BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034031
(105 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2D6F|A Chain A, Crystal Structure Of Glu-Trna(Gln) Amidotransferase In The
Complex With Trna(Gln)
pdb|2D6F|B Chain B, Crystal Structure Of Glu-Trna(Gln) Amidotransferase In The
Complex With Trna(Gln)
Length = 435
Score = 26.9 bits (58), Expect = 2.6, Method: Composition-based stats.
Identities = 13/36 (36%), Positives = 20/36 (55%)
Query: 29 PLPVRPSKAARFLGKPKSRARLQVQASLKEKVAEAA 64
P+PV + A R +P S A L +Q S++ +E A
Sbjct: 194 PVPVVFTGAQRSSDRPSSDASLNIQCSVRAATSEIA 229
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.312 0.124 0.330
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,895,285
Number of Sequences: 62578
Number of extensions: 47929
Number of successful extensions: 73
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 72
Number of HSP's gapped (non-prelim): 1
length of query: 105
length of database: 14,973,337
effective HSP length: 70
effective length of query: 35
effective length of database: 10,592,877
effective search space: 370750695
effective search space used: 370750695
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 45 (21.9 bits)