Citrus Sinensis ID: 034041
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| 225440460 | 267 | PREDICTED: tropinone reductase homolog [ | 0.847 | 0.333 | 0.764 | 3e-35 | |
| 147825358 | 245 | hypothetical protein VITISV_027737 [Viti | 1.0 | 0.428 | 0.657 | 3e-35 | |
| 297746018 | 252 | unnamed protein product [Vitis vinifera] | 0.876 | 0.365 | 0.728 | 5e-34 | |
| 359478613 | 539 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.876 | 0.170 | 0.728 | 6e-34 | |
| 297740326 | 277 | unnamed protein product [Vitis vinifera] | 0.895 | 0.339 | 0.723 | 7e-34 | |
| 147769646 | 270 | hypothetical protein VITISV_035429 [Viti | 0.876 | 0.340 | 0.728 | 8e-34 | |
| 225440458 | 325 | PREDICTED: tropinone reductase 1-like [V | 0.895 | 0.289 | 0.723 | 8e-34 | |
| 297746010 | 270 | unnamed protein product [Vitis vinifera] | 0.876 | 0.340 | 0.728 | 2e-33 | |
| 359478606 | 533 | PREDICTED: LOW QUALITY PROTEIN: uncharac | 0.723 | 0.142 | 0.728 | 2e-33 | |
| 449465852 | 273 | PREDICTED: tropinone reductase homolog A | 0.904 | 0.347 | 0.694 | 2e-33 |
| >gi|225440460|ref|XP_002271837.1| PREDICTED: tropinone reductase homolog [Vitis vinifera] gi|297740324|emb|CBI30506.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 152 bits (384), Expect = 3e-35, Method: Compositional matrix adjust.
Identities = 68/89 (76%), Positives = 81/89 (91%)
Query: 2 EDFSTIMTTNFESAYHLSQLAHPLLKASGNGNIVFISSVAGVIALPMCSIYASSKGAMNE 61
EDFSTIM TNFESAYHL QL HPLLKASGNG+IVFISS++G++A P SIYA+SKGAMN+
Sbjct: 117 EDFSTIMGTNFESAYHLCQLGHPLLKASGNGSIVFISSISGLLAFPASSIYAASKGAMNQ 176
Query: 62 LTKNLACEWAKDKIRVNSVAPWMIRTPLV 90
+TKNLACEWAKD IRVN++APW+I+T L+
Sbjct: 177 VTKNLACEWAKDGIRVNTIAPWIIKTSLL 205
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|147825358|emb|CAN64401.1| hypothetical protein VITISV_027737 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297746018|emb|CBI16074.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359478613|ref|XP_003632145.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized short-chain type dehydrogenase/reductase y4vI-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297740326|emb|CBI30508.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147769646|emb|CAN63543.1| hypothetical protein VITISV_035429 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225440458|ref|XP_002271432.1| PREDICTED: tropinone reductase 1-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297746010|emb|CBI16066.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|359478606|ref|XP_003632143.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized short-chain type dehydrogenase/reductase y4vI-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449465852|ref|XP_004150641.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis sativus] gi|449531117|ref|XP_004172534.1| PREDICTED: tropinone reductase homolog At1g07440-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 105 | ||||||
| TAIR|locus:2152815 | 264 | AT5G06060 [Arabidopsis thalian | 0.876 | 0.348 | 0.663 | 2.1e-29 | |
| TAIR|locus:2043177 | 269 | SAG13 "senescence-associated g | 0.838 | 0.327 | 0.693 | 3.4e-29 | |
| TAIR|locus:2043167 | 271 | AT2G29360 [Arabidopsis thalian | 0.847 | 0.328 | 0.707 | 3.4e-29 | |
| TAIR|locus:2043052 | 262 | AT2G29290 [Arabidopsis thalian | 0.904 | 0.362 | 0.589 | 5.6e-29 | |
| TAIR|locus:2025072 | 266 | AT1G07440 [Arabidopsis thalian | 0.933 | 0.368 | 0.611 | 2.4e-28 | |
| TAIR|locus:2043037 | 268 | AT2G29150 [Arabidopsis thalian | 0.828 | 0.324 | 0.681 | 3.1e-28 | |
| TAIR|locus:2025057 | 260 | AT1G07450 [Arabidopsis thalian | 0.838 | 0.338 | 0.674 | 3.9e-28 | |
| TAIR|locus:2043152 | 268 | AT2G29370 [Arabidopsis thalian | 0.828 | 0.324 | 0.678 | 3.9e-28 | |
| TAIR|locus:2042992 | 260 | TRI "tropinone reductase" [Ara | 0.838 | 0.338 | 0.659 | 5.7e-27 | |
| TAIR|locus:2043087 | 322 | AT2G29260 [Arabidopsis thalian | 0.866 | 0.282 | 0.582 | 9.4e-27 |
| TAIR|locus:2152815 AT5G06060 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 326 (119.8 bits), Expect = 2.1e-29, P = 2.1e-29
Identities = 61/92 (66%), Positives = 77/92 (83%)
Query: 2 EDFSTIMTTNFESAYHLSQLAHPLLKASGNGNIVFISSVAGVIALPMCSIYASSKGAMNE 61
E+++ IM+TN ESA+HLSQ+AHPLLKASG G+IVFISSVAG++ L SIY ++KGA+N+
Sbjct: 111 EEYAKIMSTNLESAFHLSQIAHPLLKASGVGSIVFISSVAGLVHLSSGSIYGATKGALNQ 170
Query: 62 LTKNLACEWAKDKIRVNSVAPWMIRTPLVDNL 93
LT+NLACEWA D IR N VAPW I+T LV+ L
Sbjct: 171 LTRNLACEWASDNIRTNCVAPWYIKTSLVETL 202
|
|
| TAIR|locus:2043177 SAG13 "senescence-associated gene 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043167 AT2G29360 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043052 AT2G29290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025072 AT1G07440 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043037 AT2G29150 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2025057 AT1G07450 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043152 AT2G29370 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2042992 TRI "tropinone reductase" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043087 AT2G29260 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00021371001 | SubName- Full=Chromosome chr8 scaffold_23, whole genome shotgun sequence; (180 aa) | ||||||||||
(Vitis vinifera) | |||||||||||
| GSVIVG00021145001 | • | 0.413 | |||||||||
| GSVIVG00006986001 | • | 0.406 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| cd05329 | 251 | cd05329, TR_SDR_c, tropinone reductase-I and II (T | 3e-51 | |
| PRK09242 | 257 | PRK09242, PRK09242, tropinone reductase; Provision | 4e-33 | |
| cd05233 | 234 | cd05233, SDR_c, classical (c) SDRs | 8e-32 | |
| PRK07231 | 251 | PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) | 4e-25 | |
| PRK12826 | 251 | PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote | 8e-24 | |
| COG1028 | 251 | COG1028, FabG, Dehydrogenases with different speci | 9e-24 | |
| PRK12829 | 264 | PRK12829, PRK12829, short chain dehydrogenase; Pro | 4e-22 | |
| PRK05653 | 246 | PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) | 7e-22 | |
| cd05352 | 252 | cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M | 2e-21 | |
| cd05341 | 247 | cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta | 4e-21 | |
| PRK06484 | 520 | PRK06484, PRK06484, short chain dehydrogenase; Val | 8e-21 | |
| cd05365 | 242 | cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi | 2e-20 | |
| PRK12825 | 249 | PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) | 3e-20 | |
| PRK06172 | 253 | PRK06172, PRK06172, short chain dehydrogenase; Pro | 5e-20 | |
| PRK05557 | 248 | PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) | 1e-19 | |
| TIGR01963 | 255 | TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase | 1e-19 | |
| PRK12827 | 249 | PRK12827, PRK12827, short chain dehydrogenase; Pro | 2e-19 | |
| cd05364 | 253 | cd05364, SDR_c11, classical (c) SDR, subgroup 11 | 2e-19 | |
| PRK05565 | 247 | PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) | 3e-19 | |
| cd08944 | 246 | cd08944, SDR_c12, classical (c) SDR, subgroup 12 | 6e-18 | |
| cd05347 | 248 | cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena | 1e-17 | |
| cd05333 | 240 | cd05333, BKR_SDR_c, beta-Keto acyl carrier protein | 2e-17 | |
| TIGR01830 | 239 | TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier | 6e-17 | |
| cd05358 | 253 | cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc | 6e-17 | |
| PRK07069 | 251 | PRK07069, PRK07069, short chain dehydrogenase; Val | 1e-16 | |
| PRK06077 | 252 | PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) | 2e-16 | |
| PRK12429 | 258 | PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas | 2e-16 | |
| PRK06113 | 255 | PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro | 3e-16 | |
| TIGR03971 | 265 | TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil | 3e-16 | |
| PRK07060 | 245 | PRK07060, PRK07060, short chain dehydrogenase; Pro | 3e-16 | |
| PRK06484 | 520 | PRK06484, PRK06484, short chain dehydrogenase; Val | 4e-16 | |
| cd05350 | 239 | cd05350, SDR_c6, classical (c) SDR, subgroup 6 | 6e-16 | |
| PRK08324 | 681 | PRK08324, PRK08324, short chain dehydrogenase; Val | 6e-16 | |
| PRK07856 | 252 | PRK07856, PRK07856, short chain dehydrogenase; Pro | 2e-15 | |
| cd05345 | 248 | cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl | 2e-15 | |
| cd05332 | 257 | cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste | 2e-15 | |
| PRK07523 | 255 | PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro | 2e-15 | |
| cd05351 | 244 | cd05351, XR_like_SDR_c, xylulose reductase-like, c | 2e-15 | |
| cd05324 | 225 | cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu | 3e-15 | |
| PRK12828 | 239 | PRK12828, PRK12828, short chain dehydrogenase; Pro | 5e-15 | |
| cd05374 | 248 | cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster | 6e-15 | |
| PRK06138 | 252 | PRK06138, PRK06138, short chain dehydrogenase; Pro | 6e-15 | |
| cd08935 | 271 | cd08935, mannonate_red_SDR_c, putative D-mannonate | 1e-14 | |
| PRK08628 | 258 | PRK08628, PRK08628, short chain dehydrogenase; Pro | 1e-14 | |
| PRK08589 | 272 | PRK08589, PRK08589, short chain dehydrogenase; Val | 2e-14 | |
| PRK06500 | 249 | PRK06500, PRK06500, short chain dehydrogenase; Pro | 2e-14 | |
| cd08933 | 261 | cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl | 4e-14 | |
| PRK08226 | 263 | PRK08226, PRK08226, short chain dehydrogenase; Pro | 4e-14 | |
| cd05362 | 243 | cd05362, THN_reductase-like_SDR_c, tetrahydroxynap | 4e-14 | |
| cd05356 | 239 | cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst | 5e-14 | |
| PRK12939 | 250 | PRK12939, PRK12939, short chain dehydrogenase; Pro | 6e-14 | |
| PRK12743 | 256 | PRK12743, PRK12743, oxidoreductase; Provisional | 7e-14 | |
| PRK12824 | 245 | PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro | 8e-14 | |
| PRK06398 | 258 | PRK06398, PRK06398, aldose dehydrogenase; Validate | 9e-14 | |
| PRK08267 | 260 | PRK08267, PRK08267, short chain dehydrogenase; Pro | 1e-13 | |
| PRK05867 | 253 | PRK05867, PRK05867, short chain dehydrogenase; Pro | 2e-13 | |
| PRK08265 | 261 | PRK08265, PRK08265, short chain dehydrogenase; Pro | 2e-13 | |
| cd08936 | 256 | cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re | 2e-13 | |
| cd05368 | 241 | cd05368, DHRS6_like_SDR_c, human DHRS6-like, class | 3e-13 | |
| cd05326 | 249 | cd05326, secoisolariciresinol-DH_like_SDR_c, secoi | 3e-13 | |
| PRK06550 | 235 | PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) | 3e-13 | |
| PRK08263 | 275 | PRK08263, PRK08263, short chain dehydrogenase; Pro | 3e-13 | |
| cd08932 | 223 | cd08932, HetN_like_SDR_c, HetN oxidoreductase-like | 4e-13 | |
| PRK08936 | 261 | PRK08936, PRK08936, glucose-1-dehydrogenase; Provi | 5e-13 | |
| PRK07035 | 252 | PRK07035, PRK07035, short chain dehydrogenase; Pro | 8e-13 | |
| cd05355 | 270 | cd05355, SDR_c1, classical (c) SDR, subgroup 1 | 9e-13 | |
| cd08940 | 258 | cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge | 1e-12 | |
| PRK12936 | 245 | PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote | 2e-12 | |
| COG0300 | 265 | COG0300, DltE, Short-chain dehydrogenases of vario | 2e-12 | |
| PRK06701 | 290 | PRK06701, PRK06701, short chain dehydrogenase; Pro | 2e-12 | |
| cd05323 | 244 | cd05323, ADH_SDR_c_like, insect type alcohol dehyd | 2e-12 | |
| PRK06841 | 255 | PRK06841, PRK06841, short chain dehydrogenase; Pro | 2e-12 | |
| PRK07774 | 250 | PRK07774, PRK07774, short chain dehydrogenase; Pro | 2e-12 | |
| cd08939 | 239 | cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine | 3e-12 | |
| cd05325 | 233 | cd05325, carb_red_sniffer_like_SDR_c, carbonyl red | 3e-12 | |
| cd09805 | 281 | cd09805, type2_17beta_HSD-like_SDR_c, human 17beta | 3e-12 | |
| cd05344 | 253 | cd05344, BKR_like_SDR_like, putative beta-ketoacyl | 3e-12 | |
| cd08931 | 227 | cd08931, SDR_c9, classical (c) SDR, subgroup 9 | 3e-12 | |
| cd05330 | 257 | cd05330, cyclohexanol_reductase_SDR_c, cyclohexano | 3e-12 | |
| PRK06949 | 258 | PRK06949, PRK06949, short chain dehydrogenase; Pro | 5e-12 | |
| cd05369 | 249 | cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta | 5e-12 | |
| PRK07576 | 264 | PRK07576, PRK07576, short chain dehydrogenase; Pro | 7e-12 | |
| cd05346 | 249 | cd05346, SDR_c5, classical (c) SDR, subgroup 5 | 8e-12 | |
| PRK08213 | 259 | PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro | 8e-12 | |
| cd05331 | 244 | cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz | 8e-12 | |
| cd08942 | 250 | cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy | 9e-12 | |
| PRK07478 | 254 | PRK07478, PRK07478, short chain dehydrogenase; Pro | 9e-12 | |
| cd08934 | 243 | cd08934, CAD_SDR_c, clavulanic acid dehydrogenase | 1e-11 | |
| PRK13394 | 262 | PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas | 1e-11 | |
| PRK12823 | 260 | PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 | 1e-11 | |
| PRK08017 | 256 | PRK08017, PRK08017, oxidoreductase; Provisional | 1e-11 | |
| cd08943 | 250 | cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al | 2e-11 | |
| cd05366 | 257 | cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol | 2e-11 | |
| TIGR01831 | 239 | TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-prote | 2e-11 | |
| PRK06124 | 256 | PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro | 2e-11 | |
| pfam00106 | 167 | pfam00106, adh_short, short chain dehydrogenase | 2e-11 | |
| PRK06181 | 263 | PRK06181, PRK06181, short chain dehydrogenase; Pro | 2e-11 | |
| PRK06114 | 254 | PRK06114, PRK06114, short chain dehydrogenase; Pro | 2e-11 | |
| PRK06935 | 258 | PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog | 2e-11 | |
| cd05340 | 236 | cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li | 2e-11 | |
| PRK06171 | 266 | PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro | 3e-11 | |
| PRK07666 | 239 | PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) | 4e-11 | |
| TIGR01832 | 248 | TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena | 4e-11 | |
| PRK07890 | 258 | PRK07890, PRK07890, short chain dehydrogenase; Pro | 6e-11 | |
| PRK07063 | 260 | PRK07063, PRK07063, short chain dehydrogenase; Pro | 6e-11 | |
| PRK07097 | 265 | PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro | 7e-11 | |
| COG4221 | 246 | COG4221, COG4221, Short-chain alcohol dehydrogenas | 9e-11 | |
| cd05359 | 242 | cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c | 9e-11 | |
| cd08937 | 256 | cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa | 1e-10 | |
| PRK06523 | 260 | PRK06523, PRK06523, short chain dehydrogenase; Pro | 2e-10 | |
| TIGR02415 | 254 | TIGR02415, 23BDH, acetoin reductases | 2e-10 | |
| cd05367 | 241 | cd05367, SPR-like_SDR_c, sepiapterin reductase (SP | 2e-10 | |
| cd05338 | 246 | cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena | 2e-10 | |
| PRK07814 | 263 | PRK07814, PRK07814, short chain dehydrogenase; Pro | 2e-10 | |
| cd05361 | 242 | cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de | 3e-10 | |
| PRK08277 | 278 | PRK08277, PRK08277, D-mannonate oxidoreductase; Pr | 4e-10 | |
| PRK06463 | 255 | PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) | 6e-10 | |
| PRK06198 | 260 | PRK06198, PRK06198, short chain dehydrogenase; Pro | 8e-10 | |
| cd08930 | 250 | cd08930, SDR_c8, classical (c) SDR, subgroup 8 | 1e-09 | |
| PRK06200 | 263 | PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny | 1e-09 | |
| PRK12935 | 247 | PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro | 1e-09 | |
| PRK07832 | 272 | PRK07832, PRK07832, short chain dehydrogenase; Pro | 2e-09 | |
| PRK07074 | 257 | PRK07074, PRK07074, short chain dehydrogenase; Pro | 2e-09 | |
| PRK08993 | 253 | PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog | 2e-09 | |
| cd05348 | 257 | cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro | 3e-09 | |
| cd05354 | 235 | cd05354, SDR_c7, classical (c) SDR, subgroup 7 | 3e-09 | |
| TIGR02632 | 676 | TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate | 3e-09 | |
| TIGR04316 | 250 | TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben | 3e-09 | |
| PRK08643 | 256 | PRK08643, PRK08643, acetoin reductase; Validated | 5e-09 | |
| TIGR01829 | 242 | TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta | 5e-09 | |
| PRK08220 | 252 | PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy | 6e-09 | |
| PRK07024 | 257 | PRK07024, PRK07024, short chain dehydrogenase; Pro | 6e-09 | |
