Citrus Sinensis ID: 034075


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MAMERVAKMASERPVVIFSKSSCCICHSIKTLFCDFGVNPAVYELDEMPGGRELEQDLQRLGCSPAVPAVFIGGELVGGANQVMSLHLNRSLIPMLKRVGAIWV
cHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHcccccEEEEECcccccHHHHHHHHHHcccccccEEEEccEEEcccHHHHHHHHccccHHHHHHcccccc
*AMERVAKMASERPVVIFSKSSCCICHSIKTLFCDFGVNPAVYELDEMPGGRELEQDLQRLGCSPAVPAVFIGGELVGGANQVMSLHLNRSLIPMLKRVGAIWV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMERVAKMASERPVVIFSKSSCCICHSIKTLFCDFGVNPAVYELDEMPGGRELEQDLQRLGCSPAVPAVFIGGELVGGANQVMSLHLNRSLIPMLKRVGAIWV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Monothiol glutaredoxin-S2 May only reduce GSH-thiol disulfides, but not protein disulfides.confidentQ8L8Z8
Glutaredoxin-C1 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.probableQ7G8Y5
Monothiol glutaredoxin-S5 May only reduce GSH-thiol disulfides, but not protein disulfides.probableO23420

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KTE, chain A
Confidence level:very confident
Coverage over the Query: 2-103
View the alignment between query and template
View the model in PyMOL