Query         034094
Match_columns 104
No_of_seqs    104 out of 179
Neff          7.1 
Searched_HMMs 46136
Date          Fri Mar 29 09:42:43 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034094.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034094hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0721 Molecular chaperone (D 100.0 2.8E-31 6.1E-36  191.2   5.4  102    1-104     4-105 (230)
  2 COG5407 SEC63 Preprotein trans  99.8   4E-21 8.7E-26  150.8   4.3   97    3-104     6-104 (610)
  3 COG2991 Uncharacterized protei  76.8     4.4 9.6E-05   24.9   3.3   15   41-55     42-57  (77)
  4 PF03579 SHP:  Small hydrophobi  75.7     2.8 6.1E-05   24.7   2.1   20    6-25     10-29  (64)
  5 PF03622 IBV_3B:  IBV 3B protei  73.6     1.9 4.2E-05   25.5   1.1   17   86-103    23-39  (64)
  6 PF08592 DUF1772:  Domain of un  72.5      10 0.00022   24.7   4.5   75    8-83     63-137 (139)
  7 KOG3672 Histidine acid phospha  65.4       4 8.7E-05   32.8   1.6   52   45-104   249-301 (487)
  8 COG4420 Predicted membrane pro  54.9      16 0.00034   26.4   3.0    7   96-102    82-88  (191)
  9 KOG0510 Ankyrin repeat protein  49.2      32 0.00069   30.3   4.4   25    8-32    505-529 (929)
 10 PF06298 PsbY:  Photosystem II   45.9      33 0.00072   18.2   2.7   17   71-87     11-27  (36)
 11 PF12955 DUF3844:  Domain of un  43.8      29 0.00064   22.6   2.7   30    5-34     63-92  (103)
 12 PRK13240 pbsY photosystem II p  42.8      22 0.00047   19.3   1.7   17   72-88     12-28  (40)
 13 PF06210 DUF1003:  Protein of u  42.1      46 0.00099   21.7   3.5    7   96-102    28-34  (108)
 14 PF11027 DUF2615:  Protein of u  41.8      32  0.0007   22.4   2.7   19   70-88     54-72  (103)
 15 PF03967 PRCH:  Photosynthetic   41.4      42 0.00091   23.0   3.3   22   70-91     13-34  (136)
 16 COG3924 Predicted membrane pro  40.0      22 0.00048   21.9   1.6   15   70-84     18-32  (80)
 17 PF04911 ATP-synt_J:  ATP synth  39.0      24 0.00053   20.4   1.6   15   10-24     10-24  (54)
 18 CHL00196 psbY photosystem II p  38.4      53  0.0011   17.4   2.7   17   71-87     11-27  (36)
 19 PF04583 Baculo_p74:  Baculovir  37.7      37 0.00081   25.5   2.8   23   75-102   106-128 (249)
 20 PF14004 DUF4227:  Protein of u  37.1      84  0.0018   19.1   3.9   31   70-102     8-38  (71)
 21 PF15176 LRR19-TM:  Leucine-ric  36.7      43 0.00092   21.8   2.6   27    4-30     10-36  (102)
 22 PF07172 GRP:  Glycine rich pro  36.3      53  0.0011   20.9   3.0   20   70-89      5-24  (95)
 23 COG1288 Predicted membrane pro  34.2 1.9E+02  0.0042   23.8   6.5   20   70-89    275-294 (481)
 24 PF06459 RR_TM4-6:  Ryanodine R  33.5      52  0.0011   25.0   3.1   28   67-95    172-200 (274)
 25 PF06422 PDR_CDR:  CDR ABC tran  33.4      61  0.0013   20.6   3.0   20   70-89     50-69  (103)
 26 PRK13183 psbN photosystem II r  33.2      56  0.0012   18.3   2.4   31   72-102    10-42  (46)
 27 PF12686 DUF3800:  Protein of u  32.7       3 6.6E-05   28.8  -3.5   16    4-19      4-27  (235)
 28 PF09878 DUF2105:  Predicted me  32.7      23 0.00049   25.9   1.0   23    7-29    164-186 (212)
 29 TIGR03778 VPDSG_CTERM VPDSG-CT  32.4      43 0.00093   16.5   1.6   18    6-23      3-20  (26)