| PRK09730 | 247 | PRK09730, PRK09730, putative NAD(P)-binding oxidor | 7e-09 | |
| cd09761 | 242 | cd09761, A3DFK9-like_SDR_c, Clostridium thermocell | 7e-09 | |
| cd05360 | 233 | cd05360, SDR_c3, classical (c) SDR, subgroup 3 | 7e-09 | |
| PRK06123 | 248 | PRK06123, PRK06123, short chain dehydrogenase; Pro | 9e-09 | |
| PRK12745 | 256 | PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote | 9e-09 | |
| cd05370 | 228 | cd05370, SDR_c2, classical (c) SDR, subgroup 2 | 1e-08 | |
| PRK06128 | 300 | PRK06128, PRK06128, oxidoreductase; Provisional | 1e-08 | |
| PRK09186 | 256 | PRK09186, PRK09186, flagellin modification protein | 1e-08 | |
| PRK06057 | 255 | PRK06057, PRK06057, short chain dehydrogenase; Pro | 2e-08 | |
| PRK08264 | 238 | PRK08264, PRK08264, short chain dehydrogenase; Val | 2e-08 | |
| cd05327 | 269 | cd05327, retinol-DH_like_SDR_c_like, retinol dehyd | 2e-08 | |
| PRK07985 | 294 | PRK07985, PRK07985, oxidoreductase; Provisional | 2e-08 | |
| cd05353 | 250 | cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- | 3e-08 | |
| cd05349 | 246 | cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl | 3e-08 | |
| PRK08063 | 250 | PRK08063, PRK08063, enoyl-(acyl carrier protein) r | 3e-08 | |
| PRK12481 | 251 | PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog | 3e-08 | |
| PRK07109 | 334 | PRK07109, PRK07109, short chain dehydrogenase; Pro | 3e-08 | |
| PLN02253 | 280 | PLN02253, PLN02253, xanthoxin dehydrogenase | 4e-08 | |
| PRK07102 | 243 | PRK07102, PRK07102, short chain dehydrogenase; Pro | 4e-08 | |
| PRK06179 | 270 | PRK06179, PRK06179, short chain dehydrogenase; Pro | 4e-08 | |
| PRK12747 | 252 | PRK12747, PRK12747, short chain dehydrogenase; Pro | 5e-08 | |
| pfam13561 | 239 | pfam13561, adh_short_C2, Enoyl-(Acyl carrier prote | 5e-08 | |
| TIGR03206 | 250 | TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy | 5e-08 | |
| PRK08251 | 248 | PRK08251, PRK08251, short chain dehydrogenase; Pro | 7e-08 | |
| PRK07577 | 234 | PRK07577, PRK07577, short chain dehydrogenase; Pro | 8e-08 | |
| PRK07041 | 230 | PRK07041, PRK07041, short chain dehydrogenase; Pro | 9e-08 | |
| cd09806 | 258 | cd09806, type1_17beta-HSD-like_SDR_c, human estrog | 9e-08 | |
| PRK08945 | 247 | PRK08945, PRK08945, putative oxoacyl-(acyl carrier | 9e-08 | |
| cd05371 | 252 | cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr | 1e-07 | |
| PRK05650 | 270 | PRK05650, PRK05650, short chain dehydrogenase; Pro | 1e-07 | |
| PRK07825 | 273 | PRK07825, PRK07825, short chain dehydrogenase; Pro | 2e-07 | |
| PRK06101 | 240 | PRK06101, PRK06101, short chain dehydrogenase; Pro | 2e-07 | |
| PRK09135 | 249 | PRK09135, PRK09135, pteridine reductase; Provision | 3e-07 | |
| PRK06914 | 280 | PRK06914, PRK06914, short chain dehydrogenase; Pro | 3e-07 | |
| cd09763 | 265 | cd09763, DHRS1-like_SDR_c, human dehydrogenase/red | 3e-07 | |
| cd05339 | 243 | cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy | 3e-07 | |
| PRK06180 | 277 | PRK06180, PRK06180, short chain dehydrogenase; Pro | 3e-07 | |
| PRK06947 | 248 | PRK06947, PRK06947, glucose-1-dehydrogenase; Provi | 3e-07 | |
| PRK09072 | 263 | PRK09072, PRK09072, short chain dehydrogenase; Pro | 4e-07 | |
| PRK08085 | 254 | PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro | 5e-07 | |
| cd05337 | 255 | cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl | 6e-07 | |
| PRK12746 | 254 | PRK12746, PRK12746, short chain dehydrogenase; Pro | 6e-07 | |
| PRK12937 | 245 | PRK12937, PRK12937, short chain dehydrogenase; Pro | 7e-07 | |
| cd05357 | 234 | cd05357, PR_SDR_c, pteridine reductase (PR), class | 7e-07 | |
| cd11731 | 198 | cd11731, Lin1944_like_SDR_c, Lin1944 and related p | 7e-07 | |
| cd02266 | 186 | cd02266, SDR, Short-chain dehydrogenases/reductase | 9e-07 | |
| PRK08219 | 227 | PRK08219, PRK08219, short chain dehydrogenase; Pro | 9e-07 | |
| cd05334 | 221 | cd05334, DHPR_SDR_c_like, dihydropteridine reducta | 1e-06 | |
| PRK07454 | 241 | PRK07454, PRK07454, short chain dehydrogenase; Pro | 1e-06 | |
| cd05328 | 250 | cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid de | 2e-06 | |
| PRK06482 | 276 | PRK06482, PRK06482, short chain dehydrogenase; Pro | 3e-06 | |
| PRK06483 | 236 | PRK06483, PRK06483, dihydromonapterin reductase; P | 3e-06 | |
| TIGR03325 | 262 | TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- | 3e-06 | |
| cd08945 | 258 | cd08945, PKR_SDR_c, Polyketide ketoreductase, clas | 4e-06 | |
| PRK09291 | 257 | PRK09291, PRK09291, short chain dehydrogenase; Pro | 5e-06 | |
| PRK12859 | 256 | PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-prote | 5e-06 | |
| PRK12938 | 246 | PRK12938, PRK12938, acetyacetyl-CoA reductase; Pro | 5e-06 | |
| PRK07370 | 258 | PRK07370, PRK07370, enoyl-(acyl carrier protein) r | 8e-06 | |
| PRK06182 | 273 | PRK06182, PRK06182, short chain dehydrogenase; Val | 9e-06 | |
| PRK05875 | 276 | PRK05875, PRK05875, short chain dehydrogenase; Pro | 9e-06 | |
| PRK05693 | 274 | PRK05693, PRK05693, short chain dehydrogenase; Pro | 1e-05 | |
| cd08929 | 226 | cd08929, SDR_c4, classical (c) SDR, subgroup 4 | 1e-05 | |
| PRK12748 | 256 | PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote | 1e-05 | |
| PRK05993 | 277 | PRK05993, PRK05993, short chain dehydrogenase; Pro | 2e-05 | |
| PRK08177 | 225 | PRK08177, PRK08177, short chain dehydrogenase; Pro | 2e-05 | |
| PRK07326 | 237 | PRK07326, PRK07326, short chain dehydrogenase; Pro | 2e-05 | |
| PRK07062 | 265 | PRK07062, PRK07062, short chain dehydrogenase; Pro | 3e-05 | |
| PRK07067 | 257 | PRK07067, PRK07067, sorbitol dehydrogenase; Provis | 4e-05 | |
| PRK08703 | 239 | PRK08703, PRK08703, short chain dehydrogenase; Pro | 4e-05 | |
| PRK08339 | 263 | PRK08339, PRK08339, short chain dehydrogenase; Pro | 4e-05 | |
| cd05343 | 250 | cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c | 5e-05 | |
| cd05363 | 254 | cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), | 6e-05 | |
| COG3967 | 245 | COG3967, DltE, Short-chain dehydrogenase involved | 8e-05 | |
| PRK05717 | 255 | PRK05717, PRK05717, oxidoreductase; Validated | 1e-04 | |
| PRK05866 | 293 | PRK05866, PRK05866, short chain dehydrogenase; Pro | 2e-04 | |
| PRK08415 | 274 | PRK08415, PRK08415, enoyl-(acyl carrier protein) r | 3e-04 | |
| COG0623 | 259 | COG0623, FabI, Enoyl-[acyl-carrier-protein] | 3e-04 | |
| PRK05876 | 275 | PRK05876, PRK05876, short chain dehydrogenase; Pro | 4e-04 | |
| PRK08217 | 253 | PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) | 5e-04 | |
| PRK08594 | 257 | PRK08594, PRK08594, enoyl-(acyl carrier protein) r | 6e-04 | |
| PRK08642 | 253 | PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) | 6e-04 | |
| cd11730 | 206 | cd11730, Tthb094_like_SDR_c, Tthb094 and related p | 7e-04 | |
| PRK07201 | 657 | PRK07201, PRK07201, short chain dehydrogenase; Pro | 7e-04 | |
| cd05322 | 257 | cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy | 7e-04 | |
| PRK05786 | 238 | PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) | 8e-04 | |
| PRK12384 | 259 | PRK12384, PRK12384, sorbitol-6-phosphate dehydroge | 0.001 | |
| PRK08261 | 450 | PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) | 0.001 | |
| PRK06194 | 287 | PRK06194, PRK06194, hypothetical protein; Provisio | 0.001 | |
| PRK08416 | 260 | PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydro | 0.001 | |
| PRK05872 | 296 | PRK05872, PRK05872, short chain dehydrogenase; Pro | 0.002 | |
| PRK12428 | 241 | PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydro | 0.002 | |
| PRK06924 | 251 | PRK06924, PRK06924, short chain dehydrogenase; Pro | 0.002 | |
| PRK12742 | 237 | PRK12742, PRK12742, oxidoreductase; Provisional | 0.003 | |
| cd05372 | 250 | cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) | 0.003 | |
| PRK08278 | 273 | PRK08278, PRK08278, short chain dehydrogenase; Pro | 0.003 | |
| TIGR01500 | 256 | TIGR01500, sepiapter_red, sepiapterin reductase | 0.003 |
| >gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs | Back alignment and domain information |
|---|
Score = 161 bits (408), Expect = 3e-51
Identities = 71/103 (68%), Positives = 88/103 (85%), Gaps = 7/103 (6%)
Query: 2 EDFSTIMTTNFESAYHLSQLAHPLLKASGNGNIVFISSVAGVIALPMCSIYASSKGAMNE 61
ED+S IM+TNFE+AYHLS+LAHPLLKASGNGNIVFISSVAGVIA+P + Y ++KGA+N+
Sbjct: 106 EDYSLIMSTNFEAAYHLSRLAHPLLKASGNGNIVFISSVAGVIAVPSGAPYGATKGALNQ 165
Query: 62 LTKNLACEWAKDKIRVNSVAPWMIRTPLV-------DNLKKIL 97
LT++LACEWAKD IRVN+VAPW+I TPLV +NL K++
Sbjct: 166 LTRSLACEWAKDNIRVNAVAPWVIATPLVEPVIQQKENLDKVI 208
|
This subgroup includes TR-I and TR-II; these proteins are members of the SDR family. TRs catalyze the NADPH-dependent reductions of the 3-carbonyl group of tropinone, to a beta-hydroxyl group. TR-I and TR-II produce different stereoisomers from tropinone, TR-I produces tropine (3alpha-hydroxytropane), and TR-II, produces pseudotropine (sigma-tropine, 3beta-hydroxytropane). SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 251 |
| >gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 | Back alignment and domain information |
|---|
| >gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 | Back alignment and domain information |
|---|
| >gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family | Back alignment and domain information |
|---|
| >gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 | Back alignment and domain information |
|---|
| >gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235816 PRK06500, PRK06500, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 | Back alignment and domain information |
|---|
| >gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR | Back alignment and domain information |
|---|
| >gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 | Back alignment and domain information |
|---|
| >gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 | Back alignment and domain information |
|---|
| >gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181198 PRK08017, PRK08017, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases | Back alignment and domain information |
|---|
| >gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 | Back alignment and domain information |
|---|
| >gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 | Back alignment and domain information |
|---|
| >gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 | Back alignment and domain information |
|---|
| >gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 | Back alignment and domain information |
|---|
| >gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|180838 PRK07102, PRK07102, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222222 pfam13561, adh_short_C2, Enoyl-(Acyl carrier protein) reductase | Back alignment and domain information |
|---|
| >gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235914 PRK07041, PRK07041, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180399 PRK06101, PRK06101, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|212497 cd11731, Lin1944_like_SDR_c, Lin1944 and related proteins, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) | Back alignment and domain information |
|---|
| >gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187589 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid dehydrogenase (3alpha_HSD), classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180586 PRK06483, PRK06483, dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|171822 PRK12938, PRK12938, acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180949 PRK07370, PRK07370, enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 | Back alignment and domain information |
|---|
| >gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180343 PRK05993, PRK05993, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236173 PRK08177, PRK08177, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|169389 PRK08339, PRK08339, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR | Back alignment and domain information |
|---|
| >gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181416 PRK08415, PRK08415, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223696 COG0623, FabI, Enoyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236308 PRK08594, PRK08594, enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212496 cd11730, Tthb094_like_SDR_c, Tthb094 and related proteins, classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs | Back alignment and domain information |
|---|
| >gnl|CDD|235608 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237099 PRK12428, PRK12428, 3-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|187630 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) reductase (ENR), divergent SDR | Back alignment and domain information |
|---|
| >gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233441 TIGR01500, sepiapter_red, sepiapterin reductase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| KOG1200 | 256 | consensus Mitochondrial/plastidial beta-ketoacyl-A | 99.93 | |
| COG4221 | 246 | Short-chain alcohol dehydrogenase of unknown speci | 99.92 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 99.91 | |
| COG0300 | 265 | DltE Short-chain dehydrogenases of various substra | 99.9 | |
| KOG1205 | 282 | consensus Predicted dehydrogenase [Secondary metab | 99.9 | |
| PRK06997 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.89 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.89 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.89 | |
| PF13561 | 241 | adh_short_C2: Enoyl-(Acyl carrier protein) reducta | 99.89 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.89 | |
| PRK08690 | 261 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.89 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 99.89 | |
| KOG1610 | 322 | consensus Corticosteroid 11-beta-dehydrogenase and | 99.88 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 99.88 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.88 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.88 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 99.88 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 99.88 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.87 | |
| PRK06300 | 299 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.87 | |
| PLN02780 | 320 | ketoreductase/ oxidoreductase | 99.87 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 99.87 | |
| PRK12747 | 252 | short chain dehydrogenase; Provisional | 99.87 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 99.87 | |
| TIGR01500 | 256 | sepiapter_red sepiapterin reductase. This model de | 99.86 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 99.86 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.86 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 99.86 | |
| PRK08159 | 272 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.86 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 99.86 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 99.86 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 99.85 | |
| PRK07889 | 256 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.85 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 99.85 | |
| PRK12859 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.85 | |
| PRK05599 | 246 | hypothetical protein; Provisional | 99.85 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 99.85 | |
| PRK07791 | 286 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK05884 | 223 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 99.84 | |
| PRK08340 | 259 | glucose-1-dehydrogenase; Provisional | 99.84 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 99.84 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.84 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 99.84 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 99.84 | |
| KOG0725 | 270 | consensus Reductases with broad range of substrate | 99.84 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 99.83 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 99.83 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 99.83 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 99.83 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 99.83 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 99.83 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 99.83 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 99.83 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 99.83 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 99.83 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 99.82 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 99.82 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 99.82 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 99.82 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 99.82 | |
