Query         034078
Match_columns 104
No_of_seqs    110 out of 198
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 09:32:33 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034078.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034078hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02704 GASA:  Gibberellin reg 100.0 1.3E-37 2.7E-42  203.4   5.3   60   45-104     1-60  (60)
  2 PF07172 GRP:  Glycine rich pro  93.6    0.15 3.3E-06   35.5   4.4   25    1-27      1-26  (95)
  3 PF15128 T_cell_tran_alt:  T-ce  77.3     2.5 5.4E-05   30.1   2.6   19    6-25     28-46  (92)
  4 PF09257 BCMA-Tall_bind:  BCMA,  64.0     6.2 0.00013   24.1   1.9   21   49-69     16-36  (39)
  5 PF03058 Sar8_2:  Sar8.2 family  51.6      22 0.00047   25.4   3.3   22    8-29      8-29  (93)
  6 PLN02708 Probable pectinestera  44.5      53  0.0011   29.2   5.2   22   45-66     42-63  (553)
  7 PF10690 Myticin-prepro:  Mytic  32.6      23 0.00049   25.5   1.0   17   42-58     21-38  (98)
  8 PF07127 Nodulin_late:  Late no  31.9      55  0.0012   20.0   2.5   16    1-17      1-16  (54)
  9 PF07699 GCC2_GCC3:  GCC2 and G  31.1      62  0.0013   19.0   2.6   28   73-100    10-41  (48)
 10 PF10717 ODV-E18:  Occlusion-de  29.8 1.2E+02  0.0025   21.4   4.1    7   20-26     40-46  (85)
 11 PF01826 TIL:  Trypsin Inhibito  25.4     2.8 6.1E-05   25.2  -4.1   38   45-86      9-46  (55)
 12 PF15330 SIT:  SHP2-interacting  25.4      90   0.002   22.1   3.0   12   85-96     43-54  (107)
 13 PRK09510 tolA cell envelope in  24.1 1.6E+02  0.0034   25.4   4.7   13    7-19     13-25  (387)
 14 PF10731 Anophelin:  Thrombin i  23.9 1.4E+02   0.003   20.1   3.4   19    6-26      3-21  (65)
 15 PF11912 DUF3430:  Protein of u  23.7      69  0.0015   23.4   2.2   16    7-23      2-17  (212)
 16 PF15079 DUF4546:  Domain of un  22.7      29 0.00063   27.6   0.1   22   61-82    167-189 (205)
 17 PLN02713 Probable pectinestera  22.4 1.3E+02  0.0029   26.9   4.1   14   53-66     38-51  (566)
 18 PF15240 Pro-rich:  Proline-ric  22.4      74  0.0016   24.9   2.2    7   20-26     10-16  (179)

No 1  
>PF02704 GASA:  Gibberellin regulated protein;  InterPro: IPR003854 This is the GASA gibberellin regulated cysteine rich protein family. The expression of these proteins is up-regulated by the plant hormone gibberellin, most of these proteins have some role in plant development. There are 12 cysteine residues conserved within the alignment giving the potential for these proteins to posses 6 disulphide bonds.
Probab=100.00  E-value=1.3e-37  Score=203.42  Aligned_cols=60  Identities=65%  Similarity=1.459  Sum_probs=59.4

Q ss_pred             CchHHHhHHhhcCCCCchHHHHHhHhcCcccccCCCCCCCCCCCCccccccccCCCCCCC
Q 034078           45 DCGAACKARCQLSSRPNLCHRACGTCCARCKCVPPGTSGHLEVCPCYATMTTHHGRRKCP  104 (104)
Q Consensus        45 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GT~Gnk~~CpCY~~m~t~~g~~KCP  104 (104)
                      ||+++|++||++++++++|+|+||+||++|+|||||||||+|+||||+||+||+|+||||
T Consensus         1 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GT~gn~~~CpCY~~m~t~~g~pKCP   60 (60)
T PF02704_consen    1 DCGGACSVRCSKASRKKRCMRACGTCCAKCKCVPPGTYGNKEECPCYRDMKTHGGKPKCP   60 (60)
T ss_pred             CcchHHHHHHhccCCchHHHHHHHHHhccCcccCCCCCCCCccCCChhhhhccCCCCCCc
Confidence            799999999999999999999999999999999999999999999999999999999999


No 2  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=93.60  E-value=0.15  Score=35.51  Aligned_cols=25  Identities=32%  Similarity=0.351  Sum_probs=13.2

