BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034067
(104 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1B34|B Chain B, Crystal Structure Of The D1d2 Sub-Complex From The Human
Snrnp Core Domain
pdb|3CW1|C Chain C, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|P Chain P, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|Q Chain Q, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|R Chain R, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3PGW|Y Chain Y, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|V Chain V, Crystal Structure Of Human U1 Snrnp
pdb|2Y9A|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|C Chain C, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|J Chain J, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|Q Chain Q, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|3S6N|B Chain B, Crystal Structure Of The Gemin2-Binding Domain Of Smn,
Gemin2 In Complex With Smd1D2FEG FROM HUMAN
pdb|4F7U|B Chain B, Macromolecular Machine 6
pdb|4F7U|D Chain D, Macromolecular Machine 6
pdb|1VU2|B Chain B, The 8s Snrnp Assembly Intermediate
pdb|1VU2|J Chain J, The 8s Snrnp Assembly Intermediate
pdb|1VU2|R Chain R, The 8s Snrnp Assembly Intermediate
pdb|1VU2|Z Chain Z, The 8s Snrnp Assembly Intermediate
pdb|1VU2|HH Chain h, The 8s Snrnp Assembly Intermediate
pdb|1VU2|PP Chain p, The 8s Snrnp Assembly Intermediate
pdb|1VU2|XX Chain x, The 8s Snrnp Assembly Intermediate
pdb|1VU3|B Chain B, The 8s Snrnp Assembly Intermediate
pdb|1VU3|J Chain J, The 8s Snrnp Assembly Intermediate
pdb|1VU3|R Chain R, The 8s Snrnp Assembly Intermediate
pdb|1VU3|Z Chain Z, The 8s Snrnp Assembly Intermediate
pdb|1VU3|HH Chain h, The 8s Snrnp Assembly Intermediate
pdb|1VU3|PP Chain p, The 8s Snrnp Assembly Intermediate
pdb|4F77|J Chain J, The 8s Snrnp Assembly Intermediate
pdb|4F77|B Chain B, The 8s Snrnp Assembly Intermediate
pdb|4F77|R Chain R, The 8s Snrnp Assembly Intermediate
pdb|4F77|Z Chain Z, The 8s Snrnp Assembly Intermediate
pdb|4F77|HH Chain h, The 8s Snrnp Assembly Intermediate
pdb|4F77|PP Chain p, The 8s Snrnp Assembly Intermediate
pdb|4F77|XX Chain x, The 8s Snrnp Assembly Intermediate
Length = 118
Score = 115 bits (287), Expect = 8e-27, Method: Compositional matrix adjust.
Identities = 65/73 (89%), Positives = 72/73 (98%)
Query: 31 QVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMF 90
QVLINCRNNKKLLGRV+AFDRHCNMVLENV+EMWTE+PK+GKGKKK+ PVNKDR+ISKMF
Sbjct: 41 QVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKSGKGKKKSKPVNKDRYISKMF 100
Query: 91 LRGDSVIIVLRNP 103
LRGDSVI+VLRNP
Sbjct: 101 LRGDSVIVVLRNP 113
>pdb|4EMG|A Chain A, Crystal Structure Of Splsm3
pdb|4EMG|B Chain B, Crystal Structure Of Splsm3
pdb|4EMG|C Chain C, Crystal Structure Of Splsm3
pdb|4EMG|D Chain D, Crystal Structure Of Splsm3
pdb|4EMG|E Chain E, Crystal Structure Of Splsm3
pdb|4EMG|F Chain F, Crystal Structure Of Splsm3
pdb|4EMG|G Chain G, Crystal Structure Of Splsm3
pdb|4EMG|H Chain H, Crystal Structure Of Splsm3
pdb|4EMG|I Chain I, Crystal Structure Of Splsm3
pdb|4EMG|J Chain J, Crystal Structure Of Splsm3
pdb|4EMG|K Chain K, Crystal Structure Of Splsm3
pdb|4EMG|L Chain L, Crystal Structure Of Splsm3
pdb|4EMG|M Chain M, Crystal Structure Of Splsm3
pdb|4EMG|N Chain N, Crystal Structure Of Splsm3
Length = 93
Score = 47.8 bits (112), Expect = 2e-06, Method: Compositional matrix adjust.
Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 1/68 (1%)
Query: 32 VLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFL 91
V + R +++L GR+ A+D H N VL + E+ T K KAL + + +F+
Sbjct: 22 VYVKLRGDRELNGRLHAYDEHLNXVLGDAEEIVTIFDDEETDKDKALKTIRKHY-EXLFV 80
Query: 92 RGDSVIIV 99
RGDSVI++
Sbjct: 81 RGDSVILI 88
>pdb|1TH7|A Chain A, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|B Chain B, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|C Chain C, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|D Chain D, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|E Chain E, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|F Chain F, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|G Chain G, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|H Chain H, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|I Chain I, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|J Chain J, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|K Chain K, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|L Chain L, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|M Chain M, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
pdb|1TH7|N Chain N, Crystal Structure Of An Archaeal Sm Protein From
Sulfolobus Solfataricus
Length = 81
Score = 42.4 bits (98), Expect = 7e-05, Method: Compositional matrix adjust.
Identities = 21/68 (30%), Positives = 40/68 (58%), Gaps = 14/68 (20%)
Query: 32 VLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFL 91
VL+ + NK++ G +R++D+H N+VL + E+ ++ G GKK + + +
Sbjct: 22 VLVKLKGNKEVRGMLRSYDQHMNLVLSDSEEIQSD----GSGKK----------LGTIVI 67
Query: 92 RGDSVIIV 99
RGD+VI++
Sbjct: 68 RGDNVILI 75
>pdb|3BW1|A Chain A, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
Novel Octameric Ring Organisation
pdb|3BW1|B Chain B, Crystal Structure Of Homomeric Yeast Lsm3 Exhibiting
Novel Octameric Ring Organisation
Length = 96
Score = 38.9 bits (89), Expect = 7e-04, Method: Compositional matrix adjust.
Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 7/69 (10%)
Query: 31 QVLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMF 90
+V I R + L+G ++AFD HCN+VL + E +L + + R +F
Sbjct: 22 RVYIKLRGARTLVGTLQAFDSHCNIVLSDAVETIYQLNNEELSESE-------RRCEMVF 74
Query: 91 LRGDSVIIV 99
+RGD+V ++
Sbjct: 75 IRGDTVTLI 83
>pdb|1I8F|A Chain A, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|B Chain B, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|C Chain C, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|D Chain D, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|E Chain E, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|F Chain F, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1I8F|G Chain G, The Crystal Structure Of A Heptameric Archaeal Sm
Protein: Implications For The Eukaryotic Snrnp Core
pdb|1LNX|A Chain A, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|B Chain B, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|C Chain C, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|D Chain D, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|E Chain E, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|F Chain F, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
pdb|1LNX|G Chain G, Crystal Structure Of The P.Aerophilum Smap1 Heptamer In
A New Crystal Form (C2221)
Length = 81
Score = 37.0 bits (84), Expect = 0.003, Method: Compositional matrix adjust.
Identities = 17/48 (35%), Positives = 30/48 (62%), Gaps = 5/48 (10%)
Query: 21 CFWAL-----EFIVLQVLINCRNNKKLLGRVRAFDRHCNMVLENVREM 63
CF L + I QVL+ R++ ++ G +R+FD+H N++LE+ E+
Sbjct: 8 CFATLGATLQDSIGKQVLVKLRDSHEIRGILRSFDQHVNLLLEDAEEI 55
>pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|2FWK|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6 Snrna-
Associated Sm-Like Protein Lsm5
pdb|3PGG|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
pdb|3PGG|B Chain B, Crystal Structure Of Cryptosporidium Parvum U6
Snrna-Associated Sm- Like Protein Lsm5
Length = 121
Score = 30.4 bits (67), Expect = 0.26, Method: Compositional matrix adjust.
Identities = 11/26 (42%), Positives = 19/26 (73%)
Query: 37 RNNKKLLGRVRAFDRHCNMVLENVRE 62
+ +K+ G +R FD + NMVL++V+E
Sbjct: 46 KGDKEFSGVLRGFDEYVNMVLDDVQE 71
>pdb|2Y9A|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9A|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9B|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9C|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|A Chain A, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|H Chain H, Structure Of The Spliceosomal U4 Snrnp Core Domain
pdb|2Y9D|O Chain O, Structure Of The Spliceosomal U4 Snrnp Core Domain
Length = 95
Score = 28.5 bits (62), Expect = 1.0, Method: Compositional matrix adjust.
Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 4/61 (6%)
Query: 37 RNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSV 96
++ + +G +AFD+H N++L + E PK K ++ + R + + LRG+++
Sbjct: 22 QDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAER----EEKRVLGLVLLRGENL 77
Query: 97 I 97
+
Sbjct: 78 V 78
>pdb|1D3B|B Chain B, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|D Chain D, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|F Chain F, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|H Chain H, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|J Chain J, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
pdb|1D3B|L Chain L, Crystal Structure Of The D3b Subcomplex Of The Human
Core Snrnp Domain At 2.0a Resolution
Length = 91
Score = 28.5 bits (62), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 4/61 (6%)
Query: 37 RNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSV 96
++ + +G +AFD+H N++L + E PK K ++ + R + + LRG+++
Sbjct: 22 QDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAER----EEKRVLGLVLLRGENL 77
Query: 97 I 97
+
Sbjct: 78 V 78
>pdb|1LOJ|A Chain A, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|B Chain B, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|C Chain C, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|D Chain D, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|E Chain E, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|F Chain F, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|G Chain G, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|H Chain H, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|I Chain I, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|J Chain J, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|K Chain K, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|L Chain L, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|M Chain M, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
pdb|1LOJ|N Chain N, Crystal Structure Of A Methanobacterial Sm-Like Archaeal
Protein (Smap1) Bound To Uridine-5'-Monophosphate (Ump)
Length = 87
Score = 28.1 bits (61), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 15/70 (21%), Positives = 37/70 (52%), Gaps = 14/70 (20%)
Query: 32 VLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFL 91
V+I + +++ G +++FD H N+VL + E+ + G+ ++ + + +
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEEL-----EDGEVTRR---------LGTVLI 71
Query: 92 RGDSVIIVLR 101
RGD+++ + R
Sbjct: 72 RGDNIVYISR 81
>pdb|1JBM|A Chain A, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|B Chain B, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|C Chain C, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|D Chain D, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|E Chain E, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|F Chain F, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
pdb|1JBM|G Chain G, Heptameric Crystal Structure Of Mth649, An Sm-Like
Archaeal Protein From Methanobacterium
Thermautotrophicum
Length = 86
Score = 28.1 bits (61), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 15/70 (21%), Positives = 37/70 (52%), Gaps = 14/70 (20%)
Query: 32 VLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFL 91
V+I + +++ G +++FD H N+VL + E+ + G+ ++ + + +
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEEL-----EDGEVTRR---------LGTVLI 71
Query: 92 RGDSVIIVLR 101
RGD+++ + R
Sbjct: 72 RGDNIVYISR 81
>pdb|1JRI|A Chain A, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|B Chain B, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|C Chain C, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|D Chain D, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|E Chain E, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|F Chain F, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|G Chain G, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|H Chain H, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|I Chain I, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|J Chain J, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|K Chain K, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|L Chain L, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|M Chain M, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit.
pdb|1JRI|N Chain N, The Crystal Structure Of An Sm-Like Archaeal Protein With
Two Heptamers In The Asymmetric Unit
Length = 85
Score = 28.1 bits (61), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 15/70 (21%), Positives = 37/70 (52%), Gaps = 14/70 (20%)
Query: 32 VLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFL 91
V+I + +++ G +++FD H N+VL + E+ + G+ ++ + + +
Sbjct: 26 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEEL-----EDGEVTRR---------LGTVLI 71
Query: 92 RGDSVIIVLR 101
RGD+++ + R
Sbjct: 72 RGDNIVYISR 81
>pdb|3PGW|B Chain B, Crystal Structure Of Human U1 Snrnp
pdb|3PGW|Q Chain Q, Crystal Structure Of Human U1 Snrnp
Length = 231
Score = 28.1 bits (61), Expect = 1.5, Method: Compositional matrix adjust.
Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 4/61 (6%)
Query: 37 RNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSV 96
++ + +G +AFD+H N++L + E PK K ++ + R + + LRG+++
Sbjct: 22 QDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAER----EEKRVLGLVLLRGENL 77
Query: 97 I 97
+
Sbjct: 78 V 78
>pdb|1I81|A Chain A, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|B Chain B, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|C Chain C, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|D Chain D, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|E Chain E, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|F Chain F, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1I81|G Chain G, Crystal Structure Of A Heptameric Lsm Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|A Chain A, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|B Chain B, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|C Chain C, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|D Chain D, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|E Chain E, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|F Chain F, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
pdb|1MGQ|G Chain G, Crystal Structure Of A Heptameric Sm-Like Protein From
Methanobacterium Thermoautotrophicum
Length = 83
Score = 27.3 bits (59), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 10/32 (31%), Positives = 21/32 (65%)
Query: 32 VLINCRNNKKLLGRVRAFDRHCNMVLENVREM 63
V+I + +++ G +++FD H N+VL + E+
Sbjct: 28 VIIKLKGDREFRGVLKSFDLHMNLVLNDAEEL 59
>pdb|3CW1|A Chain A, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|H Chain H, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|I Chain I, Crystal Structure Of Human Spliceosomal U1 Snrnp
pdb|3CW1|J Chain J, Crystal Structure Of Human Spliceosomal U1 Snrnp
Length = 174
Score = 26.9 bits (58), Expect = 2.8, Method: Compositional matrix adjust.
Identities = 15/61 (24%), Positives = 33/61 (54%), Gaps = 4/61 (6%)
Query: 37 RNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFLRGDSV 96
++ + +G +AFD+H N++L + E PK K ++ + R + + LRG+++
Sbjct: 22 QDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAER----EEKRVLGLVLLRGENL 77
Query: 97 I 97
+
Sbjct: 78 V 78
>pdb|1UKM|B Chain B, Crystal Structure Of Ems16, An Antagonist Of Collagen
Receptor Integrin Alpha2beta1 (GpiaIIA)
pdb|1V7P|B Chain B, Structure Of Ems16-Alpha2-I Domain Complex
Length = 128
Score = 26.9 bits (58), Expect = 2.9, Method: Compositional matrix adjust.
Identities = 22/65 (33%), Positives = 33/65 (50%), Gaps = 10/65 (15%)
Query: 48 AFDRHCNMVLENVREMWTELP----KTGKGKKKA--LPVNKDRFISKM---FLRGDSVII 98
+FD+HC V E V+ WTE + KG + A ++ F+SK+ L+ S+ I
Sbjct: 7 SFDQHCYKVFEPVKN-WTEAEEICMQQHKGSRLASIHSSEEEAFVSKLASKALKFTSMWI 65
Query: 99 VLRNP 103
L NP
Sbjct: 66 GLNNP 70
>pdb|1I5L|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I5L|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus Complexed With Short Poly-U Rna
pdb|1I4K|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|B Chain B, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|C Chain C, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|D Chain D, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|E Chain E, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|F Chain F, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|G Chain G, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|H Chain H, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|I Chain I, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|J Chain J, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|K Chain K, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|L Chain L, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|M Chain M, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|N Chain N, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|O Chain O, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|P Chain P, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Q Chain Q, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|R Chain R, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|S Chain S, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|T Chain T, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|U Chain U, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|V Chain V, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|W Chain W, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|X Chain X, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Y Chain Y, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|Z Chain Z, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|1 Chain 1, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
pdb|1I4K|2 Chain 2, Crystal Structure Of An Sm-Like Protein (Af-Sm1) From
Archaeoglobus Fulgidus At 2.5a Resolution
Length = 77
Score = 26.2 bits (56), Expect = 4.5, Method: Compositional matrix adjust.
Identities = 16/72 (22%), Positives = 34/72 (47%), Gaps = 14/72 (19%)
Query: 32 VLINCRNNKKLLGRVRAFDRHCNMVLENVREMWTELPKTGKGKKKALPVNKDRFISKMFL 91
V++ + ++ G + +D H N+VL + E+ + G+ +K + + +
Sbjct: 17 VIVRLKGGREFRGTLDGYDIHMNLVLLDAEEI-----QNGEVVRK---------VGSVVI 62
Query: 92 RGDSVIIVLRNP 103
RGD+V+ V P
Sbjct: 63 RGDTVVFVSPAP 74
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.331 0.142 0.438
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,666,230
Number of Sequences: 62578
Number of extensions: 90353
Number of successful extensions: 205
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 190
Number of HSP's gapped (non-prelim): 17
length of query: 104
length of database: 14,973,337
effective HSP length: 69
effective length of query: 35
effective length of database: 10,655,455
effective search space: 372940925
effective search space used: 372940925
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 45 (21.9 bits)