| KOG1611 | 249 | consensus Predicted short chain-type dehydrogenase | 99.82 | |
| PRK06940 | 275 | short chain dehydrogenase; Provisional | 99.82 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 99.82 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 99.82 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 99.82 | |
| TIGR01831 | 239 | fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas | 99.81 | |
| KOG1204 | 253 | consensus Predicted dehydrogenase [Secondary metab | 99.81 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 99.81 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.81 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 99.81 | |
| PRK07578 | 199 | short chain dehydrogenase; Provisional | 99.81 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 99.81 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.81 | |
| PRK12428 | 241 | 3-alpha-hydroxysteroid dehydrogenase; Provisional | 99.81 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 99.81 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 99.81 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 99.81 | |
| PRK07904 | 253 | short chain dehydrogenase; Provisional | 99.81 | |
| PRK08643 | 256 | acetoin reductase; Validated | 99.8 | |
| KOG1207 | 245 | consensus Diacetyl reductase/L-xylulose reductase | 99.8 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 99.8 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 99.8 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 99.8 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 99.8 | |
| PRK06484 | 520 | short chain dehydrogenase; Validated | 99.8 | |
| PRK07024 | 257 | short chain dehydrogenase; Provisional | 99.8 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 99.8 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 99.8 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 99.79 | |
| KOG4169 | 261 | consensus 15-hydroxyprostaglandin dehydrogenase an | 99.79 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 99.79 | |
| PRK05650 | 270 | short chain dehydrogenase; Provisional | 99.79 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 99.79 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 99.79 | |
| PRK12938 | 246 | acetyacetyl-CoA reductase; Provisional | 99.79 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 99.79 | |
| TIGR02685 | 267 | pter_reduc_Leis pteridine reductase. Pteridine red | 99.79 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 99.79 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 99.79 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 99.78 | |
| PLN00015 | 308 | protochlorophyllide reductase | 99.78 | |
| PRK12824 | 245 | acetoacetyl-CoA reductase; Provisional | 99.78 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 99.78 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 99.78 | |
| PRK08263 | 275 | short chain dehydrogenase; Provisional | 99.78 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 99.78 | |
| COG1028 | 251 | FabG Dehydrogenases with different specificities ( | 99.77 | |
| PRK12748 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.77 | |
| PRK09009 | 235 | C factor cell-cell signaling protein; Provisional | 99.77 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 99.77 | |
| PRK07832 | 272 | short chain dehydrogenase; Provisional | 99.77 | |
| PRK08063 | 250 | enoyl-(acyl carrier protein) reductase; Provisiona | 99.77 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 99.77 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 99.77 | |
| PRK07069 | 251 | short chain dehydrogenase; Validated | 99.76 | |
| TIGR02415 | 254 | 23BDH acetoin reductases. One member of this famil | 99.76 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 99.76 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 99.76 | |
| COG3967 | 245 | DltE Short-chain dehydrogenase involved in D-alani | 99.76 | |
| PRK06101 | 240 | short chain dehydrogenase; Provisional | 99.76 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 99.76 | |
| PRK07102 | 243 | short chain dehydrogenase; Provisional | 99.76 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 99.76 | |
| PRK12935 | 247 | acetoacetyl-CoA reductase; Provisional | 99.76 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.75 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 99.75 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 99.75 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 99.75 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 99.75 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 99.75 | |
| PRK10538 | 248 | malonic semialdehyde reductase; Provisional | 99.75 | |
| PRK07023 | 243 | short chain dehydrogenase; Provisional | 99.75 | |
| PRK07454 | 241 | short chain dehydrogenase; Provisional | 99.75 | |
| PRK06924 | 251 | short chain dehydrogenase; Provisional | 99.74 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 99.74 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.74 | |
| PRK05717 | 255 | oxidoreductase; Validated | 99.74 | |
| TIGR01289 | 314 | LPOR light-dependent protochlorophyllide reductase | 99.74 | |
| PRK06482 | 276 | short chain dehydrogenase; Provisional | 99.74 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 99.74 | |
| KOG1209 | 289 | consensus 1-Acyl dihydroxyacetone phosphate reduct | 99.74 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 99.73 | |
| PRK06947 | 248 | glucose-1-dehydrogenase; Provisional | 99.73 | |
| PRK06123 | 248 | short chain dehydrogenase; Provisional | 99.73 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 99.73 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 99.73 | |
| PRK12744 | 257 | short chain dehydrogenase; Provisional | 99.73 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 99.73 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.73 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 99.73 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.73 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 99.73 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 99.73 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 99.73 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 99.73 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 99.73 | |
| TIGR01829 | 242 | AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy | 99.72 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 99.72 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 99.72 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 99.72 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 99.72 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 99.72 | |
| PRK08251 | 248 | short chain dehydrogenase; Provisional | 99.71 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 99.71 | |
| PRK07775 | 274 | short chain dehydrogenase; Provisional | 99.71 | |
| PRK12745 | 256 | 3-ketoacyl-(acyl-carrier-protein) reductase; Provi | 99.71 | |
| PRK08177 | 225 | short chain dehydrogenase; Provisional | 99.71 | |
| PRK12746 | 254 | short chain dehydrogenase; Provisional | 99.7 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 99.7 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 99.7 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.7 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 99.7 | |
| KOG1199 | 260 | consensus Short-chain alcohol dehydrogenase/3-hydr | 99.7 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 99.7 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.7 | |
| KOG1014 | 312 | consensus 17 beta-hydroxysteroid dehydrogenase typ | 99.7 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 99.7 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 99.69 | |
| PRK09134 | 258 | short chain dehydrogenase; Provisional | 99.68 | |
| PRK08017 | 256 | oxidoreductase; Provisional | 99.68 | |
| PRK06181 | 263 | short chain dehydrogenase; Provisional | 99.68 | |
| PRK07453 | 322 | protochlorophyllide oxidoreductase; Validated | 99.68 | |
| KOG1210 | 331 | consensus Predicted 3-ketosphinganine reductase [S | 99.67 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 99.67 | |
| PRK06077 | 252 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.67 | |
| PRK07074 | 257 | short chain dehydrogenase; Provisional | 99.66 | |
| TIGR02632 | 676 | RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc | 99.65 | |
| PRK09730 | 247 | putative NAD(P)-binding oxidoreductase; Provisiona | 99.64 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.64 | |
| PRK07041 | 230 | short chain dehydrogenase; Provisional | 99.64 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 99.64 | |
| PRK12825 | 249 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.63 | |
| TIGR01830 | 239 | 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re | 99.63 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 99.62 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 99.62 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 99.62 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 99.61 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.61 | |
| PRK06953 | 222 | short chain dehydrogenase; Provisional | 99.6 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 99.6 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 99.58 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 99.57 | |
| KOG1208 | 314 | consensus Dehydrogenases with different specificit | 99.56 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 99.51 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 99.51 | |
| PF00106 | 167 | adh_short: short chain dehydrogenase alcohol dehyd | 99.5 | |
| PRK08219 | 227 | short chain dehydrogenase; Provisional | 99.49 | |
| COG0623 | 259 | FabI Enoyl-[acyl-carrier-protein] | 99.28 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 99.26 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 99.23 | |
| smart00822 | 180 | PKS_KR This enzymatic domain is part of bacterial | 99.07 | |
| KOG1478 | 341 | consensus 3-keto sterol reductase [Lipid transport | 99.03 | |
| PF08643 | 299 | DUF1776: Fungal family of unknown function (DUF177 | 99.01 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 98.97 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 98.66 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 98.66 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 98.44 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 98.44 | |
| PRK10217 | 355 | dTDP-glucose 4,6-dehydratase; Provisional | 98.35 | |
| COG1088 | 340 | RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope | 98.34 | |
| PRK08261 | 450 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 98.29 | |
| PRK13656 | 398 | trans-2-enoyl-CoA reductase; Provisional | 98.28 | |
| PLN00198 | 338 | anthocyanidin reductase; Provisional | 98.26 | |
| PLN02650 | 351 | dihydroflavonol-4-reductase | 98.21 | |
| KOG4022 | 236 | consensus Dihydropteridine reductase DHPR/QDPR [Am | 98.19 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 98.09 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 98.08 | |
| PLN02572 | 442 | UDP-sulfoquinovose synthase | 98.05 | |
| TIGR01181 | 317 | dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This | 98.04 | |
| PRK10084 | 352 | dTDP-glucose 4,6 dehydratase; Provisional | 98.04 | |
| PF08659 | 181 | KR: KR domain; InterPro: IPR013968 This domain is | 97.95 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 97.93 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 97.84 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 97.82 | |
| TIGR01746 | 367 | Thioester-redct thioester reductase domain. It has | 97.74 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 97.7 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 97.66 | |
| TIGR01472 | 343 | gmd GDP-mannose 4,6-dehydratase. Excluded from thi | 97.65 | |
| PLN02240 | 352 | UDP-glucose 4-epimerase | 97.64 | |
| PRK10675 | 338 | UDP-galactose-4-epimerase; Provisional | 97.61 | |
| TIGR01179 | 328 | galE UDP-glucose-4-epimerase. This enzyme intercon | 97.53 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 97.46 | |
| PF01370 | 236 | Epimerase: NAD dependent epimerase/dehydratase fam | 97.45 | |
| TIGR02197 | 314 | heptose_epim ADP-L-glycero-D-manno-heptose-6-epime | 97.42 | |
| PF02719 | 293 | Polysacc_synt_2: Polysaccharide biosynthesis prote | 97.4 | |
| PF01073 | 280 | 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso | 97.39 | |
| PRK11150 | 308 | rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro | 97.36 | |
| PLN02686 | 367 | cinnamoyl-CoA reductase | 97.33 | |
| PLN02725 | 306 | GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas | 97.27 | |
| COG0451 | 314 | WcaG Nucleoside-diphosphate-sugar epimerases [Cell | 97.24 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 97.18 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 97.16 | |
| PLN02166 | 436 | dTDP-glucose 4,6-dehydratase | 96.99 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 96.95 | |
| PF07993 | 249 | NAD_binding_4: Male sterility protein; InterPro: I | 96.95 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 96.95 | |
| KOG0747 | 331 | consensus Putative NAD+-dependent epimerases [Carb | 96.88 | |
| COG1087 | 329 | GalE UDP-glucose 4-epimerase [Cell envelope biogen | 96.84 | |
| PRK11908 | 347 | NAD-dependent epimerase/dehydratase family protein | 96.81 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 96.8 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 96.78 | |
| PRK08125 | 660 | bifunctional UDP-glucuronic acid decarboxylase/UDP | 96.75 | |
| PLN02996 | 491 | fatty acyl-CoA reductase | 95.83 | |
| PRK07201 | 657 | short chain dehydrogenase; Provisional | 95.79 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 95.72 | |
| PRK09987 | 299 | dTDP-4-dehydrorhamnose reductase; Provisional | 95.66 | |
| COG3320 | 382 | Putative dehydrogenase domain of multifunctional n | 95.05 | |
| TIGR03443 | 1389 | alpha_am_amid L-aminoadipate-semialdehyde dehydrog | 94.94 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 93.99 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 91.9 | |
| PLN02260 | 668 | probable rhamnose biosynthetic enzyme | 91.52 | |
| PF04321 | 286 | RmlD_sub_bind: RmlD substrate binding domain; Inte | 91.34 | |
| KOG1430 | 361 | consensus C-3 sterol dehydrogenase/3-beta-hydroxys | 90.85 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 90.48 | |
| COG1091 | 281 | RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo | 90.08 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 88.92 | |
| TIGR02813 | 2582 | omega_3_PfaA polyketide-type polyunsaturated fatty | 88.88 | |
| KOG1371 | 343 | consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo | 87.99 | |
| PRK05865 | 854 | hypothetical protein; Provisional | 87.83 | |
| COG1089 | 345 | Gmd GDP-D-mannose dehydratase [Cell envelope bioge | 87.65 | |
| PLN02503 | 605 | fatty acyl-CoA reductase 2 | 85.2 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 84.48 |
| >KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.93 E-value=2e-26 Score=139.58 Aligned_cols=101 Identities=29% Similarity=0.374 Sum_probs=91.5
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHcC--CCceEEEEcCccccccCCCchhhhhHHHHHHHHHHHHHhHhcCCCcEEEE
Q 034041 2 EDFSTIMTTNFESAYHLSQLAHPLLKAS--GNGNIVFISSVAGVIALPMCSIYASSKGAMNELTKNLACEWAKDKIRVNS 79 (105)
Q Consensus 2 ~~~~~~~~~n~~~~~~l~~~~~~~~~~~--~~~~iv~~ss~~~~~~~~~~~~y~~sK~~~~~l~~~la~e~~~~gi~v~~ 79 (105)
++|+..+.+|+.|.|+++|++...|... .+.+|||+||+.+..+.-+...|+++|+++.+|+|+.++|+++++||||.
T Consensus 112 ~qwd~vi~vNL~gvfl~tqaa~r~~~~~~~~~~sIiNvsSIVGkiGN~GQtnYAAsK~GvIgftktaArEla~knIrvN~ 191 (256)
T KOG1200|consen 112 EQWDSVIAVNLTGVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKIGNFGQTNYAASKGGVIGFTKTAARELARKNIRVNV 191 (256)
T ss_pred HHHHHHHHhhchhhHHHHHHHHHHHHHhcCCCceEEeehhhhcccccccchhhhhhcCceeeeeHHHHHHHhhcCceEeE
Confidence 6899999999999999999999995543 34699999999999999999999999999999999999999999999999
Q ss_pred eecCceeCcchhhHHHH-HHHHhh
Q 034041 80 VAPWMIRTPLVDNLKKI-LRSWNK 102 (105)
Q Consensus 80 v~pG~~~t~~~~~~~~~-~~~~~~ 102 (105)
|+||++.|||+..++++ .+++..