 30 PF12273 RCR:  Chitin synthesis  31.9      29 0.00064   22.9   1.4   24   11-34      2-25  (130)
 31 KOG0863 20S proteasome, regula  31.4      16 0.00036   27.3   0.1   10    1-10    134-143 (264)
 32 PF02468 PsbN:  Photosystem II   29.8   1E+02  0.0023   16.9   3.2   26   77-102    12-39  (43)
 33 CHL00020 psbN photosystem II p  29.5      52  0.0011   18.1   1.8   29   74-102     9-39  (43)
 34 COG0713 NuoK NADH:ubiquinone o  27.9      36 0.00077   22.1   1.2   17    4-20     54-70  (100)
 35 PRK14584 hmsS hemin storage sy  27.3      77  0.0017   22.1   2.9   19   70-88     18-36  (153)
 36 PF15128 T_cell_tran_alt:  T-ce  26.3 1.3E+02  0.0028   19.1   3.4   18   70-87     26-43  (92)
 37 PHA00024 IX minor coat protein  25.4 1.1E+02  0.0024   15.8   2.8   16   71-86      9-24  (33)
 38 PF04505 Dispanin:  Interferon-  24.8      72  0.0016   19.5   2.1   19   14-32     19-39  (82)
 39 PF03311 Cornichon:  Cornichon   24.7 1.9E+02  0.0041   19.2   4.3   24    8-31      3-27  (128)
 40 PF01542 HCV_core:  Hepatitis C  24.7      57  0.0012   19.9   1.6   19    8-26     56-74  (75)
 41 COG3083 Predicted hydrolase of  24.4      50  0.0011   27.7   1.7   24   11-34     61-84  (600)
 42 TIGR01150 puhA photosynthetic   24.3      94   0.002   23.4   3.0   21   70-90     13-33  (252)
 43 TIGR02736 cbb3_Q_epsi cytochro  24.0      79  0.0017   18.4   2.0   23   11-33      2-24  (56)
 44 PF05478 Prominin:  Prominin;    23.7 1.1E+02  0.0025   26.4   3.8   18   14-31     97-114 (806)
 45 cd00226 PRCH Photosynthetic re  23.7      98  0.0021   23.3   3.0   20   70-89     13-32  (246)
 46 PF15105 TMEM61:  TMEM61 protei  23.0      90  0.0019   22.4   2.6   26   77-102    66-91  (198)
 47 PF09125 COX2-transmemb:  Cytoc  23.0 1.1E+02  0.0024   16.3   2.3   19   10-28     15-33  (38)
 48 PF14373 Imm_superinfect:  Supe  22.2 1.5E+02  0.0032   16.2   2.9   16   71-86     22-37  (43)
 49 PRK10726 hypothetical protein;  22.1      83  0.0018   20.6   2.1   13   72-84     90-102 (105)
 50 KOG0140 Medium-chain acyl-CoA   21.7      35 0.00076   27.0   0.3    9    1-9      51-59  (408)
 51 PF07672 MFS_Mycoplasma:  Mycop  21.6 1.5E+02  0.0033   22.5   3.7   24   11-34     40-63  (267)
 52 PF06596 PsbX:  Photosystem II   21.6      89  0.0019   16.8   1.8   12   20-31     17-28  (39)
 53 PF05434 Tmemb_9:  TMEM9;  Inte  21.5      15 0.00032   25.5  -1.6   14   72-85     57-70  (149)
 54 COG5264 VTC1 Vacuolar transpor  21.1 1.4E+02   0.003   20.2   3.1   25   74-99     73-98  (126)
 55 PF11057 Cortexin:  Cortexin of  20.9      75  0.0016   19.7   1.6   19    5-23     25-43  (81)
 56 PF02937 COX6C:  Cytochrome c o  20.8      72  0.0016   19.4   1.5   33   70-102    19-58  (73)
 57 PF04341 DUF485:  Protein of un  20.8 1.3E+02  0.0028   18.6   2.8   18   70-87     59-76  (91)
 58 PRK07899 rpsA 30S ribosomal pr  20.6      42 0.00091   27.4   0.6    9    2-10    385-393 (486)
 59 PF14475 Mso1_Sec1_bdg:  Sec1-b  20.4      29 0.00063   18.9  -0.3   11    3-13     29-39  (41)
 60 PHA02955 hypothetical protein;  20.2      79  0.0017   23.3   1.9   28    8-35    176-203 (213)
 61 PF05461 ApoL:  Apolipoprotein   20.2      50  0.0011   25.5   0.9   14   15-28    111-124 (313)
 62 PRK10873 hypothetical protein;  20.1 1.2E+02  0.0026   20.4   2.6   20   70-89    105-124 (131)

