Citrus Sinensis ID: 034084

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MANTMARSFLQVAAAEEVAPPLRVVQIEGLVMLKIIKHCKEFSPALVTGQLLGLDVGSVLEVTNCFPFPIQEEDEEIEADGANYQLEMMRCLREVNVDNNTVGW
ccccccHHHHHHHccccccccccEEEEEHHHHHHHHHHHHHccccEEEEEEEEEECccEEEEEECccccccccccccccccHHHHHHHHHHHHHHccccccccc
*******************PPLRVVQIEGLVMLKIIKHCKEFSPALVTGQLLGLDVGSVLEVTNCFPFPIQEEDEEIEADGANYQLEMMRCLREVNVDNNTVGW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANTMARSFLQVAAAEEVAPPLRVVQIEGLVMLKIIKHCKEFSPALVTGQLLGLDVGSVLEVTNCFPFPIQEEDEEIEADGANYQLEMMRCLREVNVDNNTVGW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 3 subunit H Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome.probableQ9C5Z2

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain V
Confidence level:very confident
Coverage over the Query: 18-104
View the alignment between query and template
View the model in PyMOL