T Consensus 192 VlPGFI~tpMT~~mp~~v~~ki~~ 215 (256)
T KOG1200|consen 192 VLPGFIATPMTEAMPPKVLDKILG 215 (256)
T ss_pred eccccccChhhhhcCHHHHHHHHc
Confidence 99999999999999775 344443
|
|
| >COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06997 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08690 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06300 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02780 ketoreductase/ oxidoreductase | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12747 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01500 sepiapter_red sepiapterin reductase | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08159 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07889 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05599 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07791 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05884 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK08340 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06940 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative | Back alignment and domain information |
|---|
| >KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07578 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07904 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06484 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07024 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05650 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12938 acetyacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02685 pter_reduc_Leis pteridine reductase | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00015 protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK12824 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08263 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09009 C factor cell-cell signaling protein; Provisional | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07832 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08063 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07069 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02415 23BDH acetoin reductases | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK06101 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07102 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12935 acetoacetyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >PRK10538 malonic semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07023 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07454 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06924 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >TIGR01289 LPOR light-dependent protochlorophyllide reductase | Back alignment and domain information |
|---|
| >PRK06482 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06947 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06123 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK12744 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK08251 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07775 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08177 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12746 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09134 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08017 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06181 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07453 protochlorophyllide oxidoreductase; Validated | Back alignment and domain information |
|---|
| >KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07074 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK09730 putative NAD(P)-binding oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK07041 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK06953 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases | Back alignment and domain information |
|---|
| >PRK08219 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0623 FabI Enoyl-[acyl-carrier-protein] | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK10217 dTDP-glucose 4,6-dehydratase; Provisional | Back alignment and domain information |
|---|
| >COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13656 trans-2-enoyl-CoA reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00198 anthocyanidin reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02650 dihydroflavonol-4-reductase | Back alignment and domain information |
|---|
| >KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02572 UDP-sulfoquinovose synthase | Back alignment and domain information |
|---|
| >TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK10084 dTDP-glucose 4,6 dehydratase; Provisional | Back alignment and domain information |
|---|
| >PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01746 Thioester-redct thioester reductase domain | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR01472 gmd GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02240 UDP-glucose 4-epimerase | Back alignment and domain information |
|---|
| >PRK10675 UDP-galactose-4-epimerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01179 galE UDP-glucose-4-epimerase | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor | Back alignment and domain information |
|---|
| >TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase | Back alignment and domain information |
|---|
| >PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases | Back alignment and domain information |
|---|
| >PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones | Back alignment and domain information |
|---|
| >PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional | Back alignment and domain information |
|---|
| >PLN02686 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase | Back alignment and domain information |
|---|
| >COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PLN02166 dTDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02996 fatty acyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK07201 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional | Back alignment and domain information |
|---|
| >COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >PLN02260 probable rhamnose biosynthetic enzyme | Back alignment and domain information |
|---|
| >PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 | Back alignment and domain information |
|---|
| >KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA | Back alignment and domain information |
|---|
| >KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] | Back alignment and domain information |
|---|
| >PRK05865 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PLN02503 fatty acyl-CoA reductase 2 | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 105 | ||||
| 1ae1_A | 273 | Tropinone Reductase-I Complex With Nadp Length = 27 | 5e-33 | ||
| 1xq1_A | 266 | X-Ray Structure Of Putative Tropinone Reducatse Fro | 5e-32 | ||
| 1ipe_A | 259 | Tropinone Reductase-Ii Complexed With Nadph Length | 5e-29 | ||
| 2ae2_A | 260 | Tropinone Reductase-Ii Complexed With Nadp+ And Pse | 5e-29 | ||
| 4b79_A | 242 | The Aeropath Project And Pseudomonas Aeruginosa Hig | 8e-14 | ||
| 2cfc_A | 250 | Structural Basis For Stereo Selectivity In The (R)- | 1e-12 | ||
| 3gaf_A | 256 | 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid De | 9e-12 | ||
| 2hsd_A | 253 | The Refined Three-Dimensional Structure Of 3alpha,2 | 2e-11 | ||
| 1hdc_A | 254 | Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste | 2e-11 | ||
| 1vl8_A | 267 | Crystal Structure Of Gluconate 5-dehydrogenase (tm0 | 6e-11 | ||
| 3v2h_A | 281 | The Crystal Structure Of D-Beta-Hydroxybutyrate Deh | 9e-11 | ||
| 3r1i_A | 276 | Crystal Structure Of A Short-Chain Type Dehydrogena | 2e-10 | ||
| 1yde_A | 270 | Crystal Structure Of Human Retinal Short-Chain Dehy | 4e-10 | ||
| 3rku_A | 287 | Substrate Fingerprint And The Structure Of Nadp+ De | 4e-10 | ||
| 3emk_A | 246 | 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN | 6e-10 | ||
| 3enn_A | 249 | 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGEN | 6e-10 | ||
| 2d1y_A | 256 | Crystal Structure Of Tt0321 From Thermus Thermophil | 7e-10 | ||
| 2ph3_A | 245 | Crystal Structure Of 3-oxoacyl-[acyl Carrier Protei | 7e-10 | ||
| 2hq1_A | 247 | Crystal Structure Of Orf 1438 A Putative GlucoseRIB | 8e-10 | ||
| 1cyd_A | 244 | Carbonyl Reductase Complexed With Nadph And 2-Propa | 1e-09 | ||
| 3pgx_A | 280 | Crystal Structure Of A Putative Carveol Dehydrogena | 1e-09 | ||
| 1iy8_A | 267 | Crystal Structure Of Levodione Reductase Length = 2 | 2e-09 | ||
| 3tzq_B | 271 | Crystal Structure Of A Short-Chain Type Dehydrogena | 3e-09 | ||
| 1nff_A | 260 | Crystal Structure Of Rv2002 Gene Product From Mycob | 4e-09 | ||
| 1wmb_A | 260 | Crystal Structure Of Nad Dependent D-3-Hydroxybutyl | 4e-09 | ||
| 3tsc_A | 277 | Crystal Structure Of Short Chain Dehydrogenase Map_ | 5e-09 | ||
| 2bd0_A | 244 | Chlorobium Tepidum Sepiapterin Reductase Complexed | 6e-09 | ||
| 4iiu_A | 267 | Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car | 6e-09 | ||
| 3oec_A | 317 | Crystal Structure Of Carveol Dehydrogenase From Myc | 1e-08 | ||
| 4dqx_A | 277 | Crystal Structure Of A Short Chain Dehydrogenase Fr | 1e-08 | ||
| 1rwb_A | 261 | Cooperative Effect Of Two Surface Amino Acid Mutati | 1e-08 | ||
| 3cxr_A | 291 | Crystal Structure Of Gluconate 5-Dehydrogase From S | 1e-08 | ||
| 1nfr_A | 260 | Rv2002 Gene Product From Mycobacterium Tuberculosis | 1e-08 | ||
| 1zjy_A | 251 | Structure Of R-Specific Alcohol Dehydrogenase (Muta | 2e-08 | ||
| 1nxq_A | 251 | Crystal Structure Of R-Alcohol Dehydrogenase (Radh) | 2e-08 | ||
| 2wdz_A | 254 | Crystal Structure Of The Short Chain Dehydrogenase | 2e-08 | ||
| 4eso_A | 255 | Crystal Structure Of A Putative Oxidoreductase Prot | 2e-08 | ||
| 3vc7_A | 254 | Crystal Structure Of A Putative Oxidoreductase From | 2e-08 | ||
| 3ay6_A | 269 | Crystal Structure Of Bacillus Megaterium Glucose De | 2e-08 | ||
| 2bgk_A | 278 | X-Ray Structure Of Apo-Secoisolariciresinol Dehydro | 2e-08 | ||
| 3ay7_A | 269 | Crystal Structure Of Bacillus Megaterium Glucose De | 2e-08 | ||
| 3aus_A | 269 | Crystal Structure Of Bacillus Megaterium Glucose De | 2e-08 | ||
| 3gvc_A | 277 | Crystal Structure Of Probable Short-Chain Dehydroge | 3e-08 | ||
| 2zat_A | 260 | Crystal Structure Of A Mammalian Reductase Length = | 3e-08 | ||
| 1zem_A | 262 | Crystal Structure Of Nad+-Bound Xylitol Dehydrogena | 3e-08 | ||
| 3un1_A | 260 | Crystal Structure Of An Oxidoreductase From Sinorhi | 3e-08 | ||
| 1gco_A | 261 | Crystal Structure Of Glucose Dehydrogenase Complexe | 4e-08 | ||
| 4iin_A | 271 | Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Car | 4e-08 | ||
| 1gee_A | 261 | Crystal Structure Of Glucose Dehydrogenase Mutant Q | 4e-08 | ||
| 1g6k_A | 261 | Crystal Structure Of Glucose Dehydrogenase Mutant E | 4e-08 | ||
| 1x1e_A | 239 | Crystal Structure Of Tt0495 Protein From Thermus Th | 4e-08 | ||
| 3f9i_A | 249 | Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote | 5e-08 | ||
| 3vtz_A | 269 | Structure Of Thermoplasma Volcanium Aldohexose Dehy | 5e-08 | ||
| 3ftp_A | 270 | Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote | 6e-08 | ||
| 3uve_A | 286 | Crystal Structure Of Carveol Dehydrogenase ((+)-Tra | 9e-08 | ||
| 2uvd_A | 246 | The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier | 9e-08 | ||
| 3sj7_A | 252 | Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) F | 1e-07 | ||
| 2yz7_A | 260 | X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase F | 1e-07 | ||
| 4ibo_A | 271 | Crystal Structure Of A Putative Gluconate Dehydroge | 1e-07 | ||
| 3o4r_A | 261 | Crystal Structure Of Human DehydrogenaseREDUCTASE ( | 1e-07 | ||
| 4g81_D | 255 | Crystal Structure Of A Hexonate Dehydrogenase Ortho | 1e-07 | ||
| 1xkq_A | 280 | Crystal Structure Of Short-Chain DehydrogenaseREDUC | 2e-07 | ||
| 2nm0_A | 253 | Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl | 2e-07 | ||
| 1spx_A | 278 | Crystal Structure Of Glucose Dehydrogenase Of Caeno | 2e-07 | ||
| 1ybv_A | 283 | Structure Of Trihydroxynaphthalene Reductase In Com | 3e-07 | ||
| 1doh_A | 283 | Structure Of Trihydroxynaphthalene Reductase In Com | 3e-07 | ||
| 3rsh_A | 251 | Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc | 3e-07 | ||
| 3u09_A | 251 | Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote | 3e-07 | ||
| 3tzk_A | 251 | Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote | 3e-07 | ||
| 2q2q_A | 255 | Structure Of D-3-Hydroxybutyrate Dehydrogenase From | 4e-07 | ||
| 3d3w_A | 244 | Structure Of L-Xylulose Reductase With Bound Coenzy | 4e-07 | ||
| 2zk7_A | 257 | Structure Of A C-Terminal Deletion Mutant Of Thermo | 4e-07 | ||
| 3grp_A | 266 | 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl- | 4e-07 | ||
| 2dtd_A | 264 | Structure Of Thermoplasma Acidophilum Aldohexose De | 4e-07 | ||
| 1pr9_A | 244 | Human L-Xylulose Reductase Holoenzyme Length = 244 | 4e-07 | ||
| 3tzh_A | 251 | Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote | 4e-07 | ||
| 2pd6_A | 264 | Structure Of Human Hydroxysteroid Dehydrogenase Typ | 5e-07 | ||
| 3osu_A | 246 | Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Pro | 5e-07 | ||
| 3uf0_A | 273 | Crystal Structure Of A Putative Nad(P) Dependent Gl | 7e-07 | ||
| 3ctm_A | 279 | Crystal Structure Of A Carbonyl Reductase From Cand | 8e-07 | ||
| 3sx2_A | 278 | Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Ca | 8e-07 | ||
| 1i01_A | 244 | Crystal Structure Of Beta-Ketoacyl [acyl Carrier Pr | 9e-07 | ||
| 3tzc_A | 251 | Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote | 1e-06 | ||
| 2a4k_A | 263 | 3-Oxoacyl-[acyl Carrier Protein] Reductase From The | 1e-06 | ||
| 1hxh_A | 253 | Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID D | 1e-06 | ||
| 2ntn_A | 267 | Crystal Structure Of Maba-c60v/g139a/s144l Length = | 1e-06 | ||
| 4dml_A | 269 | 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Syn | 1e-06 | ||
| 1uzm_A | 247 | Maba From Mycobacterium Tuberculosis Length = 247 | 1e-06 | ||
| 1xu7_A | 286 | Crystal Structure Of The Interface Open Conformatio | 1e-06 | ||
| 3pdj_A | 273 | Crystal Structure Of Human 11-Beta-Hydroxysteroid D | 1e-06 | ||
| 2rbe_A | 275 | The Discovery Of 2-Anilinothiazolones As 11beta-Hsd | 1e-06 | ||
| 2c07_A | 285 | Oxoacyl-Acp Reductase Of Plasmodium Falciparum Leng | 1e-06 | ||
| 3d5q_A | 272 | Crystal Structure Of 11b-Hsd1 In Complex With Triaz | 1e-06 | ||
| 2irw_A | 264 | Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W | 1e-06 | ||
| 4e4y_A | 244 | The Crystal Structure Of A Short Chain Dehydrogenas | 1e-06 | ||
| 2ilt_A | 275 | Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) W | 1e-06 | ||
| 2ag5_A | 246 | Crystal Structure Of Human Dhrs6 Length = 246 | 2e-06 | ||
| 2bel_A | 283 | Structure Of Human 11-Beta-Hydroxysteroid Dehydroge | 2e-06 | ||
| 3ch6_A | 286 | Crystal Structure Of 11beta-Hsd1 Double Mutant (L26 | 2e-06 | ||
| 1ahi_A | 255 | 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With | 2e-06 | ||
| 1uzl_A | 247 | Maba From Mycobacterium Tuberculosis Length = 247 | 2e-06 | ||
| 3tox_A | 280 | Crystal Structure Of A Short Chain Dehydrogenase In | 3e-06 | ||
| 3edm_A | 259 | Crystal Structure Of A Short Chain Dehydrogenase Fr | 3e-06 | ||
| 2et6_A | 604 | (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candid | 3e-06 | ||
| 3ai3_A | 263 | The Crystal Structure Of L-Sorbose Reductase From G | 3e-06 | ||
| 3ai1_A | 263 | The Crystal Structure Of L-Sorbose Reductase From G | 3e-06 | ||
| 4bb6_A | 292 | Free-Wilson And Structural Approaches To Co-Optimis | 3e-06 | ||
| 4bb5_A | 292 | Free-Wilson And Structural Approaches To Co-Optimis | 4e-06 | ||
| 3sju_A | 279 | Hedamycin Polyketide Ketoreductase Bound To Nadph L | 4e-06 | ||
| 4dbz_A | 281 | Crystal Structure Of V151l Actinorhodin Polyketide | 4e-06 | ||
| 4hfr_A | 272 | Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In | 4e-06 | ||
| 3pk0_A | 262 | Crystal Structure Of Short-Chain DehydrogenaseREDUC | 5e-06 | ||
| 2nwq_A | 272 | Short Chain Dehydrogenase From Pseudomonas Aerugino | 6e-06 | ||
| 3d3w_B | 245 | Structure Of L-Xylulose Reductase With Bound Coenzy | 7e-06 | ||
| 4iqg_C | 271 | Crystal Structure Of Bpro0239 Oxidoreductase From P | 7e-06 | ||
| 3e9n_A | 245 | Crystal Structure Of A Putative Short-Chain Dehydro | 7e-06 | ||
| 3csd_B | 281 | Actinorhodin Polyketide Ketoreductase Mutant P94l B | 9e-06 | ||
| 2rh4_A | 277 | Actinorhodin Ketoreductase, Actkr, With Nadph And I | 9e-06 | ||
| 2rhr_B | 277 | P94l Actinorhodin Ketordeuctase Mutant, With Nadph | 9e-06 | ||
| 4dc1_A | 281 | Crystal Structure Of Y202f Actinorhodin Polyketide | 9e-06 | ||
| 1x7g_A | 261 | Actinorhodin Polyketide Ketoreductase, Act Kr, With | 9e-06 | ||
| 1w4z_A | 281 | Structure Of Actinorhodin Polyketide (Actiii) Reduc | 1e-05 | ||
| 3ezl_A | 256 | Crystal Structure Of Acetyacetyl-Coa Reductase From | 1e-05 | ||
| 3gmd_A | 264 | Structure-Based Design Of 7-Azaindole-Pyrrolidines | 1e-05 | ||
| 4afn_A | 269 | Crystal Structure Of 3-ketoacyl-(acyl-carrier-prote | 1e-05 | ||
| 3m1a_A | 281 | The Crystal Structure Of A Short-Chain Dehydrogenas | 1e-05 | ||
| 1h5q_A | 265 | Mannitol Dehydrogenase From Agaricus Bisporus Lengt | 1e-05 | ||
| 4gkb_A | 258 | Crystal Structure Of A Short Chain Dehydrogenase Ho | 1e-05 | ||
| 3gk3_A | 269 | Crystal Structure Of Acetoacetyl-Coa Reductase From | 1e-05 | ||
| 4hp8_A | 247 | Crystal Structure Of A Putative 2-Deoxy-D-Gluconate | 2e-05 | ||
| 4fc6_A | 277 | Studies On Dcr Shed New Light On Peroxisomal Beta-O | 2e-05 | ||
| 3v8b_A | 283 | Crystal Structure Of A 3-Ketoacyl-Acp Reductase Fro | 2e-05 | ||
| 3t7c_A | 299 | Crystal Structure Of Carveol Dehydrogenase From Myc | 2e-05 | ||
| 1e3w_A | 261 | Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co | 2e-05 | ||
| 2ew8_A | 249 | Crystal Structure Of The (s)-specific 1-phenylethan | 2e-05 | ||
| 3kzv_A | 254 | The Crystal Structure Of A Cytoplasmic Protein With | 3e-05 | ||
| 3lz6_A | 263 | Guinea Pig 11beta Hydroxysteroid Dehydrogenase With | 3e-05 | ||
| 1xse_A | 295 | Crystal Structure Of Guinea Pig 11beta-Hydroxystero | 3e-05 | ||
| 3g49_A | 277 | N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b- | 3e-05 | ||
| 4dc0_A | 281 | Crystal Structure Of F189w Actinorhodin Polyketide | 3e-05 | ||
| 3dwf_A | 276 | Crystal Structure Of The Guinea Pig 11beta-Hydroxys | 3e-05 | ||
| 1y5m_A | 276 | The Crystal Structure Of Murine 11b-Hydroxysteroid | 3e-05 | ||
| 3op4_A | 248 | Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carr | 3e-05 | ||
| 3i1j_A | 247 | Structure Of A Putative Short Chain Dehydrogenase F | 3e-05 | ||
| 3rkr_A | 262 | Crystal Structure Of A Metagenomic Short-Chain Oxid | 3e-05 | ||
| 1e6w_A | 260 | Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co | 4e-05 | ||
| 3rih_A | 293 | Crystal Structure Of A Putative Short Chain Dehydro | 4e-05 | ||
| 1e3s_A | 261 | Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Co | 4e-05 | ||
| 3gdf_A | 267 | Crystal Structure Of The Nadp-Dependent Mannitol De | 4e-05 | ||
| 1u7t_A | 261 | Crystal Structure Of AbadHSD10 WITH A BOUND INHIBIT | 4e-05 | ||
| 3uxy_A | 266 | The Crystal Structure Of Short Chain Dehydrogenase | 6e-05 | ||
| 4fn4_A | 254 | Short-chain Nad(h)-dependent Dehydrogenase/reductas | 6e-05 | ||