No 1  
>KOG0721 consensus Molecular chaperone (DnaJ superfamily) [Posttranslational modification, protein turnover, chaperones]
Probab=99.97  E-value=2.8e-31  Score=191.18  Aligned_cols=102  Identities=25%  Similarity=0.466  Sum_probs=82.4

Q ss_pred             CCccccCCCchhHHHHHHHhhhhhhhhhhhhhccccccccccccccccchhhHHHHHHHhhhccCcchhHHHHHHHHHHH
Q 034094            1 MAATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVI   80 (104)
Q Consensus         1 ~~~YDE~g~~f~yFvlt~l~lvLiP~T~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~k~~~~~~~~~~i~lv~gW~l   80 (104)
                      |.||||+|+|||||+||+++++++|+||.++++...+.....+|||.+|.+++...++..+ + .++..+++++++||++
T Consensus         4 ~~eYDE~g~tf~yflls~~~~i~~P~Ty~~i~~~~~~~~~~~~c~c~~c~~~r~~~~~~~~-k-~~~~~~~i~lv~~W~v   81 (230)
T KOG0721|consen    4 DYEYDESGNTFPYFLLSFLAIILLPMTYLLIPRNPEPPKRKEECQCHGCDKKRRKKAKVSP-K-SISTKRKVFLVVGWAV   81 (230)
T ss_pred             ccccccccCccHHHHHHHHHHHHHHHHHHHhccccchhhhhhHHhhhhhhhhhhhhcccCc-c-cchhHHHHHHHHHHHH
Confidence            5799999999999999999999999999999853222222468999999887654333322 2 3333399999999999


Q ss_pred             HHHHHHHHHhcccccCccCCcccC
Q 034094           81 MIILIYYIKSTSREVWNMGPQIQI  104 (104)
Q Consensus        81 ~~~L~y~i~~~~~~~~~fDPyei~  104 (104)
                      +++|+|+|++++++.+.||||||+
T Consensus        82 ~~fL~y~i~~~~~~~~~fDPyEIL  105 (230)
T KOG0721|consen   82 IAFLIYKIMNSRRERQKFDPYEIL  105 (230)
T ss_pred             HHHHHHHHhhhhHHhhcCCcHHhh
Confidence            999999999999888999999996


No 2  
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion]
Probab=99.82  E-value=4e-21  Score=150.80  Aligned_cols=97  Identities=21%  Similarity=0.364  Sum_probs=76.7

Q ss_pred             ccccCCCchhHHHHHHHhhhhhhhhhhhhhcccccc-ccccccccccchhhHHHHHHHhhhccCcchhHHHHHHHHHHHH
Q 034094            3 ATEENSQLFPIFILTIMALPLVPYTILKLCHAFSKK-IKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIM   81 (104)
Q Consensus         3 ~YDE~g~~f~yFvlt~l~lvLiP~T~~~l~~~~~~~-~~~~~~~~~~~~~~~~~i~~~~k~~~~~~~~~~i~lv~gW~l~   81 (104)
                      ||||+|.+||||+|+.+.++..|+||..+-+....+ ....+|.|+.|..+..+  .+||  +.++. |++++++||.++
T Consensus         6 eYDE~g~~~p~fvL~gl~~vvlpmTY~~i~gpsaSKe~~~vr~~~q~~Rpkdkn--v~rK--SIf~l-R~If~ivgWl~i   80 (610)
T COG5407           6 EYDESGLASPYFVLSGLVPVVLPMTYDLIEGPSASKELRRVRCACQGCRPKDKN--VSRK--SIFKL-RKIFTIVGWLVI   80 (610)
T ss_pred             ccccccccchHHHHhhhhheeeeeehhheeCCcccchhhcchhhhhhcCccccc--hhhh--HHHhh-hHHHHHHHHHHH
Confidence            899999999999999999999999998886553332 33567888888754432  2222  32234 999999999999


Q ss_pred             HHHHHHHHhccccc-CccCCcccC
Q 034094           82 IILIYYIKSTSREV-WNMGPQIQI  104 (104)
Q Consensus        82 ~~L~y~i~~~~~~~-~~fDPyei~  104 (104)
                      ++|.|+|.+.+.+. +.||||||+
T Consensus        81 ~~L~~~I~~~k~~~~~~fDPyEIL  104 (610)
T COG5407          81 SYLISNIRTLKIEYRRGFDPYEIL  104 (610)
T ss_pred             HHHHHHHHHHHHHHHcCCChHHhh
Confidence            99999999777776 899999996


No 3  
>COG2991 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=76.82  E-value=4.4  Score=24.92  Aligned_cols=15  Identities=27%  Similarity=0.749  Sum_probs=8.3

Q ss_pred             cccccccc-chhhHHH
Q 034094           41 TIHCQCSD-CARSGKY   55 (104)
Q Consensus        41 ~~~~~~~~-~~~~~~~   55 (104)
                      ++.|.|+. |..+.++
T Consensus        42 ~K~CdC~~pCDt~~~k   57 (77)
T COG2991          42 EKVCDCDEPCDTHKKK   57 (77)
T ss_pred             chhcCCCCchHHHHHh
Confidence            34577765 5554443


