
Confidence            3468899999999886


No 121
>PRK11486 flagellar biosynthesis protein FliO; Provisional
Probab=22.37  E-value=2.7e+02  Score=20.33  Aligned_cols=16  Identities=25%  Similarity=0.412  Sum_probs=12.3

Q ss_pred             CCCCCCeEEEEecCCC
Q 034029           69 VLDPEPKVVVIMAGDD   84 (105)
Q Consensus        69 ~~~~e~kivVIMAGd~   84 (105)
                      ++-.+|||+||=.||+
T Consensus        61 slG~RErvvvVeV~~~   76 (124)
T PRK11486         61 SLGARERVVIVDVEDA   76 (124)
T ss_pred             ccCCccEEEEEEECCE
Confidence            4566788888888876


No 122
>cd01324 cbb3_Oxidase_CcoQ Cytochrome cbb oxidase CcoQ.  Cytochrome cbb3 oxidase, the terminal oxidase in the respiratory chains of proteobacteria, is a multi-chain transmembrane protein located in the cell membrane. Like other cytochrome oxidases, it catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  Found exclusively in proteobacteria, cbb3 is believed to be a modern enzyme that has evolved independently to perform a specialized function in microaerobic energy metabolism. The cbb3 operon contains four genes (ccoNOQP or fixNOQP), with ccoN coding for subunit I.  Instead of a CuA-containing subunit II analogous to other cytochrome oxidases, cbb3 utilizes subunits ccoO and ccoP, which contain one and two hemes, respectively, to transfer electrons to the binuclear center.  ccoQ, the fourth subunit, is a single transmembrane helix protein.  It has been shown to protect the core complex from proteolytic degradation by serine proteases.  See cd00919, cd01322
Probab=22.37  E-value=2e+02  Score=17.53  Aligned_cols=28  Identities=14%  Similarity=0.082  Sum_probs=18.3

Q ss_pred             HHHHHHHHHHH---HHHHHHHHHHhhcccCC
Q 034029           22 LFTSLALVLVL---IAVALVLLLCSYHKRYS   49 (105)
Q Consensus        22 LFgGLA~MlgL---IAvALliLaCSy~K~~s   49 (105)
                      .+-+++-..||   +++.+.|+.+.||+.+.
T Consensus         6 ~lr~~a~~~~l~~~~~~Figiv~wa~~p~~k   36 (48)
T cd01324           6 TLRGLADSWGLLYLALFFLGVVVWAFRPGRK   36 (48)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhCCCcc
Confidence            45566666666   55666777888887544


No 123
>COG3847 Flp Flp pilus assembly protein, pilin Flp [Intracellular trafficking and secretion]
Probab=22.29  E-value=86  Score=20.39  Aligned_cols=14  Identities=36%  Similarity=0.494  Sum_probs=10.4

Q ss_pred             HHHHHHHHHHHHHH
Q 034029           27 ALVLVLIAVALVLL   40 (105)
Q Consensus        27 A~MlgLIAvALliL   40 (105)
                      +++.+||+++++.-
T Consensus        21 glia~lIav~ii~~   34 (58)
T COG3847          21 GLIAALIAVVIIAG   34 (58)
T ss_pred             HHHHHHHHHHHHHH
Confidence            56778888888754


No 124
>TIGR03501 gamma_C_targ gammaproteobacterial enzyme C-terminal transmembrane domain. This homology domain, largely restricted to a subset of the gamma proteobacteria that excludes the enterobacteria, is found at the extreme carboxyl-terminus of a diverse set of proteins, most of which are enzymes with conventional signal sequences and with hydrolytic activities: nucleases, proteases, agarases, etc. Species that have this domain at all typically have from two to fifteen proteins tagged with this domain at the C-terminus. The agarase AgaA from Vibro sp. strain JT0107 is secreted into the medium, while the same protein heterologously expressed in E. coli is retained in the cell fraction. This suggests cleavage and release in species with this domain. Both this suggestion, and the chemical structure of the domain (motif, hydrophobic predicted transmembrane helix, cluster of basic residues) closely parallels that of the LPXTG/sortase system and the PEP-CTERM/exosortase(EpsH) system.
Probab=22.19  E-value=1e+02  Score=16.86  Aligned_cols=17  Identities=29%  Similarity=0.387  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHHHhhcc
Q 034029           30 LVLIAVALVLLLCSYHK   46 (105)
Q Consensus        30 lgLIAvALliLaCSy~K   46 (105)
                      ||..++.+|.+..-+||
T Consensus         5 lGwl~LllL~~~~~rRr   21 (26)
T TIGR03501         5 LGWLSLLLLLLLGLRRR   21 (26)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            45566656655554444