| 3awd_A | 260 | Crystal Structure Of Gox2181 Length = 260 | 7e-05 | ||
| 3p19_A | 266 | Improved Nadph-Dependent Blue Fluorescent Protein L | 7e-05 | ||
| 3icc_A | 255 | Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Car | 7e-05 | ||
| 3uwr_A | 286 | Crystal Structure Of Carveol Dehydrogenase From Myc | 7e-05 | ||
| 4fgs_A | 273 | Crystal Structure Of A Probable Dehydrogenase Prote | 8e-05 | ||
| 1uay_A | 242 | Crystal Structure Of Type Ii 3-Hydroxyacyl-Coa Dehy | 8e-05 | ||
| 3oic_A | 258 | Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl | 9e-05 | ||
| 4e3z_A | 272 | Crystal Structure Of A Oxidoreductase From Rhizobiu | 1e-04 | ||
| 1ja9_A | 274 | Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalen | 1e-04 | ||
| 3ged_A | 247 | Fingerprint And Structural Analysis Of A Apo Scor E | 2e-04 | ||
| 3tl3_A | 257 | Structure Of A Short-Chain Type DehydrogenaseREDUCT | 2e-04 | ||
| 3g1t_A | 258 | Crystal Structure Of Short Chain Dehydrogenase From | 2e-04 | ||
| 3asu_A | 248 | Crystal Structure Of Serine Dehydrogenase From Esch | 2e-04 | ||
| 3oif_A | 266 | Crystal Structure Of Enoyl-Acp Reductases I (Fabi) | 3e-04 | ||
| 1geg_A | 256 | Cryatal Structure Analysis Of Meso-2,3-Butanediol D | 3e-04 | ||
| 3is3_A | 270 | Crystal Structure Of 17beta-Hydroxysteroid Dehydrog | 3e-04 | ||
| 1so8_A | 261 | Abeta-bound Human Abad Structure [also Known As 3-h | 3e-04 | ||
| 1uls_A | 245 | Crystal Structure Of Tt0140 From Thermus Thermophil | 3e-04 | ||
| 2o23_A | 265 | The Structure Of Wild-Type Human Hadh2 (17beta-Hydr | 3e-04 | ||
| 3svt_A | 281 | Structure Of A Short-Chain Type DehydrogenaseREDUCT | 3e-04 | ||
| 2pnf_A | 248 | Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- | 4e-04 | ||
| 3ak4_A | 263 | Crystal Structure Of Nadh-Dependent Quinuclidinone | 7e-04 | ||
| 1a27_A | 289 | Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C | 7e-04 | ||
| 3f5q_A | 262 | Crystal Structure Of Putative Short Chain Dehydroge | 7e-04 | ||
| 3f1l_A | 252 | The 0.95 A Structure Of An Oxidoreductase, Ycik Fro | 8e-04 | ||
| 3r3s_A | 294 | Structure Of The Ygha Oxidoreductase From Salmonell | 9e-04 |
| >pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp Length = 273 | Back alignment and structure |
|
| >pdb|1XQ1|A Chain A, X-Ray Structure Of Putative Tropinone Reducatse From Arabidopsis Thaliana Gene At1g07440 Length = 266 | Back alignment and structure |
| >pdb|1IPE|A Chain A, Tropinone Reductase-Ii Complexed With Nadph Length = 259 | Back alignment and structure |
| >pdb|2AE2|A Chain A, Tropinone Reductase-Ii Complexed With Nadp+ And Pseudotropine Length = 260 | Back alignment and structure |
| >pdb|4B79|A Chain A, The Aeropath Project And Pseudomonas Aeruginosa High-throughput Crystallographic Studies For Assessment Of Potential Targets In Early Stage Drug Discovery. Length = 242 | Back alignment and structure |
| >pdb|2CFC|A Chain A, Structural Basis For Stereo Selectivity In The (R)- And (S)- Hydroxypropylethane Thiosulfonate Dehydrogenases Length = 250 | Back alignment and structure |
| >pdb|3GAF|A Chain A, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid Dehydrogenase From Brucella Melitensis Length = 256 | Back alignment and structure |
| >pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 | Back alignment and structure |
| >pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 | Back alignment and structure |
| >pdb|3V2H|A Chain A, The Crystal Structure Of D-Beta-Hydroxybutyrate Dehydrogenase From Sinorhizobium Meliloti Length = 281 | Back alignment and structure |
| >pdb|3R1I|A Chain A, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 276 | Back alignment and structure |
| >pdb|1YDE|A Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 Length = 270 | Back alignment and structure |
| >pdb|3RKU|A Chain A, Substrate Fingerprint And The Structure Of Nadp+ Dependent Serine Dehydrogenase From Saccharomyces Cerevisiae Complexed With Nadp+ Length = 287 | Back alignment and structure |
| >pdb|3EMK|A Chain A, 2.5a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE From Brucella Melitensis Length = 246 | Back alignment and structure |
| >pdb|3ENN|A Chain A, 2.1a Crystal Structure Of GlucoseRIBITOL DEHYDROGENASE FROM BRUCELLA Melitensis (P43212) Length = 249 | Back alignment and structure |
| >pdb|2D1Y|A Chain A, Crystal Structure Of Tt0321 From Thermus Thermophilus Hb8 Length = 256 | Back alignment and structure |
| >pdb|2PH3|A Chain A, Crystal Structure Of 3-oxoacyl-[acyl Carrier Protein] Reductase Ttha0415 From Thermus Thermophilus Length = 245 | Back alignment and structure |
| >pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 | Back alignment and structure |
| >pdb|1CYD|A Chain A, Carbonyl Reductase Complexed With Nadph And 2-Propanol Length = 244 | Back alignment and structure |
| >pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From Mycobacterium Paratuberculosis Bound To Nicotinamide Adenine Dinucleotide Length = 280 | Back alignment and structure |
| >pdb|1IY8|A Chain A, Crystal Structure Of Levodione Reductase Length = 267 | Back alignment and structure |
| >pdb|3TZQ|B Chain B, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 271 | Back alignment and structure |
| >pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 | Back alignment and structure |
| >pdb|1WMB|A Chain A, Crystal Structure Of Nad Dependent D-3-Hydroxybutylate Dehydrogenase Length = 260 | Back alignment and structure |
| >pdb|3TSC|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Map_2410 From Mycobacterium Paratuberculosis Bound To Nad Length = 277 | Back alignment and structure |
| >pdb|2BD0|A Chain A, Chlorobium Tepidum Sepiapterin Reductase Complexed With Nadp And Sepiapterin Length = 244 | Back alignment and structure |
| >pdb|4IIU|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Escherichia Coli Strain Cft073 Complexed With Nadp+ At 2.1 A Resolution Length = 267 | Back alignment and structure |
| >pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 | Back alignment and structure |
| >pdb|4DQX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Rhizobium Etli Cfn 42 Length = 277 | Back alignment and structure |
| >pdb|1RWB|A Chain A, Cooperative Effect Of Two Surface Amino Acid Mutations (Q252l And E170k) Of Glucose Dehydrogenase From Bacillus Megaterium Iwg3 For The Stabilization Of Oligomeric State Length = 261 | Back alignment and structure |
| >pdb|3CXR|A Chain A, Crystal Structure Of Gluconate 5-Dehydrogase From Streptococcus Suis Type 2 Length = 291 | Back alignment and structure |
| >pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 | Back alignment and structure |
| >pdb|1ZJY|A Chain A, Structure Of R-Specific Alcohol Dehydrogenase (Mutant G37d) From Lactobacillus Brevis In Complex With Phenylethanol And Nadh Length = 251 | Back alignment and structure |
| >pdb|1NXQ|A Chain A, Crystal Structure Of R-Alcohol Dehydrogenase (Radh) (Apoenyzme) From Lactobacillus Brevis Length = 251 | Back alignment and structure |
| >pdb|2WDZ|A Chain A, Crystal Structure Of The Short Chain Dehydrogenase Galactitol-Dehydrogenase (Gatdh) Of Rhodobacter Sphaeroides In Complex With Nad+ And 1,2-Pentandiol Length = 254 | Back alignment and structure |
| >pdb|4ESO|A Chain A, Crystal Structure Of A Putative Oxidoreductase Protein From Sinorhizobium Meliloti 1021 In Complex With Nadp Length = 255 | Back alignment and structure |
| >pdb|3VC7|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 254 | Back alignment and structure |
| >pdb|3AY6|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 A258f Mutant In Complex With Nadh And D-Glucose Length = 269 | Back alignment and structure |
| >pdb|2BGK|A Chain A, X-Ray Structure Of Apo-Secoisolariciresinol Dehydrogenase Length = 278 | Back alignment and structure |
| >pdb|3AY7|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 G259a Mutant Length = 269 | Back alignment and structure |
| >pdb|3AUS|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 In Ligand-Free Form Length = 269 | Back alignment and structure |
| >pdb|3GVC|A Chain A, Crystal Structure Of Probable Short-Chain Dehydrogenase- Reductase From Mycobacterium Tuberculosis Length = 277 | Back alignment and structure |
| >pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 | Back alignment and structure |
| >pdb|1ZEM|A Chain A, Crystal Structure Of Nad+-Bound Xylitol Dehydrogenase Length = 262 | Back alignment and structure |
| >pdb|3UN1|A Chain A, Crystal Structure Of An Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 260 | Back alignment and structure |
| >pdb|1GCO|A Chain A, Crystal Structure Of Glucose Dehydrogenase Complexed With Nad+ Length = 261 | Back alignment and structure |
| >pdb|4IIN|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-[acyl-Carrier Protein]reductase From Helicobacter Pylori 26695 Complexed With Nad+ Length = 271 | Back alignment and structure |
| >pdb|1GEE|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant Q252l Complexed With Nad+ Length = 261 | Back alignment and structure |
| >pdb|1G6K|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant E96a Complexed With Nad+ Length = 261 | Back alignment and structure |
| >pdb|1X1E|A Chain A, Crystal Structure Of Tt0495 Protein From Thermus Thermophilus Hb8 Length = 239 | Back alignment and structure |
| >pdb|3F9I|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase Rickettsia Prowazekii Length = 249 | Back alignment and structure |
| >pdb|3VTZ|A Chain A, Structure Of Thermoplasma Volcanium Aldohexose Dehydrogenase Length = 269 | Back alignment and structure |
| >pdb|3FTP|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Burkholderia Pseudomallei At 2.05 A Resolution Length = 270 | Back alignment and structure |
| >pdb|3UVE|A Chain A, Crystal Structure Of Carveol Dehydrogenase ((+)-Trans-Carveol Dehydrogenase) From Mycobacterium Avium Length = 286 | Back alignment and structure |
| >pdb|2UVD|A Chain A, The Crystal Structure Of A 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis (Ba3989) Length = 246 | Back alignment and structure |
| >pdb|3SJ7|A Chain A, Structure Of Beta-Ketoacetyl-Coa Reductase (Fabg) From Staphylococcus Aureus Complex With Nadph Length = 252 | Back alignment and structure |
| >pdb|2YZ7|A Chain A, X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase From Alcaligenes Faecalis Length = 260 | Back alignment and structure |
| >pdb|4IBO|A Chain A, Crystal Structure Of A Putative Gluconate Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506446) Length = 271 | Back alignment and structure |
| >pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 | Back alignment and structure |
| >pdb|4G81|D Chain D, Crystal Structure Of A Hexonate Dehydrogenase Ortholog (Target Efi- 506402 From Salmonella Enterica, Unliganded Structure Length = 255 | Back alignment and structure |
| >pdb|1XKQ|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE OF Unknown Function From Caenorhabditis Elegans With Cofactor Length = 280 | Back alignment and structure |
| >pdb|2NM0|A Chain A, Crystal Structure Of Sco1815: A Beta-Ketoacyl-Acyl Carrier Protein Reductase From Streptomyces Coelicolor A3(2) Length = 253 | Back alignment and structure |
| >pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 | Back alignment and structure |
| >pdb|1YBV|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And An Active Site Inhibitor Length = 283 | Back alignment and structure |
| >pdb|1DOH|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And 4-nitro-inden-1-one Length = 283 | Back alignment and structure |
| >pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 | Back alignment and structure |
| >pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 | Back alignment and structure |
| >pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 | Back alignment and structure |
| >pdb|2Q2Q|A Chain A, Structure Of D-3-Hydroxybutyrate Dehydrogenase From Pseudomonas Putida Length = 255 | Back alignment and structure |
| >pdb|3D3W|A Chain A, Structure Of L-Xylulose Reductase With Bound Coenzyme, Phosphate And Hydroxide Length = 244 | Back alignment and structure |
| >pdb|2ZK7|A Chain A, Structure Of A C-Terminal Deletion Mutant Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (Aldt) Length = 257 | Back alignment and structure |
| >pdb|3GRP|A Chain A, 2.1 Angstrom Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Bartonella Henselae Length = 266 | Back alignment and structure |
| >pdb|2DTD|A Chain A, Structure Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (aldt) In Ligand-free Form Length = 264 | Back alignment and structure |
| >pdb|1PR9|A Chain A, Human L-Xylulose Reductase Holoenzyme Length = 244 | Back alignment and structure |
| >pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 | Back alignment and structure |
| >pdb|2PD6|A Chain A, Structure Of Human Hydroxysteroid Dehydrogenase Type 8, Hsd17b8 Length = 264 | Back alignment and structure |
| >pdb|3OSU|A Chain A, Crystal Structure Of The 3-Oxoacyl-Acyl Carrier Protein Reductase, Fabg, From Staphylococcus Aureus Length = 246 | Back alignment and structure |
| >pdb|3UF0|A Chain A, Crystal Structure Of A Putative Nad(P) Dependent Gluconate 5- Dehydrogenase From Beutenbergia Cavernae(Efi Target Efi-502044) With Bound Nadp (Low Occupancy) Length = 273 | Back alignment and structure |
| >pdb|3CTM|A Chain A, Crystal Structure Of A Carbonyl Reductase From Candida Parapsilosis With Anti-Prelog Stereo-Specificity Length = 279 | Back alignment and structure |
| >pdb|3SX2|A Chain A, Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Paratuberculosis In Complex With Nad Length = 278 | Back alignment and structure |
| >pdb|1I01|A Chain A, Crystal Structure Of Beta-Ketoacyl [acyl Carrier Protein] Reductase From E. Coli. Length = 244 | Back alignment and structure |
| >pdb|3TZC|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(Y155f) From Vibrio Cholerae Length = 251 | Back alignment and structure |
| >pdb|2A4K|A Chain A, 3-Oxoacyl-[acyl Carrier Protein] Reductase From Thermus Thermophilus Tt0137 Length = 263 | Back alignment and structure |
| >pdb|1HXH|A Chain A, Comamonas Testosteroni 3beta17BETA HYDROXYSTEROID Dehydrogenase Length = 253 | Back alignment and structure |
| >pdb|2NTN|A Chain A, Crystal Structure Of Maba-c60v/g139a/s144l Length = 267 | Back alignment and structure |
| >pdb|4DML|A Chain A, 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Synechococcus Elongatus Pcc 7942 Length = 269 | Back alignment and structure |
| >pdb|1UZM|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 | Back alignment and structure |
| >pdb|1XU7|A Chain A, Crystal Structure Of The Interface Open Conformation Of Tetrameric 11b-hsd1 Length = 286 | Back alignment and structure |
| >pdb|3PDJ|A Chain A, Crystal Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase 1 (11b-Hsd1) In Complex With 4,4-Disubstituted Cyclohexylbenzamide Inhibitor Length = 273 | Back alignment and structure |
| >pdb|2RBE|A Chain A, The Discovery Of 2-Anilinothiazolones As 11beta-Hsd1 Inhibitors Length = 275 | Back alignment and structure |
| >pdb|2C07|A Chain A, Oxoacyl-Acp Reductase Of Plasmodium Falciparum Length = 285 | Back alignment and structure |
| >pdb|3D5Q|A Chain A, Crystal Structure Of 11b-Hsd1 In Complex With Triazole Inhibitor Length = 272 | Back alignment and structure |
| >pdb|2IRW|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Ether Inhibitor Length = 264 | Back alignment and structure |
| >pdb|4E4Y|A Chain A, The Crystal Structure Of A Short Chain Dehydrogenase Family Protein From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 244 | Back alignment and structure |
| >pdb|2ILT|A Chain A, Human 11-Beta-Hydroxysteroid Dehydrogenase (Hsd1) With Nadp And Adamantane Sulfone Inhibitor Length = 275 | Back alignment and structure |
| >pdb|2AG5|A Chain A, Crystal Structure Of Human Dhrs6 Length = 246 | Back alignment and structure |
| >pdb|2BEL|A Chain A, Structure Of Human 11-Beta-Hydroxysteroid Dehydrogenase In Complex With Nadp And Carbenoxolone Length = 283 | Back alignment and structure |
| >pdb|3CH6|A Chain A, Crystal Structure Of 11beta-Hsd1 Double Mutant (L262r, F278e) Complexed With (3,3-Dimethylpiperidin-1-Yl)(6-(3- Fluoro-4-Methylphenyl)pyridin-2-Yl)methanone Length = 286 | Back alignment and structure |
| >pdb|1AHI|A Chain A, 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With Nadh And 7-Oxo Glycochenodeoxycholic Acid Length = 255 | Back alignment and structure |
| >pdb|1UZL|A Chain A, Maba From Mycobacterium Tuberculosis Length = 247 | Back alignment and structure |
| >pdb|3TOX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase In Complex With Nad(P) From Sinorhizobium Meliloti 1021 Length = 280 | Back alignment and structure |
| >pdb|3EDM|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Agrobacterium Tumefaciens Length = 259 | Back alignment and structure |
| >pdb|2ET6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candida Tropicalis Peroxisomal Multifunctional Enzyme Type 2 Length = 604 | Back alignment and structure |
| >pdb|3AI3|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Length = 263 | Back alignment and structure |
| >pdb|3AI1|A Chain A, The Crystal Structure Of L-Sorbose Reductase From Gluconobacter Frateurii Complexed With Nadph And L-Sorbose Reveals The Structure Bases Of Its Catalytic Mechanism And High Substrate Selectivity Length = 263 | Back alignment and structure |
| >pdb|4BB6|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 | Back alignment and structure |
| >pdb|4BB5|A Chain A, Free-Wilson And Structural Approaches To Co-Optimising Human And Rodent Isoform Potency For 11b-Hydroxysteroid Dehydrogenase Type 1 11b-Hsd1 Inhibitors Length = 292 | Back alignment and structure |
| >pdb|3SJU|A Chain A, Hedamycin Polyketide Ketoreductase Bound To Nadph Length = 279 | Back alignment and structure |
| >pdb|4DBZ|A Chain A, Crystal Structure Of V151l Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 | Back alignment and structure |
| >pdb|4HFR|A Chain A, Human 11beta-Hydroxysteroid Dehydrogenase Type 1 In Complex With An Orally Bioavailable Acidic Inhibitor Azd4017. Length = 272 | Back alignment and structure |
| >pdb|3PK0|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE SDR FROM Mycobacterium Smegmatis Length = 262 | Back alignment and structure |
| >pdb|2NWQ|A Chain A, Short Chain Dehydrogenase From Pseudomonas Aeruginosa Length = 272 | Back alignment and structure |
| >pdb|4IQG|C Chain C, Crystal Structure Of Bpro0239 Oxidoreductase From Polaromonas Sp. Js666 In Nadp Bound Form Length = 271 | Back alignment and structure |
| >pdb|3E9N|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE FROM CORYNEBACTERIUM GLUTAMICUM Length = 245 | Back alignment and structure |
| >pdb|3CSD|B Chain B, Actinorhodin Polyketide Ketoreductase Mutant P94l Bound To Nadph And The Inhibitor Emodin Length = 281 | Back alignment and structure |
| >pdb|2RH4|A Chain A, Actinorhodin Ketoreductase, Actkr, With Nadph And Inhibitor Emodin Length = 277 | Back alignment and structure |
| >pdb|2RHR|B Chain B, P94l Actinorhodin Ketordeuctase Mutant, With Nadph And Inhibitor Emodin Length = 277 | Back alignment and structure |
| >pdb|4DC1|A Chain A, Crystal Structure Of Y202f Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 | Back alignment and structure |