Q ss_pred             CcchhhHHHHH-HHHHHHHHHHHHHHhh
Q 034078            1 MAISSSKAFIA-SVLLSLILVLHLVAAD   27 (104)
Q Consensus         1 MA~~~sk~li~-~ll~sll~~l~lv~a~   27 (104)
                      ||.  -++|++ ++|++|||+.+.|.|.
T Consensus         1 MaS--K~~llL~l~LA~lLlisSevaa~   26 (95)
T PF07172_consen    1 MAS--KAFLLLGLLLAALLLISSEVAAR   26 (95)
T ss_pred             Cch--hHHHHHHHHHHHHHHHHhhhhhH
Confidence            773  333333 4455555466666663


No 3  
>PF15128 T_cell_tran_alt:  T-cell leukemia translocation-altered
Probab=77.34  E-value=2.5  Score=30.07  Aligned_cols=19  Identities=32%  Similarity=0.478  Sum_probs=16.7

Q ss_pred             hHHHHHHHHHHHHHHHHHHH
Q 034078            6 SKAFIASVLLSLILVLHLVA   25 (104)
Q Consensus         6 sk~li~~ll~sll~~l~lv~   25 (104)
                      +|+|+.+|++||+ .+|+.=
T Consensus        28 fkllL~WlvlsLl-~I~lAW   46 (92)
T PF15128_consen   28 FKLLLGWLVLSLL-AIHLAW   46 (92)
T ss_pred             HHHHHHHHHHHHH-HHHHHH
Confidence            8999999999998 888754


No 4  
>PF09257 BCMA-Tall_bind:  BCMA, TALL-1 binding;  InterPro: IPR015337 Cytokines can be grouped into a family on the basis of sequence, functional and structural similarities [, , ]. Tumor necrosis factor (TNF) (also known as TNF-alpha or cachectin) is a monocyte-derived cytotoxin that has been implicated in tumour regression, septic shock and cachexia [, ]. The protein is synthesised as a prohormone with an unusually long and atypical signal sequence, which is absent from the mature secreted cytokine []. A short hydrophobic stretch of amino acids serves to anchor the prohormone in lipid bilayers []. Both the mature protein and a partially-processed form of the hormone are secreted after cleavage of the propeptide []. There are a number of different families of TNF, but all these cytokines seem to form homotrimeric (or heterotrimeric in the case of LT-alpha/beta) complexes that are recognised by their specific receptors.  Members of this entry, which are predominantly found in the tumour necrosis factor receptor superfamily member 17, BCMA, are required for binding to tumour necrosis factor ligand TALL-1 []. ; PDB: 2KN1_A 1OQD_R 1XU2_T.
Probab=64.05  E-value=6.2  Score=24.13  Aligned_cols=21  Identities=33%  Similarity=0.890  Sum_probs=16.6

Q ss_pred             HHhHHhhcCCCCchHHHHHhH
Q 034078           49 ACKARCQLSSRPNLCHRACGT   69 (104)
Q Consensus        49 ~C~~RCs~~~~~~~C~~~C~~   69 (104)
                      -|--|||+..-+-.|.+||+.
T Consensus        16 PChLRCsn~tPP~~Cq~YCna   36 (39)
T PF09257_consen   16 PCHLRCSNNTPPLPCQRYCNA   36 (39)
T ss_dssp             EHHHHHTSSS--TTTHHHHHH
T ss_pred             cceeecCCCCCCccchhhccc
Confidence            388999998888899999985


No 5  
>PF03058 Sar8_2:  Sar8.2 family;  InterPro: IPR004297 Members of this family are found in Solanaceae spp. plants, a taxonomic group (family) that includes pepper and tobacco plant species. Synthesis of these proteins is induced by Tobacco mosaic virus and salicylic acid []; indeed they are thought to be involved in the development of systemic acquired resistance (SAR) after an initial hypersensitive response to microbial infection [, ]. SAR is characterised by long-lasting resistance to infection by a wide range of pathogens, extending to plant tissues distant from the initial infection site [].
Probab=51.64  E-value=22  Score=25.40  Aligned_cols=22  Identities=23%  Similarity=0.314  Sum_probs=12.2