No 125
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=22.18  E-value=72  Score=24.07  Aligned_cols=19  Identities=26%  Similarity=0.396  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHHhhcccCC
Q 034029           31 VLIAVALVLLLCSYHKRYS   49 (105)
Q Consensus        31 gLIAvALliLaCSy~K~~s   49 (105)
                      .+|++.|++.+|+..+...
T Consensus         5 ~~l~l~lll~~C~~~~~~~   23 (216)
T PF11153_consen    5 LLLLLLLLLTGCSTNPNEP   23 (216)
T ss_pred             HHHHHHHHHHhhcCCCccC
Confidence            3455888999999877553


No 126
>PF10577 UPF0560:  Uncharacterised protein family UPF0560;  InterPro: IPR018890  This family of proteins has no known function. 
Probab=22.15  E-value=1.2e+02  Score=28.77  Aligned_cols=24  Identities=25%  Similarity=0.539  Sum_probs=13.9

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh
Q 034029           20 PYLFTSLALVLVLIAVALVLLLCS   43 (105)
Q Consensus        20 PYLFgGLA~MlgLIAvALliLaCS   43 (105)
                      =||.+-|+.|+.|+-+-|-+|.|.
T Consensus       273 ~fLl~ILG~~~livl~lL~vLl~y  296 (807)
T PF10577_consen  273 VFLLAILGGTALIVLILLCVLLCY  296 (807)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHh
Confidence            456666666666555555555553


No 127
>PLN00055 photosystem II reaction center protein H; Provisional
Probab=21.79  E-value=1.3e+02  Score=20.49  Aligned_cols=21  Identities=29%  Similarity=0.532  Sum_probs=15.3

Q ss_pred             HHHHHHHHHHHHHHHHHhhcc
Q 034029           26 LALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        26 LA~MlgLIAvALliLaCSy~K   46 (105)
                      .++.|+|+|+.|+|+.=-|..
T Consensus        43 Mg~~m~lf~vfl~iileiyNs   63 (73)
T PLN00055         43 MGVAMALFAVFLSIILEIYNS   63 (73)
T ss_pred             HHHHHHHHHHHHHHHHHHhcc
Confidence            466788899999888755543


No 128
>TIGR03750 conj_TIGR03750 conjugative transfer region protein, TIGR03750 family. Members of this protein family are found occasionally on plasmids. Usually, however, they are found on the bacterial main chromosome in regions flanked by markers of conjugative transfer and/or transposition.
Probab=21.75  E-value=1.6e+02  Score=21.19  Aligned_cols=28  Identities=25%  Similarity=0.222  Sum_probs=18.8

Q ss_pred             hHHHHHHHHH--HHHHHHHHHHHHHHhhcc
Q 034029           19 IPYLFTSLAL--VLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        19 vPYLFgGLA~--MlgLIAvALliLaCSy~K   46 (105)
                      .-+++++++.  ...+|.++|.|+.|..+-
T Consensus        41 l~~~~~~w~~~p~~~lig~~l~v~~gg~~l   70 (111)
T TIGR03750        41 LALLAGPWALIPTGALLGPILVVLIGGKLL   70 (111)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhHHHH
Confidence            3355555554  456788888899988743