| >pdb|1X7G|A Chain A, Actinorhodin Polyketide Ketoreductase, Act Kr, With Nadp Bound Length = 261 | Back alignment and structure |
| >pdb|1W4Z|A Chain A, Structure Of Actinorhodin Polyketide (Actiii) Reductase Length = 281 | Back alignment and structure |
| >pdb|3EZL|A Chain A, Crystal Structure Of Acetyacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 256 | Back alignment and structure |
| >pdb|3GMD|A Chain A, Structure-Based Design Of 7-Azaindole-Pyrrolidines As Inhibitors Of 11beta-Hydroxysteroid-Dehydrogenase Type I Length = 264 | Back alignment and structure |
| >pdb|4AFN|A Chain A, Crystal Structure Of 3-ketoacyl-(acyl-carrier-protein) Reductase (fabg) From Pseudomonas Aeruginosa At 2.3a Resolution Length = 269 | Back alignment and structure |
| >pdb|3M1A|A Chain A, The Crystal Structure Of A Short-Chain Dehydrogenase From Streptomyces Avermitilis To 2a Length = 281 | Back alignment and structure |
| >pdb|1H5Q|A Chain A, Mannitol Dehydrogenase From Agaricus Bisporus Length = 265 | Back alignment and structure |
| >pdb|4GKB|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase Homolog (Target Efi- 505321) From Burkholderia Multivorans, Unliganded Structure Length = 258 | Back alignment and structure |
| >pdb|3GK3|A Chain A, Crystal Structure Of Acetoacetyl-Coa Reductase From Burkholderia Pseudomallei 1710b Length = 269 | Back alignment and structure |
| >pdb|4HP8|A Chain A, Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 3-Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506435) With Bound Nadp Length = 247 | Back alignment and structure |
| >pdb|4FC6|A Chain A, Studies On Dcr Shed New Light On Peroxisomal Beta-Oxidation: Crystal Structure Of The Ternary Complex Of Pdcr Length = 277 | Back alignment and structure |
| >pdb|3V8B|A Chain A, Crystal Structure Of A 3-Ketoacyl-Acp Reductase From Sinorhizobium Meliloti 1021 Length = 283 | Back alignment and structure |
| >pdb|3T7C|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Bound To Nad Length = 299 | Back alignment and structure |
| >pdb|1E3W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And 3-Keto Butyrate Length = 261 | Back alignment and structure |
| >pdb|2EW8|A Chain A, Crystal Structure Of The (s)-specific 1-phenylethanol Dehydrogenase Of The Denitrifying Bacterium Strain Ebn1 Length = 249 | Back alignment and structure |
| >pdb|3KZV|A Chain A, The Crystal Structure Of A Cytoplasmic Protein With Unknown Function From Saccharomyces Cerevisiae Length = 254 | Back alignment and structure |
| >pdb|3LZ6|A Chain A, Guinea Pig 11beta Hydroxysteroid Dehydrogenase With Pf-877423 Length = 263 | Back alignment and structure |
| >pdb|1XSE|A Chain A, Crystal Structure Of Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Length = 295 | Back alignment and structure |
| >pdb|3G49|A Chain A, N-(Pyridin-2-Yl) Arylsulfonamide Inhibitors Of 11b-Hydroxysteroid Dehydrogenase Type 1: Discovery Of Pf-915275 Length = 277 | Back alignment and structure |
| >pdb|4DC0|A Chain A, Crystal Structure Of F189w Actinorhodin Polyketide Ketoreductase With Nadph Length = 281 | Back alignment and structure |
| >pdb|3DWF|A Chain A, Crystal Structure Of The Guinea Pig 11beta-Hydroxysteroid Dehydrogenase Type 1 Mutant F278e Length = 276 | Back alignment and structure |
| >pdb|1Y5M|A Chain A, The Crystal Structure Of Murine 11b-Hydroxysteroid Dehydrogenase: An Important Therapeutic Target For Diabetes Length = 276 | Back alignment and structure |
| >pdb|3OP4|A Chain A, Crystal Structure Of Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Vibrio Cholerae O1 Biovar Eltor Str. N16961 In Complex With Nadp+ Length = 248 | Back alignment and structure |
| >pdb|3I1J|A Chain A, Structure Of A Putative Short Chain Dehydrogenase From Pseudomonas Syringae Length = 247 | Back alignment and structure |
| >pdb|3RKR|A Chain A, Crystal Structure Of A Metagenomic Short-Chain Oxidoreductase (Sdr) In Complex With Nadp Length = 262 | Back alignment and structure |
| >pdb|1E6W|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh And Estradiol Length = 260 | Back alignment and structure |
| >pdb|3RIH|A Chain A, Crystal Structure Of A Putative Short Chain Dehydrogenase Or Reductase From Mycobacterium Abscessus Length = 293 | Back alignment and structure |
| >pdb|1E3S|A Chain A, Rat Brain 3-Hydroxyacyl-Coa Dehydrogenase Binary Complex With Nadh Length = 261 | Back alignment and structure |
| >pdb|3GDF|A Chain A, Crystal Structure Of The Nadp-Dependent Mannitol Dehydrogenase From Cladosporium Herbarum. Length = 267 | Back alignment and structure |
| >pdb|1U7T|A Chain A, Crystal Structure Of AbadHSD10 WITH A BOUND INHIBITOR Length = 261 | Back alignment and structure |
| >pdb|3UXY|A Chain A, The Crystal Structure Of Short Chain Dehydrogenase From Rhodobacter Sphaeroides Length = 266 | Back alignment and structure |
| >pdb|4FN4|A Chain A, Short-chain Nad(h)-dependent Dehydrogenase/reductase From Sulfolobus Acidocaldarius Length = 254 | Back alignment and structure |
| >pdb|3AWD|A Chain A, Crystal Structure Of Gox2181 Length = 260 | Back alignment and structure |
| >pdb|3P19|A Chain A, Improved Nadph-Dependent Blue Fluorescent Protein Length = 266 | Back alignment and structure |
| >pdb|3ICC|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis At 1.87 A Resolution Length = 255 | Back alignment and structure |
| >pdb|3UWR|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Strain 104 Length = 286 | Back alignment and structure |
| >pdb|4FGS|A Chain A, Crystal Structure Of A Probable Dehydrogenase Protein Length = 273 | Back alignment and structure |
| >pdb|1UAY|A Chain A, Crystal Structure Of Type Ii 3-Hydroxyacyl-Coa Dehydrogenase From Thermus Thermophilus Hb8 Length = 242 | Back alignment and structure |
| >pdb|3OIC|A Chain A, Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl) From B. Subtilis (Apo Form) Length = 258 | Back alignment and structure |
| >pdb|4E3Z|A Chain A, Crystal Structure Of A Oxidoreductase From Rhizobium Etli Cfn 42 Length = 272 | Back alignment and structure |
| >pdb|1JA9|A Chain A, Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalene Reductase In Complex With Nadph And Pyroquilon Length = 274 | Back alignment and structure |
| >pdb|3GED|A Chain A, Fingerprint And Structural Analysis Of A Apo Scor Enzyme From Clostridium Thermocellum Length = 247 | Back alignment and structure |
| >pdb|3TL3|A Chain A, Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Ulcerans Length = 257 | Back alignment and structure |
| >pdb|3G1T|A Chain A, Crystal Structure Of Short Chain Dehydrogenase From Salmonella Enterica Subsp. Enterica Serovar Typhi Str. Ct18 Length = 258 | Back alignment and structure |
| >pdb|3ASU|A Chain A, Crystal Structure Of Serine Dehydrogenase From Escherichia Coli Length = 248 | Back alignment and structure |
| >pdb|3OIF|A Chain A, Crystal Structure Of Enoyl-Acp Reductases I (Fabi) From B. Subtilis (Complex With Nad And Tcl) Length = 266 | Back alignment and structure |
| >pdb|1GEG|A Chain A, Cryatal Structure Analysis Of Meso-2,3-Butanediol Dehydrogenase Length = 256 | Back alignment and structure |
| >pdb|3IS3|A Chain A, Crystal Structure Of 17beta-Hydroxysteroid Dehydrogenase (Apo Form) From Fungus Cochliobolus Lunatus Length = 270 | Back alignment and structure |
| >pdb|1SO8|A Chain A, Abeta-bound Human Abad Structure [also Known As 3-hydroxyacyl-coa Dehydrogenase Type Ii (type Ii Hadh), Endoplasmic Reticulum- Associated Amyloid Beta-peptide Binding Protein (erab)] Length = 261 | Back alignment and structure |
| >pdb|1ULS|A Chain A, Crystal Structure Of Tt0140 From Thermus Thermophilus Hb8 Length = 245 | Back alignment and structure |
| >pdb|2O23|A Chain A, The Structure Of Wild-Type Human Hadh2 (17beta-Hydroxysteroid Dehydrogenase Type 10) Bound To Nad+ At 1.2 A Length = 265 | Back alignment and structure |
| >pdb|3SVT|A Chain A, Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Ulcerans Length = 281 | Back alignment and structure |
| >pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 | Back alignment and structure |
| >pdb|3AK4|A Chain A, Crystal Structure Of Nadh-Dependent Quinuclidinone Reductase From Agrobacterium Tumefaciens Length = 263 | Back alignment and structure |
| >pdb|1A27|A Chain A, Human 17-Beta-Hydroxysteroid-Dehydrogenase Type 1 C-Terminal Deletion Mutant Complexed With Estradiol And Nadp+ Length = 289 | Back alignment and structure |
| >pdb|3F5Q|A Chain A, Crystal Structure Of Putative Short Chain Dehydrogenase From Escherichia Coli Cft073 Length = 262 | Back alignment and structure |
| >pdb|3F1L|A Chain A, The 0.95 A Structure Of An Oxidoreductase, Ycik From E.Coli Length = 252 | Back alignment and structure |
| >pdb|3R3S|A Chain A, Structure Of The Ygha Oxidoreductase From Salmonella Enterica Length = 294 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 105 | |||
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 4e-48 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 9e-48 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 2e-47 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 2e-31 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 1e-30 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 1e-30 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 1e-30 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 2e-30 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 2e-30 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 8e-30 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 1e-29 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 1e-29 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 2e-29 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 2e-29 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 2e-29 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 3e-29 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 4e-29 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 4e-29 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 5e-29 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 1e-28 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 2e-28 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 2e-28 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 3e-28 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 4e-28 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 5e-28 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 6e-28 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 6e-28 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 1e-27 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 2e-27 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 2e-27 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 2e-27 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 2e-27 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 2e-27 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 4e-27 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 5e-27 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 5e-27 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 6e-27 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 7e-27 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 8e-27 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 8e-27 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 9e-27 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 1e-26 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 1e-26 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 1e-26 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 1e-26 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 2e-26 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 2e-26 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 3e-26 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 3e-26 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 3e-26 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 3e-26 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 3e-26 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 4e-26 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 6e-26 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 7e-26 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 7e-26 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 9e-26 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 1e-25 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 1e-25 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 2e-25 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 2e-25 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 2e-25 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 2e-25 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 3e-25 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 3e-25 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 5e-25 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 7e-25 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 9e-25 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 1e-24 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 2e-24 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 2e-24 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 2e-24 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 3e-24 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 4e-24 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 4e-24 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 4e-24 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 5e-24 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 6e-24 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 6e-24 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 7e-24 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 1e-23 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 1e-23 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 3e-23 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 3e-23 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 4e-23 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 4e-23 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 5e-23 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 6e-23 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 7e-23 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 8e-23 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 9e-23 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 1e-22 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 1e-22 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 1e-22 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 1e-22 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 2e-22 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 2e-22 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 2e-22 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 2e-22 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 3e-22 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 4e-22 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 5e-22 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 7e-22 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 7e-22 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 9e-22 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 2e-21 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 2e-21 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 3e-21 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 3e-21 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 4e-21 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 4e-21 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 5e-21 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 7e-21 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 9e-21 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 9e-21 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 1e-20 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 1e-20 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 2e-20 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 3e-20 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 4e-20 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 6e-20 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 8e-20 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 3e-19 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 4e-19 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 4e-19 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 5e-19 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 1e-18 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 1e-18 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 2e-18 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 2e-18 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 2e-18 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 3e-18 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 3e-18 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 4e-18 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 1e-17 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 1e-17 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 2e-17 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 2e-17 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 2e-17 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 2e-17 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 3e-17 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 2e-16 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 2e-16 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 3e-16 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 6e-16 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 4e-16 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 5e-16 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 7e-16 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 8e-16 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 8e-16 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 9e-16 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 1e-15 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 1e-15 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 1e-15 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 2e-15 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 2e-15 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 2e-15 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 2e-15 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 3e-15 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 3e-15 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 3e-15 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 3e-15 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 4e-15 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 4e-15 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 5e-15 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 5e-15 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 8e-15 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 8e-15 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 1e-14 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 1e-14 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 1e-14 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 2e-14 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 2e-14 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 2e-14 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 2e-14 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 3e-14 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 4e-14 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 4e-14 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 5e-14 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 2e-13 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 4e-13 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 4e-13 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 8e-13 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 6e-11 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 1e-10 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 2e-07 |
