Citrus Sinensis ID: 034054


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MDVTERETKTGNSDSALVDNKESSIQIKVLFFARARDLTGLTDMPLEVSCGSTTQDCLNKLIARFPNLEEIRGCMVLALNEEYTNASVIVNEKDELAIIPPISGG
ccccccccccccccccccccccccEEEEEEccHHHHHHHccccEEEEccccccHHHHHHHHHHHcccHHHHHcccEEEEcccccccccccccccEEEEccccccc
************************IQIKVLFFARARDLTGLTDMPLEVSCGSTTQDCLNKLIARFPNLEEIRGCMVLALNEEYTNASVIVNEKDELAIIPPISGG
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVTERETKTGNSDSALVDNKESSIQIKVLFFARARDLTGLTDMPLEVSCGSTTQDCLNKLIARFPNLEEIRGCMVLALNEEYTNASVIVNEKDELAIIPPISGG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Molybdopterin synthase sulfur carrier subunit Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin.probableQ6YVX4
Molybdopterin synthase sulfur carrier subunit Acts as a sulfur carrier required for molybdopterin biosynthesis. Component of the molybdopterin synthase complex that catalyzes the conversion of precursor Z into molybdopterin by mediating the incorporation of 2 sulfur atoms into precursor Z to generate a dithiolene group. In the complex, serves as sulfur donor by being thiocarboxylated (-COSH) at its C-terminus by MOCS3. After interaction with MOCS2B, the sulfur is then transferred to precursor Z to form molybdopterin.probableQ9S7A3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VJK, chain A
Confidence level:very confident
Coverage over the Query: 24-103
View the alignment between query and template
View the model in PyMOL