No 129
>PF00822 PMP22_Claudin:  PMP-22/EMP/MP20/Claudin family;  InterPro: IPR004031 Several vertebrate small integral membrane glycoproteins are evolutionary related [, , ], including eye lens specific membrane protein 20 (MP20 or MP19); epithelial membrane protein-1 (EMP-1), which is also known as tumor-associated membrane protein (TMP) or as squamous cell-specific protein Cl-20; epithelial membrane protein-2 (EMP-2), which is also known as XMP; epithelial membrane protein-3 (EMP-3), also known as YMP; and peripheral myelin protein 22 (PMP-22), which is expressed in many tissues but mainly by Schwann cells as a component of myelin of the peripheral nervous system (PNS). PMP-22 probably plays a role both in myelinization and in cell proliferation. Mutations affecting PMP-22 are associated with hereditary motor and sensory neuropathies such as Charcot-Marie-Tooth disease type 1A (CMT-1A) in human or the trembler phenotype in mice. The proteins of this family are about 160 to 173 amino acid residues in size, and contain four transmembrane segments. PMP-22, EMP-1, -2 and -3 are highly similar, while MP20 is more distantly related. This family also includes the claudins, which are components of tight junctions.; GO: 0016020 membrane
Probab=21.52  E-value=1.6e+02  Score=20.35  Aligned_cols=30  Identities=23%  Similarity=0.175  Sum_probs=17.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHH-Hh-hcccCCCC
Q 034029           22 LFTSLALVLVLIAVALVLLL-CS-YHKRYSNS   51 (105)
Q Consensus        22 LFgGLA~MlgLIAvALliLa-CS-y~K~~s~s   51 (105)
                      +.....+++.+.++++++.+ .+ +|+..+..
T Consensus         3 ~q~~~~~~~~~~~~~~liva~~~~~W~~~~~~   34 (166)
T PF00822_consen    3 LQLAGFIVSSLGWLALLIVATATPYWRVSNVS   34 (166)
T ss_pred             HHHHHHHHHHHHHHHHHHHHcCchHheEecCc
Confidence            34444555666666655443 56 88876654


No 130
>PF06716 DUF1201:  Protein of unknown function (DUF1201);  InterPro: IPR009591 This entry consists of several Beet yellows virus (BYV) putative membrane-binding proteins of around 54 residues in length. The function of this currently unknown.
Probab=21.42  E-value=1.7e+02  Score=18.67  Aligned_cols=27  Identities=19%  Similarity=0.519  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHH-HHHHHHHHHhhcc
Q 034029           20 PYLFTSLALVLVLI-AVALVLLLCSYHK   46 (105)
Q Consensus        20 PYLFgGLA~MlgLI-AvALliLaCSy~K   46 (105)
                      .||..|+++.+-|. +++....+.-|++
T Consensus         7 s~L~~~F~~lIC~Fl~~~~~F~~F~~Kq   34 (54)
T PF06716_consen    7 SYLLLAFGFLICLFLFCLVVFIWFVYKQ   34 (54)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            48899999887774 4443334444444


No 131
>cd02433 Nodulin-21_like_2 Nodulin-21 and CCC1-related protein family. Nodulin-21_like_2: This is a family of proteins closely related to nodulin-21, a plant nodule-specific protein that may be involved in symbiotic nitrogen fixation. This family is also related to CCC1, a yeast vacuole transmembrane protein that functions as an iron and manganese transporter.
Probab=21.19  E-value=1.9e+02  Score=22.77  Aligned_cols=27  Identities=30%  Similarity=0.485  Sum_probs=12.9

Q ss_pred             HHHHH-----HHHHHHHHHHHHHHHHHHhhcc
Q 034029           20 PYLFT-----SLALVLVLIAVALVLLLCSYHK   46 (105)
Q Consensus        20 PYLFg-----GLA~MlgLIAvALliLaCSy~K   46 (105)
                      ||+|.     ++.+.+++..++|+++-+..-|
T Consensus       171 Pf~~~~~~~~~~~~s~~~~~~~L~~lG~~~a~  202 (234)
T cd02433         171 PFLFGMSGLAALVLSVLLVGLALLATGAVTGL  202 (234)
T ss_pred             HHHHhcchhHHHHHHHHHHHHHHHHHHHHHHh
Confidence            67652     3333344445555555544433