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 | Back alignment and structure |
|---|
Score = 153 bits (389), Expect = 4e-48
Identities = 61/92 (66%), Positives = 80/92 (86%)
Query: 2 EDFSTIMTTNFESAYHLSQLAHPLLKASGNGNIVFISSVAGVIALPMCSIYASSKGAMNE 61
+D++ IM TNFE+AYHLSQ+A+PLLKAS NGN++F+SS+AG ALP S+Y++SKGA+N+
Sbjct: 121 KDYNIIMGTNFEAAYHLSQIAYPLLKASQNGNVIFLSSIAGFSALPSVSLYSASKGAINQ 180
Query: 62 LTKNLACEWAKDKIRVNSVAPWMIRTPLVDNL 93
+TK+LACEWAKD IRVNSVAP +I TPLV+
Sbjct: 181 MTKSLACEWAKDNIRVNSVAPGVILTPLVETA 212
|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 99.97 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 99.96 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 99.96 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 99.96 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 99.95 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 99.95 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 99.94 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 99.94 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 99.92 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 99.91 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 99.91 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 99.91 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 99.91 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 99.91 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 99.91 | |
| 3rku_A | 287 | Oxidoreductase YMR226C; substrate fingerprint, sho | 99.91 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 99.91 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.9 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.9 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 99.9 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 99.9 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.9 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 99.9 | |
| 1zmo_A | 244 | Halohydrin dehalogenase; haloalcohol dehalogenase, | 99.9 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 99.9 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 99.9 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 99.9 | |
| 3uve_A | 286 | Carveol dehydrogenase ((+)-trans-carveol dehydrog; | 99.9 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.9 | |
| 3tsc_A | 277 | Putative oxidoreductase; structural genomics, seat | 99.9 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 99.9 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 99.9 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 99.9 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 99.9 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 99.9 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 99.9 | |
| 3t7c_A | 299 | Carveol dehydrogenase; structural genomics, seattl | 99.9 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 99.9 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 99.9 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 99.9 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 99.9 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 99.9 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 99.9 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 99.9 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 99.9 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 99.9 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 99.9 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 99.9 | |
| 3nyw_A | 250 | Putative oxidoreductase; fatty acid synthesis,3-ox | 99.9 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 99.9 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.89 | |
| 3asu_A | 248 | Short-chain dehydrogenase/reductase SDR; SDR famil | 99.89 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 99.89 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 99.89 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 99.89 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 99.89 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 99.89 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 99.89 | |
| 1e7w_A | 291 | Pteridine reductase; dihydrofolate reductase, shor | 99.89 | |
| 3kzv_A | 254 | Uncharacterized oxidoreductase YIR035C; cytoplasmi | 99.89 | |
| 1zmt_A | 254 | Haloalcohol dehalogenase HHEC; halohydrin dehaloge | 99.89 | |
| 3ezl_A | 256 | Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA | 99.89 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 99.89 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.89 | |
| 3a28_C | 258 | L-2.3-butanediol dehydrogenase; chiral substrate r | 99.89 | |
| 3oec_A | 317 | Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; | 99.89 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 99.89 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 99.89 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 99.89 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 99.89 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 99.88 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 99.88 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 99.88 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 99.88 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 99.88 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 99.88 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 99.88 | |
| 4e4y_A | 244 | Short chain dehydrogenase family protein; structur | 99.88 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 99.88 | |
| 3guy_A | 230 | Short-chain dehydrogenase/reductase SDR; structura | 99.88 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 99.88 | |
| 2qhx_A | 328 | Pteridine reductase 1; oxidoreductase, short-chain | 99.88 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 99.88 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 99.88 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 99.88 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 99.88 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 99.88 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 99.88 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 99.88 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 99.88 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 99.88 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 99.88 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 99.88 | |
| 2et6_A | 604 | (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox | 99.88 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 99.88 | |
| 2nwq_A | 272 | Probable short-chain dehydrogenase; oxidoreductase | 99.88 | |
| 2uvd_A | 246 | 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k | 99.88 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 99.88 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 99.88 | |
| 1geg_A | 256 | Acetoin reductase; SDR family, oxidoreductase; HET | 99.88 | |
| 2x9g_A | 288 | PTR1, pteridine reductase; short chain dehydrogena | 99.88 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 99.88 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 99.88 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 99.88 | |
| 3lt0_A | 329 | Enoyl-ACP reductase; triclosan, triclosan variant, | 99.88 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.88 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 99.88 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 99.87 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 99.87 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.87 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 99.87 | |
| 3cxt_A | 291 | Dehydrogenase with different specificities; rossma | 99.87 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 99.87 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 99.87 | |
| 1jtv_A | 327 | 17 beta-hydroxysteroid dehydrogenase type 1; stero | 99.87 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 99.87 | |
| 1xhl_A | 297 | Short-chain dehydrogenase/reductase family member | 99.87 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 99.87 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 99.87 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 99.87 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 99.87 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 99.87 | |
| 3o38_A | 266 | Short chain dehydrogenase; tuberculosis, ortholog | 99.87 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 99.87 | |
| 3gdg_A | 267 | Probable NADP-dependent mannitol dehydrogenase; ro | 99.87 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 99.87 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 99.87 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 99.87 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 99.87 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 99.87 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 99.87 | |
| 1xkq_A | 280 | Short-chain reductase family member (5D234); parra | 99.87 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 99.87 | |
| 1oaa_A | 259 | Sepiapterin reductase; tetrahydrobiopterin, oxidor | 99.86 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 99.86 | |
| 1spx_A | 278 | Short-chain reductase family member (5L265); paral | 99.86 | |
| 3ioy_A | 319 | Short-chain dehydrogenase/reductase SDR; structura | 99.86 | |
| 2p91_A | 285 | Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD | 99.86 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 99.86 | |
| 3ksu_A | 262 | 3-oxoacyl-acyl carrier protein reductase; structur | 99.86 | |
| 3r3s_A | 294 | Oxidoreductase; structural genomics, csgid, center | 99.86 | |
| 2qq5_A | 260 | DHRS1, dehydrogenase/reductase SDR family member 1 | 99.86 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 99.86 | |
| 2pd4_A | 275 | Enoyl-[acyl-carrier-protein] reductase [NADH]; ant | 99.86 | |
| 3u9l_A | 324 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 99.86 | |
| 3kvo_A | 346 | Hydroxysteroid dehydrogenase-like protein 2; HSDL2 | 99.86 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 99.86 | |
| 3icc_A | 255 | Putative 3-oxoacyl-(acyl carrier protein) reducta; | 99.86 | |
| 1g0o_A | 283 | Trihydroxynaphthalene reductase; protein-NADPH-act | 99.86 | |
| 3edm_A | 259 | Short chain dehydrogenase; structural genomics, ox | 99.85 | |
| 1mxh_A | 276 | Pteridine reductase 2; SDR topology, protein-subst | 99.85 | |
| 1qsg_A | 265 | Enoyl-[acyl-carrier-protein] reductase; enoyl redu | 99.85 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 99.85 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 99.85 | |
| 1d7o_A | 297 | Enoyl-[acyl-carrier protein] reductase (NADH) PRE; | 99.85 | |
| 2wyu_A | 261 | Enoyl-[acyl carrier protein] reductase; oxidoreduc | 99.85 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 99.85 | |
| 3u0b_A | 454 | Oxidoreductase, short chain dehydrogenase/reducta | 99.85 | |
| 3ek2_A | 271 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 99.85 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 99.85 | |
| 2bd0_A | 244 | Sepiapterin reductase; oxidoreductase; HET: NAP BI | 99.85 | |
| 1gee_A | 261 | Glucose 1-dehydrogenase; short-chain dehydrogenase | 99.85 | |
| 2o2s_A | 315 | Enoyl-acyl carrier reductase; enoyl reductase, tri | 99.85 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 99.85 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 99.85 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 99.84 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 99.84 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 99.84 | |
| 2h7i_A | 269 | Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi | 99.84 | |
| 3s8m_A | 422 | Enoyl-ACP reductase; rossmann fold, oxidoreductase | 99.84 | |
| 2ptg_A | 319 | Enoyl-acyl carrier reductase; apicomplexa, enoyl ( | 99.84 | |
| 1gz6_A | 319 | Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF | 99.84 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 99.84 | |
| 3zu3_A | 405 | Putative reductase YPO4104/Y4119/YP_4011; oxidored | 99.84 | |
| 3o26_A | 311 | Salutaridine reductase; short chain dehydrogenase/ | 99.84 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 99.84 | |
| 3qlj_A | 322 | Short chain dehydrogenase; structural genomics, se | 99.84 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 99.84 | |
| 4e3z_A | 272 | Putative oxidoreductase protein; PSI-biology, stru | 99.84 | |
| 2cfc_A | 250 | 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor | 99.84 | |
| 1edo_A | 244 | Beta-keto acyl carrier protein reductase; nucleoti | 99.83 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 99.83 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 99.83 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 99.83 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 99.83 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 99.83 | |
| 2ph3_A | 245 | 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 | 99.83 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 99.82 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 99.82 | |
| 2c07_A | 285 | 3-oxoacyl-(acyl-carrier protein) reductase; oxidor | 99.82 | |
| 1yo6_A | 250 | Putative carbonyl reductase sniffer; tyrosine-depe | 99.82 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 99.82 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 99.82 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 99.82 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 99.82 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 99.82 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 99.82 | |
| 3oml_A | 613 | GH14720P, peroxisomal multifunctional enzyme type | 99.81 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 99.81 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 99.81 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 99.81 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 99.81 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 99.8 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 99.8 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 99.8 | |
| 1xu9_A | 286 | Corticosteroid 11-beta-dehydrogenase, isozyme 1; h | 99.8 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 99.79 | |
| 4eue_A | 418 | Putative reductase CA_C0462; TER, biofuel, synthet | 99.79 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 99.78 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 99.76 | |
| 1ja9_A | 274 | 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p | 99.75 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 99.72 | |
| 2yut_A | 207 | Putative short-chain oxidoreductase; alpha and bet | 99.72 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 99.71 | |
| 1wma_A | 276 | Carbonyl reductase [NADPH] 1; oxidoreductase; HET: | 99.7 | |
| 3qp9_A | 525 | Type I polyketide synthase pikaii; rossmann fold, | 99.61 | |
| 2uv8_A | 1887 | Fatty acid synthase subunit alpha (FAS2); fatty ac | 99.6 | |
| 2pff_A | 1688 | Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl | 99.54 | |
| 2uv9_A | 1878 | Fatty acid synthase alpha subunits; fungal, dehydr | 99.53 | |
| 3slk_A | 795 | Polyketide synthase extender module 2; rossmann fo | 99.47 | |
| 3mje_A | 496 | AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. | 99.37 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 99.37 | |
| 2z5l_A | 511 | Tylkr1, tylactone synthase starter module and modu | 99.2 | |
| 3zen_D | 3089 | Fatty acid synthase; transferase, mycolic acid bio | 99.16 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 99.15 | |
| 1kew_A | 361 | RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo | 99.13 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 99.11 | |
| 2fr1_A | 486 | Erythromycin synthase, eryai; short chain dehydrog | 99.11 | |
| 1orr_A | 347 | CDP-tyvelose-2-epimerase; rossmann fold, short-cha | 99.11 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 99.1 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 99.09 | |
| 3ehe_A | 313 | UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, | 99.04 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 99.04 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 99.03 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 99.02 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 99.02 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 98.99 | |
| 1i24_A | 404 | Sulfolipid biosynthesis protein SQD1; SDR, short-c | 98.95 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 98.94 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 98.92 | |
| 1gy8_A | 397 | UDP-galactose 4-epimerase; oxidoreductase; HET: NA | 98.9 | |
| 2p5y_A | 311 | UDP-glucose 4-epimerase; TTHA0591, structural geno | 98.9 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 98.87 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 98.87 | |
| 1r6d_A | 337 | TDP-glucose-4,6-dehydratase; rossmann fold, short- | 98.86 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 98.83 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 98.77 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 98.77 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 98.75 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 98.74 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 98.73 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 98.72 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 98.72 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 98.71 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 98.69 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 98.69 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 98.69 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 98.69 | |
| 1t2a_A | 375 | GDP-mannose 4,6 dehydratase; structural genomics c | 98.67 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 98.66 | |
| 2bll_A | 345 | Protein YFBG; decarboxylase, short chain dehydroge | 98.65 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 98.63 | |
| 1eq2_A | 310 | ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin | 98.62 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 98.62 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 98.61 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 98.59 | |
| 3ajr_A | 317 | NDP-sugar epimerase; L-threonine dehydrogenase, L- | 98.59 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 98.59 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 98.58 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 98.58 | |
| 1db3_A | 372 | GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya | 98.55 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 98.55 | |
| 1udb_A | 338 | Epimerase, UDP-galactose-4-epimerase; isomerase; H | 98.54 | |