Q ss_pred             HHHHHHHHHHHHHHHHHHhhcc
Q 034078            8 AFIASVLLSLILVLHLVAADQM   29 (104)
Q Consensus         8 ~li~~ll~sll~~l~lv~a~~~   29 (104)
                      +|.+||-|.|++..+.|.|-++
T Consensus         8 fl~lSLailLmIISSqv~AREm   29 (93)
T PF03058_consen    8 FLCLSLAILLMIISSQVDAREM   29 (93)
T ss_pred             HHHHHHHHHHHHHhhHHHHHHH
Confidence            4555554555545557776444


No 6  
>PLN02708 Probable pectinesterase/pectinesterase inhibitor
Probab=44.47  E-value=53  Score=29.24  Aligned_cols=22  Identities=14%  Similarity=0.327  Sum_probs=16.8

Q ss_pred             CchHHHhHHhhcCCCCchHHHH
Q 034078           45 DCGAACKARCQLSSRPNLCHRA   66 (104)
Q Consensus        45 ~C~~~C~~RCs~~~~~~~C~~~   66 (104)
                      .=+..=..-|+.+.+++.|...
T Consensus        42 ~~~~~I~s~C~~T~YP~lC~sS   63 (553)
T PLN02708         42 STPPQILLACNATRFPDTCVSS   63 (553)
T ss_pred             CccHHHHHhccCCCCcHHHHHH
Confidence            3455666779999999999875


No 7  
>PF10690 Myticin-prepro:  Myticin pre-proprotein from the mussel;  InterPro: IPR019631  Myticin is a cysteine-rich peptide produced in three isoforms, A, B and C, by Mytilus galloprovincialis (Mediterranean mussel). Isoforms A and B show antibacterial activity against Gram-positive bacteria, while isoform B is additionally active against the fungus Fusarium oxysporum and a Gram-negative bacterium, Escherichia coli (streptomycin resistant strain D31) []. Myticin-prepro is the precursor peptide. The mature molecule, named myticin, consists of 40 residues, with four intramolecular disulphide bridges and a cysteine array in the primary structure different from that of previously characterised cysteine-rich antimicrobial peptides. The first 20 amino acids are a putative signal peptide, and the antimicrobial peptide sequence is a 36-residue C-terminal extension. Such a structure suggests that myticins are synthesised as prepro-proteins that are then processed by various proteolytic events before storage in the haemocytes as the active peptide. Myticin precursors are expressed mainly in the haemocytes. ; PDB: 2EEM_A.
Probab=32.64  E-value=23  Score=25.51  Aligned_cols=17  Identities=29%  Similarity=0.696  Sum_probs=9.5

Q ss_pred             CCCCchHH-HhHHhhcCC
Q 034078           42 PTIDCGAA-CKARCQLSS   58 (104)
Q Consensus        42 ~~~~C~~~-C~~RCs~~~   58 (104)
                      +.+.|.+. |+.+|..++
T Consensus        21 ~s~~CtS~yC~~fCgsa~   38 (98)
T PF10690_consen   21 QSISCTSYYCKKFCGSAR   38 (98)
T ss_dssp             ----HHHH-HHHHHHHTT
T ss_pred             cccccchhHHHHhcCCCC
Confidence            34468887 888887543


No 8  
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=31.89  E-value=55  Score=20.04  Aligned_cols=16  Identities=25%  Similarity=0.121  Sum_probs=9.0

Q ss_pred             CcchhhHHHHHHHHHHH
Q 034078            1 MAISSSKAFIASVLLSL   17 (104)
Q Consensus         1 MA~~~sk~li~~ll~sl   17 (104)
                      ||-+ -|++-+.|++..
T Consensus         1 Ma~i-lKFvY~mIifls   16 (54)
T PF07127_consen    1 MAKI-LKFVYAMIIFLS   16 (54)
T ss_pred             Cccc-hhhHHHHHHHHH
Confidence            6665 676666444433


No 9  
>PF07699 GCC2_GCC3:  GCC2 and GCC3;  InterPro: IPR011641 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].   This entry represents various ephrin type A and B receptors, which have tyrosine kinase activity.
Probab=31.08  E-value=62  Score=19.00  Aligned_cols=28  Identities=32%  Similarity=0.600  Sum_probs=20.1

Q ss_pred             cccccCCCCCCCC---CCC-CccccccccCCC
Q 034078           73 RCKCVPPGTSGHL---EVC-PCYATMTTHHGR  100 (104)
Q Consensus        73 ~C~CVP~GT~Gnk---~~C-pCY~~m~t~~g~  100 (104)
                      .|.=.|.|||-+.   .+| +|-.+..|...+
T Consensus        10 ~C~~Cp~GtYq~~~g~~~C~~Cp~g~~T~~~G   41 (48)
T PF07699_consen   10 KCQPCPKGTYQDEEGQTSCTPCPPGSTTSSEG   41 (48)
T ss_pred             ccCCCCCCccCCccCCccCccCcCCCccCCcC
Confidence            4555689999854   579 899998875443