No 132
>cd07387 MPP_PolD2_C PolD2 (DNA polymerase delta, subunit 2), C-terminal domain. PolD2 (DNA polymerase delta, subunit 2) is an auxiliary subunit of the eukaryotic DNA polymerase delta (PolD) complex thought to play a regulatory role and to serve as a scaffold for PolD assembly by interacting simultaneously with all of the other three subunits.  PolD2 is catalytically inactive and lacks the active site residues required for phosphoesterase activity in other members of this superfamily.  PolD2 is also involved in the recruitment of several proteins regulating DNA metabolism, including p21, PDIP1, PDIP38, PDIP46, and WRN. Human PolD consists of four subunits: p125 (PolD1), p50 (PolD2), p66(PolD3), and p12(PolD4).  PolD is one of three major replicases in eukaryotes. PolD also plays an essential role in translesion DNA synthesis, homologous recombination, and DNA repair.  Within the PolD complex, PolD2 tightly associates with PolD3.  PolD2 belongs to the metallophosphatase (MPP) superfamily
Probab=20.63  E-value=60  Score=26.01  Aligned_cols=16  Identities=25%  Similarity=0.345  Sum_probs=14.1

Q ss_pred             EEEecCCCCCccceec
Q 034029           77 VVIMAGDDKPRYLATQ   92 (105)
Q Consensus        77 vVIMAGd~~PTfLAkP   92 (105)
                      |+||+|++-|+=.+-|
T Consensus        97 V~imPG~~Dp~~~~lP  112 (257)
T cd07387          97 VDLMPGEFDPANHSLP  112 (257)
T ss_pred             EEECCCCCCcccccCC
Confidence            7899999999998855


No 133
>PHA02337 putative high light inducible protein
Probab=20.60  E-value=2e+02  Score=16.97  Aligned_cols=21  Identities=14%  Similarity=0.173  Sum_probs=14.6

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHH
Q 034029           19 IPYLFTSLALVLVLIAVALVLL   40 (105)
Q Consensus        19 vPYLFgGLA~MlgLIAvALliL   40 (105)
                      -+=.+-|=.+|+|+++ +|++-
T Consensus         4 ~aE~~NGRlAMiGfv~-~~~~e   24 (35)
T PHA02337          4 EAEIFNGWLAMIGFVA-AVGAY   24 (35)
T ss_pred             HHHHHhhHHHHHHHHH-HHHHH
Confidence            3446678899999988 44443


No 134
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=20.38  E-value=68  Score=17.64  Aligned_cols=19  Identities=32%  Similarity=0.588  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHHHHHHHHHhh
Q 034029           25 SLALVLVLIAVALVLLLCSY   44 (105)
Q Consensus        25 GLA~MlgLIAvALliLaCSy   44 (105)
                      |+|+++.|. +-|+|.-||+
T Consensus         5 ~FalivVLF-ILLiIvG~s~   23 (24)
T PF09680_consen    5 GFALIVVLF-ILLIIVGASC   23 (24)
T ss_pred             cchhHHHHH-HHHHHhccee
Confidence            455555543 3356667765


No 135
>PRK13415 flagella biosynthesis protein FliZ; Provisional
Probab=20.15  E-value=1.8e+02  Score=23.32  Aligned_cols=25  Identities=16%  Similarity=0.299  Sum_probs=12.7

Q ss_pred             CCCcccccCchHHHHHHHHHHHHHHHH
Q 034029            9 TAPIDLWHSPIPYLFTSLALVLVLIAV   35 (105)
Q Consensus         9 ~~~~~~W~SPvPYLFgGLA~MlgLIAv   35 (105)
                      +++.+.|.  +-=++++|+++++||.+
T Consensus        60 ~~~~s~~~--l~qmi~aL~~VI~Liy~   84 (219)
T PRK13415         60 ASSVSAFD--FVKLIGATLFVIFLIYA   84 (219)
T ss_pred             CCCccHHH--HHHHHHHHHHHHHHHHH
Confidence            35555564  33356666555444433


No 136
>COG3197 FixS Uncharacterized protein, possibly involved in nitrogen fixation [Inorganic ion transport and metabolism]
Probab=20.15  E-value=1.3e+02  Score=19.68  Aligned_cols=19  Identities=11%  Similarity=0.385  Sum_probs=12.0

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 034029           20 PYLFTSLALVLVLIAVALV   38 (105)
Q Consensus        20 PYLFgGLA~MlgLIAvALl   38 (105)
                      -|+...++.+||.|++.-+
T Consensus         4 l~~Lipvsi~l~~v~l~~f   22 (58)
T COG3197           4 LYILIPVSILLGAVGLGAF   22 (58)
T ss_pred             eeeHHHHHHHHHHHHHHHH
Confidence            4667777777776554433


Done!