| 1n7h_A | 381 | GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, | 98.53 | |
| 4b8w_A | 319 | GDP-L-fucose synthase; oxidoreductase; HET: NAP GD | 98.52 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 98.51 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 98.5 | |
| 1z7e_A | 660 | Protein aRNA; rossmann fold, OB-like fold, hydrola | 98.43 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 98.42 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 98.42 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 98.39 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 98.39 | |
| 3slg_A | 372 | PBGP3 protein; structural genomics, seattle struct | 98.36 | |
| 2ggs_A | 273 | 273AA long hypothetical DTDP-4-dehydrorhamnose red | 98.3 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 98.29 | |
| 1z45_A | 699 | GAL10 bifunctional protein; epimerase, mutarotase, | 98.29 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 98.29 | |
| 4ggo_A | 401 | Trans-2-enoyl-COA reductase; rossmann fold, oxidor | 98.26 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 98.24 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 98.22 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 98.2 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 98.2 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 98.19 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 98.16 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 98.16 | |
| 4f6l_B | 508 | AUSA reductase domain protein; thioester reductase | 98.05 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 98.02 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 97.97 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 97.7 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 97.68 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 97.59 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 97.49 | |
| 1xgk_A | 352 | Nitrogen metabolite repression regulator NMRA; ros | 97.41 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 97.35 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 97.29 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 97.2 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 96.31 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 95.09 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 94.06 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 93.82 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 92.75 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 92.51 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 89.15 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 87.65 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 86.55 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 81.82 |
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
Probab=99.97 E-value=1.4e-29 Score=159.72 Aligned_cols=93 Identities=31% Similarity=0.422 Sum_probs=88.5
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHcCC-CceEEEEcCccccccCCCchhhhhHHHHHHHHHHHHHhHhcCCCcEEEEe
Q 034041 2 EDFSTIMTTNFESAYHLSQLAHPLLKASG-NGNIVFISSVAGVIALPMCSIYASSKGAMNELTKNLACEWAKDKIRVNSV 80 (105)
Q Consensus 2 ~~~~~~~~~n~~~~~~l~~~~~~~~~~~~-~~~iv~~ss~~~~~~~~~~~~y~~sK~~~~~l~~~la~e~~~~gi~v~~v 80 (105)
++|++++++|+.|+|+++|+++|+|.+++ +|+|||+||..+..+.+....|+++|+++.+|+|+++.|++++|||||+|
T Consensus 101 ~~w~~~~~vNl~g~f~~~~~~~~~m~~~g~~G~IVnisS~~~~~g~~~~~~Y~asKaav~~ltr~lA~Ela~~gIrVNaV 180 (247)
T 4hp8_A 101 LDWDEVMDVNLKALFFTTQAFAKELLAKGRSGKVVNIASLLSFQGGIRVPSYTAAKHGVAGLTKLLANEWAAKGINVNAI 180 (247)
T ss_dssp HHHHHHHHHHTHHHHHHHHHHHHHHHHHTCCEEEEEECCGGGTSCCSSCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEEE
T ss_pred HHHHHHHHHHhHHHHHHHHHHHHHHHHhCCCcEEEEEechhhCCCCCCChHHHHHHHHHHHHHHHHHHHHhhcCeEEEEE
Confidence 68999999999999999999999998765 69999999999999999999999999999999999999999999999999
Q ss_pred ecCceeCcchhhHH
Q 034041 81 APWMIRTPLVDNLK 94 (105)
Q Consensus 81 ~pG~~~t~~~~~~~ 94 (105)
+||+++|++.+...
T Consensus 181 ~PG~i~T~~~~~~~ 194 (247)
T 4hp8_A 181 APGYIETNNTEALR 194 (247)
T ss_dssp EECSBCSGGGHHHH
T ss_pred eeCCCCCcchhhcc
Confidence 99999999987763
|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* | Back alignment and structure |
|---|
| >3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* | Back alignment and structure |
|---|
| >3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} | Back alignment and structure |
|---|
| >3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} | Back alignment and structure |
|---|
| >2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} | Back alignment and structure |
|---|
| >3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* | Back alignment and structure |
|---|
| >3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* | Back alignment and structure |
|---|
| >3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* | Back alignment and structure |
|---|
| >1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* | Back alignment and structure |
|---|
| >2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A | Back alignment and structure |
|---|
| >3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* | Back alignment and structure |
|---|
| >2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... | Back alignment and structure |
|---|
| >3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} | Back alignment and structure |
|---|
| >2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} | Back alignment and structure |
|---|
| >1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* | Back alignment and structure |
|---|
| >3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* | Back alignment and structure |
|---|
| >3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* | Back alignment and structure |
|---|
| >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* | Back alignment and structure |
|---|
| >3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} | Back alignment and structure |
|---|
| >3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} | Back alignment and structure |
|---|
| >3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* | Back alignment and structure |
|---|
| >1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* | Back alignment and structure |
|---|
| >2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* | Back alignment and structure |
|---|
| >1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* | Back alignment and structure |
|---|
| >4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 105 | ||||
| d2d1ya1 | 248 | c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T | 9e-26 | |
| d1yb1a_ | 244 | c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase | 4e-25 | |
| d1ydea1 | 250 | c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase | 9e-24 | |
| d1jtva_ | 285 | c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi | 1e-23 | |
| d1spxa_ | 264 | c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato | 5e-23 | |
| d2ae2a_ | 259 | c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu | 1e-22 | |
| d2ew8a1 | 247 | c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas | 2e-22 | |
| d1hdca_ | 254 | c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr | 8e-22 | |
| d1sbya1 | 254 | c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase | 8e-22 | |
| d2bd0a1 | 240 | c.2.1.2 (A:2-241) Bacterial sepiapterin reductase | 3e-21 | |
| d2c07a1 | 251 | c.2.1.2 (A:54-304) beta-keto acyl carrier protein | 4e-21 | |
| d1gz6a_ | 302 | c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do | 1e-20 | |
| d1xg5a_ | 257 | c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 | 1e-20 | |
| d1xkqa_ | 272 | c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh | 3e-20 | |
| d2gdza1 | 254 | c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog | 5e-20 | |
| d2ag5a1 | 245 | c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami | 9e-20 | |
| d1xu9a_ | 269 | c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase | 1e-19 | |
| d1zk4a1 | 251 | c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase | 8e-19 | |
| d1edoa_ | 244 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 9e-19 | |
| d1xq1a_ | 259 | c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara | 9e-19 | |
| d1q7ba_ | 243 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 2e-18 | |
| d1xhla_ | 274 | c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh | 4e-18 | |
| d1hxha_ | 253 | c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge | 8e-18 | |
| d1cyda_ | 242 | c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul | 1e-17 | |
| d1bdba_ | 276 | c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy | 1e-17 | |
| d1ae1a_ | 258 | c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu | 2e-17 | |
| d1pr9a_ | 244 | c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie | 2e-17 | |
| d1zema1 | 260 | c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba | 2e-17 | |
| d1uaya_ | 241 | c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena | 2e-17 | |
| d2bgka1 | 268 | c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de | 4e-16 | |
| d1o5ia_ | 234 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 7e-16 | |
| d1ulsa_ | 242 | c.2.1.2 (A:) beta-keto acyl carrier protein reduct | 4e-15 | |
| d1yo6a1 | 250 | c.2.1.2 (A:1-250) Putative carbonyl reductase snif | 3e-14 | |
| d1g0oa_ | 272 | c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase | 3e-14 | |
| d1ja9a_ | 259 | c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc | 3e-14 | |
| d2o23a1 | 248 | c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr | 7e-14 | |
| d1x1ta1 | 260 | c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge | 1e-13 | |
| d1h5qa_ | 260 | c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga | 2e-13 | |
| d1wmaa1 | 275 | c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox | 3e-13 | |
| d2rhca1 | 257 | c.2.1.2 (A:5-261) beta-keto acyl carrier protein r | 3e-13 | |
| d1oaaa_ | 259 | c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus | 4e-13 | |
| d1yxma1 | 297 | c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re | 4e-13 | |
| d1ulua_ | 256 | c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph | 9e-13 | |
| d1w6ua_ | 294 | c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr | 2e-12 | |
| d1nffa_ | 244 | c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob | 2e-12 | |
| d1uzma1 | 237 | c.2.1.2 (A:9-245) beta-keto acyl carrier protein r | 4e-12 | |
| d1iy8a_ | 258 | c.2.1.2 (A:) Levodione reductase {Corynebacterium | 4e-12 | |
| d1dhra_ | 236 | c.2.1.2 (A:) Dihydropteridin reductase (pteridine | 6e-12 | |
| d2a4ka1 | 241 | c.2.1.2 (A:2-242) beta-keto acyl carrier protein r | 8e-12 | |
| d1vl8a_ | 251 | c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga | 1e-11 | |
| d1zmta1 | 252 | c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag | 2e-11 | |
| d1qsga_ | 258 | c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli | 2e-11 | |
| d1ooea_ | 235 | c.2.1.2 (A:) Dihydropteridin reductase (pteridine | 4e-11 | |
| d1geea_ | 261 | c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat | 5e-11 | |
| d1fmca_ | 255 | c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase | 9e-10 | |
| d1snya_ | 248 | c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly | 3e-09 | |
| d1k2wa_ | 256 | c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s | 9e-09 | |
| d1gega_ | 255 | c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl | 1e-08 | |
| d1mxha_ | 266 | c.2.1.2 (A:) Dihydropteridin reductase (pteridine | 2e-08 | |
| d1luaa1 | 191 | c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter | 6e-04 | |
| d1fjha_ | 257 | c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase | 0.001 |
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: Hypothetical protein TTHA0369 species: Thermus thermophilus [TaxId: 274]
Score = 94.1 bits (234), Expect = 9e-26
Identities = 33/93 (35%), Positives = 52/93 (55%)
Query: 1 MEDFSTIMTTNFESAYHLSQLAHPLLKASGNGNIVFISSVAGVIALPMCSIYASSKGAMN 60
+ ++ ++ N + HLS LA ++ G G IV ++SV G+ A + Y +SKG +
Sbjct: 97 LPEWRRVLEVNLTAPMHLSALAAREMRKVGGGAIVNVASVQGLFAEQENAAYNASKGGLV 156
Query: 61 ELTKNLACEWAKDKIRVNSVAPWMIRTPLVDNL 93
LT++LA + A +IRVN+VAP I T V
Sbjct: 157 NLTRSLALDLAPLRIRVNAVAPGAIATEAVLEA 189
|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 105 | |||
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 99.96 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 99.96 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 99.95 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 99.95 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 99.95 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 99.95 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 99.95 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 99.95 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 99.95 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 99.95 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 99.95 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 99.95 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 99.95 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 99.95 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 99.95 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 99.94 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 99.94 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 99.94 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 99.94 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 99.94 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 99.94 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 99.94 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 99.94 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 99.94 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 99.93 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 99.93 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 99.93 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 99.93 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 99.93 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 99.93 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 99.93 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 99.93 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 99.93 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 99.93 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 99.93 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 99.93 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 99.93 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 99.92 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 99.92 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 99.92 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 99.92 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 99.91 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 99.91 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 99.9 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 99.9 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 99.9 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 99.9 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 99.89 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 99.89 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 99.88 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 99.88 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 99.88 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 99.87 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 99.87 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 99.86 | |
| d1uh5a_ | 329 | Enoyl-ACP reductase {Malaria parasite (Plasmodium | 99.85 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 99.84 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 99.82 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 99.82 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 99.78 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 99.73 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 99.7 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 99.68 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 99.66 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 99.62 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 99.45 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 98.15 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 98.03 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 98.03 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 97.89 | |
| d1r6da_ | 322 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces | 97.81 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 97.75 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 97.68 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 97.59 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 97.57 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 97.48 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 97.27 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 97.23 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 97.18 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 96.94 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 96.58 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 96.56 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 96.36 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 96.18 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 93.54 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 92.34 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 92.25 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 88.21 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 88.19 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 88.1 |
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Tyrosine-dependent oxidoreductases domain: beta-keto acyl carrier protein reductase species: Oil seed rape (Brassica napus) [TaxId: 3708]
Probab=99.96 E-value=5.2e-29 Score=155.73 Aligned_cols=96 Identities=25% Similarity=0.350 Sum_probs=91.3
Q ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHcCCCceEEEEcCccccccCCCchhhhhHHHHHHHHHHHHHhHhcCCCcEEEEee
Q 034041 2 EDFSTIMTTNFESAYHLSQLAHPLLKASGNGNIVFISSVAGVIALPMCSIYASSKGAMNELTKNLACEWAKDKIRVNSVA 81 (105)
Q Consensus 2 ~~~~~~~~~n~~~~~~l~~~~~~~~~~~~~~~iv~~ss~~~~~~~~~~~~y~~sK~~~~~l~~~la~e~~~~gi~v~~v~ 81 (105)
++|++.+++|+.++++++|+++|+|.++++|+||++||..+..+.++...|+++|+|+.+|+|++++|++++|||||+|+
T Consensus 101 ~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaal~~ltk~lA~el~~~gIrvN~I~ 180 (244)
T d1edoa_ 101 SQWDEVIDLNLTGVFLCTQAATKIMMKKRKGRIINIASVVGLIGNIGQANYAAAKAGVIGFSKTAAREGASRNINVNVVC 180 (244)
T ss_dssp HHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCTHHHHCCTTCHHHHHHHHHHHHHHHHHHHHHHTTTEEEEEEE
T ss_pred HHHHHHHhhhhhhHHHHHHHHHHHHHHcCCcEEEEEcChhhcCCCCCCHHHHHHHHHHHHChHHHHHHHhhhCcEEEEEe
Confidence 68999999999999999999999999988999999999999999999999999999999999999999999999999999
Q ss_pred cCceeCcchhhHHHHH
Q 034041 82 PWMIRTPLVDNLKKIL 97 (105)
Q Consensus 82 pG~~~t~~~~~~~~~~ 97 (105)
||+++|++.+...++.
T Consensus 181 PG~i~T~~~~~~~~~~ 196 (244)
T d1edoa_ 181 PGFIASDMTAKLGEDM 196 (244)
T ss_dssp ECSBCSHHHHTTCHHH
T ss_pred cceeccHHHHHhhHHH
Confidence 9999999988765543
|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|