No 10 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=29.83  E-value=1.2e+02  Score=21.39  Aligned_cols=7  Identities=14%  Similarity=0.396  Sum_probs=2.9

Q ss_pred             HHHHHHh
Q 034078           20 VLHLVAA   26 (104)
Q Consensus        20 ~l~lv~a   26 (104)
                      ++-|+|.
T Consensus        40 lImlfqs   46 (85)
T PF10717_consen   40 LIMLFQS   46 (85)
T ss_pred             HHHHHhc
Confidence            3334444


No 11 
>PF01826 TIL:  Trypsin Inhibitor like cysteine rich domain;  InterPro: IPR002919 This domain is found in proteinase inhibitors as well as in many extracellular proteins. The domain typically contains ten cysteine residues that form five disulphide bonds. The cysteine residues that form the disulphide bonds are 1-7, 2-6, 3-5, 4-10 and 8-9. This inhibitor domain belongs to MEROPS inhibitor family I8 (clan IA). Proteins containing this domain inhibit peptidases belonging to families S1 (IPR001254 from INTERPRO), S8 (IPR000209 from INTERPRO), and M4 (IPR001570 from INTERPRO) [] and are restricted to the chordata, nematoda, arthropoda and echinodermata. Examples of proteins containing this domain are:  chymotrypsin/elastase inhibitor from Ascaris suum (pig roundworm) Acp62F protein from Drosophila melanogaster  Bombina trypsin inhibitor from Bombina maxima (large-webbed bell toad) Bombyx subtilisin inhibitor from Bombyx mori (silk moth) von Willebrand factor ; PDB: 2P3F_N 1HX2_A 1CCV_A 1EAI_D 2H9E_C 1COU_A 1ATE_A 1ATB_A 1ATD_A 1ATA_A ....
Probab=25.45  E-value=2.8  Score=25.18  Aligned_cols=38  Identities=32%  Similarity=0.942  Sum_probs=25.8

Q ss_pred             CchHHHhHHhhcCCCCchHHHHHhHhcCcccccCCCCCCCCC
Q 034078           45 DCGAACKARCQLSSRPNLCHRACGTCCARCKCVPPGTSGHLE   86 (104)
Q Consensus        45 ~C~~~C~~RCs~~~~~~~C~~~C~~CC~~C~CVP~GT~Gnk~   86 (104)
                      +|++.|...|+.......|..   .|=.-|.| |+|++-|.+
T Consensus         9 ~C~~~C~~tC~~~~~~~~C~~---~C~~gC~C-~~G~v~~~~   46 (55)
T PF01826_consen    9 ECGSPCPRTCDNPNNPEPCSE---PCVEGCFC-PPGYVRNDN   46 (55)
T ss_dssp             SSETSTTCBSSCTTTSSSCSS---S-ESEEEE-TTTEEEETT
T ss_pred             cccCCcCCcCCCCCCCcCcCC---CCCccCCC-CCCeeEcCC
Confidence            688899999998777766663   33344667 567765544


No 12 
>PF15330 SIT:  SHP2-interacting transmembrane adaptor protein, SIT
Probab=25.43  E-value=90  Score=22.11  Aligned_cols=12  Identities=33%  Similarity=0.708  Sum_probs=6.3

Q ss_pred             CCCCCccccccc
Q 034078           85 LEVCPCYATMTT   96 (104)
Q Consensus        85 k~~CpCY~~m~t   96 (104)
                      .|+=|||.|+..
T Consensus        43 ~E~~p~YgNL~~   54 (107)
T PF15330_consen   43 TEDDPCYGNLEL   54 (107)
T ss_pred             CCCCcccccccc
Confidence            344456666544


No 13 
>PRK09510 tolA cell envelope integrity inner membrane protein TolA; Provisional
Probab=24.13  E-value=1.6e+02  Score=25.40  Aligned_cols=13  Identities=54%  Similarity=0.802  Sum_probs=7.0

Q ss_pred             HHHHHHHHHHHHH
Q 034078            7 KAFIASVLLSLIL   19 (104)
Q Consensus         7 k~li~~ll~sll~   19 (104)
                      +.|+++|++.+||
T Consensus        13 ~aiiiSv~LHvlL   25 (387)
T PRK09510         13 RAIIISVVLHIIL   25 (387)
T ss_pred             hHHHHHHHHHHHH
Confidence            3455566665553