No 4  
>PF03579 SHP:  Small hydrophobic protein;  InterPro: IPR005327 The small hydrophobic integral membrane protein, SH (previously designated 1A) is found to have a variety of glycosylated forms [, ]. This protein is a component of the mature respiratory syncytial virion [] where it may form complexes and appears to play a structural role.; GO: 0016020 membrane, 0016021 integral to membrane, 0048222 glycoprotein network
Probab=75.75  E-value=2.8  Score=24.71  Aligned_cols=20  Identities=25%  Similarity=0.326  Sum_probs=14.2

Q ss_pred             cCCCchhHHHHHHHhhhhhh
Q 034094            6 ENSQLFPIFILTIMALPLVP   25 (104)
Q Consensus         6 E~g~~f~yFvlt~l~lvLiP   25 (104)
                      -+|.+||||-|.+..+.++-
T Consensus        10 FtskFW~YFtLi~M~lti~~   29 (64)
T PF03579_consen   10 FTSKFWTYFTLIFMMLTIGF   29 (64)
T ss_pred             eccccchHHHHHHHHHHHHH
Confidence            36899999987766554443


No 5  
>PF03622 IBV_3B:  IBV 3B protein ;  InterPro: IPR005295 These proteins are the product of ORF 3B from Infectious bronchitis virus). Currently, the function of this protein remains unknown [].
Probab=73.63  E-value=1.9  Score=25.49  Aligned_cols=17  Identities=12%  Similarity=-0.099  Sum_probs=11.3

Q ss_pred             HHHHhcccccCccCCccc
Q 034094           86 YYIKSTSREVWNMGPQIQ  103 (104)
Q Consensus        86 y~i~~~~~~~~~fDPyei  103 (104)
                      +.|+ +.-+..+|||||.
T Consensus        23 q~IS-svl~t~iFDPFE~   39 (64)
T PF03622_consen   23 QHIS-SVLNTEIFDPFEV   39 (64)
T ss_pred             HHHH-HHHhhhhcCCeeE
Confidence            5555 3335578999985


No 6  
>PF08592 DUF1772:  Domain of unknown function (DUF1772);  InterPro: IPR013901  This entry represents proteins of unknown function. 
Probab=72.53  E-value=10  Score=24.66  Aligned_cols=75  Identities=9%  Similarity=0.279  Sum_probs=38.5

Q ss_pred             CCchhHHHHHHHhhhhhhhhhhhhhccccccccccccccccchhhHHHHHHHhhhccCcchhHHHHHHHHHHHHHH
Q 034094            8 SQLFPIFILTIMALPLVPYTILKLCHAFSKKIKTIHCQCSDCARSGKYRKSIFKRISNFSTCSNLSLVLLWVIMII   83 (104)
Q Consensus         8 g~~f~yFvlt~l~lvLiP~T~~~l~~~~~~~~~~~~~~~~~~~~~~~~i~~~~k~~~~~~~~~~i~lv~gW~l~~~   83 (104)
                      +....+.+.+.+.+-.+|.|....... ++.-..-+-+........+..++.++|..+.+..|.++-++++++..+
T Consensus        63 ~~~~~~~~a~~~~~~~~~~T~~~~~P~-N~~l~~~~~~~~~~~~~~~~~~~l~~~W~~~n~vR~~~~~~a~~~~~~  137 (139)
T PF08592_consen   63 AARLLWLAAAALLLSIIPFTFLVNVPI-NNRLAAWDIESSPEEAPADWVRALLDRWGRLNLVRTVLSLVAFLLLLI  137 (139)
T ss_pred             ccHHHHHHHHHHHHHHHHHHHHHhhHH-HHHHHHccccccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            344445555666667899998775322 111000000001112222334555555666654488888888887653


No 7  
>KOG3672 consensus Histidine acid phosphatase [General function prediction only]
Probab=65.42  E-value=4  Score=32.84  Aligned_cols=52  Identities=15%  Similarity=0.137  Sum_probs=28.2

Q ss_pred             ccccchhhHHHHHHHhhh-ccCcchhHHHHHHHHHHHHHHHHHHHHhcccccCccCCcccC
Q 034094           45 QCSDCARSGKYRKSIFKR-ISNFSTCSNLSLVLLWVIMIILIYYIKSTSREVWNMGPQIQI  104 (104)
Q Consensus        45 ~~~~~~~~~~~i~~~~k~-~~~~~~~~~i~lv~gW~l~~~L~y~i~~~~~~~~~fDPyei~  104 (104)
                      +| .|+.+...++....+ -..+.+ +....+.-|.=.+.+      .....+.||||+.|
T Consensus       249 ~C-~Cp~~~~~r~~~e~~~~~q~lk-~~~~dv~~~~~~~~~------~~~p~~~~~pf~~I  301 (487)
T KOG3672|consen  249 QC-ACPIHKSIRRIYEEEHLQQFLK-MKSDDVADEEKKFLS------FPQPAASFDPFQMI  301 (487)
T ss_pred             cc-cchHHHHHHHHHHHHHHHHHHh-cchHHHHhhhcceee------ecccccccCchhHH
Confidence            66 377766665544431 111133 334566677655443      22344679999865