No 14 
>PF10731 Anophelin:  Thrombin inhibitor from mosquito;  InterPro: IPR018932  Members of this family are all inhibitors of thrombin, the peptidase that is at the end of the blood coagulation cascade and which creates the clot by cleaving fibrinogen. The interaction between thrombin and fibrinogen involves two different areas of contact - via the thrombin active site and via a second substrate-binding site known as an exosite. The inhibitor acts by blocking the exosite, rather than by interacting with the active site. The inhibitors are from mosquitoes that feed on human blood and which, by inhibiting thrombin, prevent the blood from clotting and keep it flowing. 
Probab=23.90  E-value=1.4e+02  Score=20.12  Aligned_cols=19  Identities=26%  Similarity=0.401  Sum_probs=9.4

Q ss_pred             hHHHHHHHHHHHHHHHHHHHh
Q 034078            6 SKAFIASVLLSLILVLHLVAA   26 (104)
Q Consensus         6 sk~li~~ll~sll~~l~lv~a   26 (104)
                      +|++++++|-..| +. +||+
T Consensus         3 ~Kl~vialLC~aL-va-~vQ~   21 (65)
T PF10731_consen    3 SKLIVIALLCVAL-VA-IVQS   21 (65)
T ss_pred             chhhHHHHHHHHH-HH-HHhc
Confidence            3665555444433 22 6665


No 15 
>PF11912 DUF3430:  Protein of unknown function (DUF3430);  InterPro: IPR021837  This family of proteins are functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 209 to 265 amino acids in length. 
Probab=23.69  E-value=69  Score=23.37  Aligned_cols=16  Identities=31%  Similarity=0.671  Sum_probs=7.4

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 034078            7 KAFIASVLLSLILVLHL   23 (104)
Q Consensus         7 k~li~~ll~sll~~l~l   23 (104)
                      |+|+.+||+.++ ++.+
T Consensus         2 Kll~~lilli~~-~~~~   17 (212)
T PF11912_consen    2 KLLISLILLILL-IINF   17 (212)
T ss_pred             cHHHHHHHHHHH-HHhh
Confidence            455444444444 4444


No 16 
>PF15079 DUF4546:  Domain of unknown function (DUF4546)
Probab=22.69  E-value=29  Score=27.65  Aligned_cols=22  Identities=27%  Similarity=0.718  Sum_probs=16.4

Q ss_pred             chHHHHHhHhcCcc-cccCCCCC
Q 034078           61 NLCHRACGTCCARC-KCVPPGTS   82 (104)
Q Consensus        61 ~~C~~~C~~CC~~C-~CVP~GT~   82 (104)
                      -..+-.|++||++| .|..-.+|
T Consensus       167 ld~lH~C~tCcekcllCalk~n~  189 (205)
T PF15079_consen  167 LDSLHQCRTCCEKCLLCALKNNY  189 (205)
T ss_pred             Ccchhhchhhhhhhhhhhccccc
Confidence            34667799999999 58766554


No 17 
>PLN02713 Probable pectinesterase/pectinesterase inhibitor
Probab=22.42  E-value=1.3e+02  Score=26.90  Aligned_cols=14  Identities=21%  Similarity=0.776  Sum_probs=10.1

Q ss_pred             HhhcCCCCchHHHH
Q 034078           53 RCQLSSRPNLCHRA   66 (104)
Q Consensus        53 RCs~~~~~~~C~~~   66 (104)
                      -|+.+.+++.|...
T Consensus        38 ~C~~T~YP~~C~ss   51 (566)
T PLN02713         38 ICNTTPDPSFCKSV   51 (566)
T ss_pred             ccCCCCChHHHHHH
Confidence            46777788888764


No 18 
>PF15240 Pro-rich:  Proline-rich
Probab=22.35  E-value=74  Score=24.89  Aligned_cols=7  Identities=43%  Similarity=0.548  Sum_probs=2.9

Q ss_pred             HHHHHHh
Q 034078           20 VLHLVAA   26 (104)
Q Consensus        20 ~l~lv~a   26 (104)
                      ||.|..|
T Consensus        10 LLALSSA   16 (179)
T PF15240_consen   10 LLALSSA   16 (179)
T ss_pred             HHHhhhc
Confidence            3444443


Done!