No 8  
>COG4420 Predicted membrane protein [Function unknown]
Probab=54.89  E-value=16  Score=26.42  Aligned_cols=7  Identities=14%  Similarity=0.069  Sum_probs=5.8

Q ss_pred             CccCCcc
Q 034094           96 WNMGPQI  102 (104)
Q Consensus        96 ~~fDPye  102 (104)
                      ..||||-
T Consensus        82 ~~wDpyP   88 (191)
T COG4420          82 LAWDPYP   88 (191)
T ss_pred             CcCCCcc
Confidence            6799995


No 9  
>KOG0510 consensus Ankyrin repeat protein [General function prediction only]
Probab=49.23  E-value=32  Score=30.25  Aligned_cols=25  Identities=36%  Similarity=0.369  Sum_probs=19.8

Q ss_pred             CCchhHHHHHHHhhhhhhhhhhhhh
Q 034094            8 SQLFPIFILTIMALPLVPYTILKLC   32 (104)
Q Consensus         8 g~~f~yFvlt~l~lvLiP~T~~~l~   32 (104)
                      |--|.++-|-+++++++|+|++.+-
T Consensus       505 g~~~~~~nL~~Y~lFlv~lT~Yv~~  529 (929)
T KOG0510|consen  505 GKYFHLNNLLIYSLFLVSLTIYVLL  529 (929)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3345666789999999999998873


No 10 
>PF06298 PsbY:  Photosystem II protein Y (PsbY);  InterPro: IPR009388 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  This family represents the low molecular weight transmembrane protein PsbY found in PSII. In higher plants, two related PsbY proteins exist, PsbY-1 and PsbY-2, which appear to function as a heterodimer. In spinach and Arabidopsis, these two proteins arise from a single-copy nuclear gene that is processed in the chloroplast. By contrast, prokaryotic and organellar chromosomes encode a single PsbY protein, as found in cyanobacteria and red algae, indicating a duplication event in the evolution of higher plants []. PsbY has two low manganese-dependent activities: a catalase-like activity and an L-arginine metabolising activity that converts L-arginine into ornithine and urea []. In addition, a redox-active group is thought to be present in the protein. In cyanobacteria, PsbY deletion mutants have a slightly impaired PSII that is less capable of coping with low levels of calcium ions than the wild-type.; GO: 0030145 manganese ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0016021 integral to membrane
Probab=45.94  E-value=33  Score=18.18  Aligned_cols=17  Identities=12%  Similarity=0.016  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 034094           71 NLSLVLLWVIMIILIYY   87 (104)
Q Consensus        71 ~i~lv~gW~l~~~L~y~   87 (104)
                      -+++.+||+++-..---
T Consensus        11 Pil~A~gWa~fNIg~~A   27 (36)
T PF06298_consen   11 PILPAAGWALFNIGRAA   27 (36)
T ss_pred             HHHHHHHHHHHHhHHHH
Confidence            35566799998666433


No 11 
>PF12955 DUF3844:  Domain of unknown function (DUF3844);  InterPro: IPR024382 This presumed domain is found in fungal species. It contains 8 largely conserved cysteine residues. This domain is found in proteins thought to be located in the endoplasmic reticulum.
Probab=43.78  E-value=29  Score=22.60  Aligned_cols=30  Identities=20%  Similarity=0.108  Sum_probs=25.1

Q ss_pred             ccCCCchhHHHHHHHhhhhhhhhhhhhhcc
Q 034094            5 EENSQLFPIFILTIMALPLVPYTILKLCHA   34 (104)
Q Consensus         5 DE~g~~f~yFvlt~l~lvLiP~T~~~l~~~   34 (104)
                      |=+.++|.++-.|+++++++-..+..|+..
T Consensus        63 DvS~~F~L~~~~ti~lv~~~~~~I~lL~sv   92 (103)
T PF12955_consen   63 DVSVPFWLFAGFTIALVVLVAGAIGLLFSV   92 (103)
T ss_pred             cccchhhHHHHHHHHHHHHHHHHHHHHHHc
Confidence            667888888889999999998888888655


No 12 
>PRK13240 pbsY photosystem II protein Y; Reviewed
Probab=42.83  E-value=22  Score=19.33  Aligned_cols=17  Identities=12%  Similarity=0.020  Sum_probs=11.8

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 034094           72 LSLVLLWVIMIILIYYI   88 (104)
Q Consensus        72 i~lv~gW~l~~~L~y~i   88 (104)
                      +++.+||+++-..---+
T Consensus        12 il~A~~Wa~fNIg~~Al   28 (40)
T PRK13240         12 ILAAAGWAVFNIGKAAR   28 (40)
T ss_pred             HHHHHHHHHHHhhHHHH
Confidence            56678999987664443


No 13 
>PF06210 DUF1003:  Protein of unknown function (DUF1003);  InterPro: IPR010406 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=42.10  E-value=46  Score=21.71  Aligned_cols=7  Identities=14%  Similarity=-0.012  Sum_probs=5.4

Q ss_pred             CccCCcc
Q 034094           96 WNMGPQI  102 (104)
Q Consensus        96 ~~fDPye  102 (104)
                      ..||||-
T Consensus        28 ~~fDpyP   34 (108)
T PF06210_consen   28 PAFDPYP   34 (108)
T ss_pred             CCCCCcc
Confidence            4699984


No 14 
>PF11027 DUF2615:  Protein of unknown function (DUF2615);  InterPro: IPR020309 This entry represents a group of uncharacterised protein from the Metazoa, including CD034 (or C4orf34) and YQF4 (or C34C12.4).
Probab=41.82  E-value=32  Score=22.42  Aligned_cols=19  Identities=21%  Similarity=0.831  Sum_probs=16.5

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIILIYYI   88 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i   88 (104)
                      ...+++++|.++|++.|..
T Consensus        54 ~~~~~~~~w~~~A~~ly~~   72 (103)
T PF11027_consen   54 SMFMMMMLWMVLAMALYLL   72 (103)
T ss_pred             cHHHHHHHHHHHHHHHHHc
Confidence            5677888999999999987


No 15 
>PF03967 PRCH:  Photosynthetic reaction centre, H-chain N-terminal region;  InterPro: IPR015810  The photosynthetic apparatus in non-oxygenic bacteria consists of light-harvesting (LH) protein-pigment complexes LH1 and LH2, which use carotenoid and bacteriochlorophyll as primary donors []. LH1 acts as the energy collection hub, temporarily storing it before its transfer to the photosynthetic reaction centre (RC) []. Electrons are transferred from the primary donor via an intermediate acceptor (bacteriopheophytin) to the primary acceptor (quinine Qa), and finally to the secondary acceptor (quinone Qb), resulting in the formation of ubiquinol QbH2. RC uses the excitation energy to shuffle electrons across the membrane, transferring them via ubiquinol to the cytochrome bc1 complex in order to establish a proton gradient across the membrane, which is used by ATP synthetase to form ATP [, , ].  The core complex is anchored in the cell membrane, consisting of one unit of RC surrounded by LH1; in some species there may be additional subunits []. RC consists of three subunits: L (light), M (medium), and H (heavy). Subunits L and M provide the scaffolding for the chromophore, while subunit H contains a cytoplasmic domain []. In Rhodopseudomonas viridis, there is also a non-membranous tetrahaem cytochrome (4Hcyt) subunit on the periplasmic surface.  This entry represents the N-terminal domain of the photosynthetic reaction centre H subunit, which includes the transmembrane domain and part of the cytoplasmic domain [].; GO: 0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity, 0019684 photosynthesis, light reaction, 0030077 plasma membrane light-harvesting complex; PDB: 1RZZ_H 1PST_H 2J8D_H 3DUQ_H 1FNP_H 1KBY_H 1E14_H 2HG3_H 1UMX_H 1YST_H ....
Probab=41.37  E-value=42  Score=22.98  Aligned_cols=22  Identities=32%  Similarity=0.786  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhc
Q 034094           70 SNLSLVLLWVIMIILIYYIKST   91 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i~~~   91 (104)
                      --++|-+.|+.|+.|+|+....
T Consensus        13 Aql~lyaFwiFFagLi~YLrrE   34 (136)
T PF03967_consen   13 AQLVLYAFWIFFAGLIYYLRRE   34 (136)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhcc
Confidence            4466778999999999998533


No 16 
>COG3924 Predicted membrane protein [Function unknown]
Probab=40.02  E-value=22  Score=21.90  Aligned_cols=15  Identities=20%  Similarity=0.388  Sum_probs=12.1

Q ss_pred             HHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIIL   84 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L   84 (104)
                      -.++.++||.+.+|+
T Consensus        18 LtllYl~gW~v~AYl   32 (80)
T COG3924          18 LTLLYLAGWLVAAYL   32 (80)
T ss_pred             HHHHHHHHHHHHHhC
Confidence            456777899999987


No 17 
>PF04911 ATP-synt_J:  ATP synthase j chain;  InterPro: IPR006995 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit J found in the F0 complex of F-ATPases from fungal mitochondria. This subunit does not appear to display sequence similarity with subunits of F-ATPases found in other organisms []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0045263 proton-transporting ATP synthase complex, coupling factor F(o)
Probab=38.96  E-value=24  Score=20.38  Aligned_cols=15  Identities=20%  Similarity=0.370  Sum_probs=11.8

Q ss_pred             chhHHHHHHHhhhhh
Q 034094           10 LFPIFILTIMALPLV   24 (104)
Q Consensus        10 ~f~yFvlt~l~lvLi   24 (104)
                      +||||+.+.+.+.+|
T Consensus        10 ~wPFf~ag~iv~ygv   24 (54)
T PF04911_consen   10 MWPFFAAGAIVYYGV   24 (54)
T ss_pred             hhHHHHHHHHHHHHH
Confidence            699999988766655


No 18 
>CHL00196 psbY photosystem II protein Y; Provisional
Probab=38.45  E-value=53  Score=17.40  Aligned_cols=17  Identities=12%  Similarity=0.106  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHHHHHHHH
Q 034094           71 NLSLVLLWVIMIILIYY   87 (104)
Q Consensus        71 ~i~lv~gW~l~~~L~y~   87 (104)
                      =+++.+||+++-..---
T Consensus        11 Pil~A~~Wa~fNIg~~A   27 (36)
T CHL00196         11 PVLAAASWALFNIGRLA   27 (36)
T ss_pred             HHHHHHHHHHHHhHHHH
Confidence            35667799998655433


No 19 
>PF04583 Baculo_p74:  Baculoviridae p74 conserved region;  InterPro: IPR007663 Baculoviruses are distinct from other virus families in that there are two viral phenotypes: budded virus (BV) and occlusion-derived virus (ODV). BVs disseminate viral infection throughout the tissues of the host and ODVs transmit baculovirus between insect hosts. GFP tagging experiments implicate p74 as an ODV envelope protein [, ].; GO: 0019058 viral infectious cycle
Probab=37.69  E-value=37  Score=25.51  Aligned_cols=23  Identities=17%  Similarity=0.109  Sum_probs=13.8

Q ss_pred             HHHHHHHHHHHHHHHhcccccCccCCcc
Q 034094           75 VLLWVIMIILIYYIKSTSREVWNMGPQI  102 (104)
Q Consensus        75 v~gW~l~~~L~y~i~~~~~~~~~fDPye  102 (104)
                      |+||+|++..+--+     -...||||-
T Consensus       106 Vvgi~Li~~ti~Dl-----vL~~WDPfG  128 (249)
T PF04583_consen  106 VVGIVLIFLTIADL-----VLMFWDPFG  128 (249)
T ss_pred             HHHHHHHHHHHHHH-----HHHhcCccc
Confidence            46887776654322     125799983


No 20 
>PF14004 DUF4227:  Protein of unknown function (DUF4227)
Probab=37.13  E-value=84  Score=19.06  Aligned_cols=31  Identities=10%  Similarity=-0.143  Sum_probs=17.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhcccccCccCCcc
Q 034094           70 SNLSLVLLWVIMIILIYYIKSTSREVWNMGPQI  102 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i~~~~~~~~~fDPye  102 (104)
                      |.++|-.|=.+++|-+..--  ..+...+|||+
T Consensus         8 k~~~LF~~~T~lfYy~~~w~--~~~~~~~hrY~   38 (71)
T PF14004_consen    8 KFFLLFTGCTLLFYYAILWV--SDEYEPYHRYD   38 (71)
T ss_pred             HHHHHHHHHHHHHHHHHHHH--HHHhccCCCCC
Confidence            55666555555555443322  23456788886


No 21 
>PF15176 LRR19-TM:  Leucine-rich repeat family 19 TM domain
Probab=36.72  E-value=43  Score=21.84  Aligned_cols=27  Identities=11%  Similarity=0.241  Sum_probs=17.9

Q ss_pred             cccCCCchhHHHHHHHhhhhhhhhhhh
Q 034094            4 TEENSQLFPIFILTIMALPLVPYTILK   30 (104)
Q Consensus         4 YDE~g~~f~yFvlt~l~lvLiP~T~~~   30 (104)
                      -.++|..|+|.+.-+++.+.+-+-+..
T Consensus        10 ~~~~g~sW~~LVGVv~~al~~SlLIal   36 (102)
T PF15176_consen   10 PGEGGRSWPFLVGVVVTALVTSLLIAL   36 (102)
T ss_pred             CCCCCcccHhHHHHHHHHHHHHHHHHH
Confidence            357899999987666555555444433


No 22 
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=36.32  E-value=53  Score=20.91  Aligned_cols=20  Identities=20%  Similarity=0.247  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIILIYYIK   89 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i~   89 (104)
                      +.++|.+.+|+++++..-++
T Consensus         5 ~~llL~l~LA~lLlisSeva   24 (95)
T PF07172_consen    5 AFLLLGLLLAALLLISSEVA   24 (95)
T ss_pred             HHHHHHHHHHHHHHHHhhhh
Confidence            56666677777777766554


No 23 
>COG1288 Predicted membrane protein [Function unknown]
Probab=34.23  E-value=1.9e+02  Score=23.83  Aligned_cols=20  Identities=25%  Similarity=0.507  Sum_probs=11.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIILIYYIK   89 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i~   89 (104)
                      ++++|.+.=+.+..++|-+.
T Consensus       275 ~klvL~lf~l~f~~mI~GV~  294 (481)
T COG1288         275 DKLVLLLFTLTFVIMIWGVI  294 (481)
T ss_pred             hhHHHHHHHHHHHHHHHHhh
Confidence            55555555555556666554


No 24 
>PF06459 RR_TM4-6:  Ryanodine Receptor TM 4-6;  InterPro: IPR009460  The release of Ca2+ ions from intracellular stores is a key step in a wide variety of cellular functions. In striated muscle, the release of Ca2+ from the sarcoplasmic reticulum (SR) leads to muscle contraction. Ca2+ release occurs through large, high-conductance Ca2+ release channels, also known as ryanodine receptors (RyRs) because they bind the plant alkaloid ryanodine with high affinity and specificity []. This region covers TM regions 4-6 of the ryanodine receptor 1 family.; GO: 0005219 ryanodine-sensitive calcium-release channel activity, 0006874 cellular calcium ion homeostasis, 0016021 integral to membrane
Probab=33.48  E-value=52  Score=24.98  Aligned_cols=28  Identities=29%  Similarity=0.462  Sum_probs=20.1

Q ss_pred             chhHHHHHHHHHHHHHHHH-HHHHhccccc
Q 034094           67 STCSNLSLVLLWVIMIILI-YYIKSTSREV   95 (104)
Q Consensus        67 ~~~~~i~lv~gW~l~~~L~-y~i~~~~~~~   95 (104)
                      +. |.+.|+++-++-++|. |||+....+.
T Consensus       172 Nl-r~lALflAFaINFILLFYKVs~~~~~~  200 (274)
T PF06459_consen  172 NL-RFLALFLAFAINFILLFYKVSTSPPEE  200 (274)
T ss_pred             HH-HHHHHHHHHHHHHHHHHHHhccCCccc
Confidence            55 8899999888866555 8887555443


No 25 
>PF06422 PDR_CDR:  CDR ABC transporter;  InterPro: IPR010929 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). In yeast, the PDR and CDR ABC transporters display extensive sequence homology, and confer resistance to several anti-fungal compounds by actively transporting their substrates out of the cell. These transporters have two homologous halves, each with an N-terminal intracellular hydrophilic region that contains an ATP-binding site, followed by a C-terminal membrane-associated region containing six transmembrane segments []. This entry represents a domain of the PDR/CDR ABC transporter comprising extracellular loop 3, transmembrane segment 6 and a linker region.; GO: 0005524 ATP binding, 0042626 ATPase activity, coupled to transmembrane movement of substances, 0006810 transport, 0016021 integral to membrane
Probab=33.42  E-value=61  Score=20.64  Aligned_cols=20  Identities=15%  Similarity=0.482  Sum_probs=14.8

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIILIYYIK   89 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i~   89 (104)
                      ||+-+++||.+++++++.+.
T Consensus        50 RN~GIli~f~i~f~~~~~~~   69 (103)
T PF06422_consen   50 RNFGILIAFWIFFIVLTLLA   69 (103)
T ss_pred             hhHHHHHHHHHHHHHHHHHH
Confidence            78888888877777766653


No 26 
>PRK13183 psbN photosystem II reaction center protein N; Provisional
Probab=33.18  E-value=56  Score=18.27  Aligned_cols=31  Identities=13%  Similarity=0.100  Sum_probs=17.8

Q ss_pred             HHHHHHHHHHHHHHHHH-Hhccccc-CccCCcc
Q 034094           72 LSLVLLWVIMIILIYYI-KSTSREV-WNMGPQI  102 (104)
Q Consensus        72 i~lv~gW~l~~~L~y~i-~~~~~~~-~~fDPye  102 (104)
                      +.+.++=+++.+..|.+ +...+.+ +.=||||
T Consensus        10 ~~i~i~~lL~~~TgyaiYtaFGppSk~LrDPFe   42 (46)
T PRK13183         10 LAITILAILLALTGFGIYTAFGPPSKELDDPFD   42 (46)
T ss_pred             HHHHHHHHHHHHhhheeeeccCCcccccCCchh
Confidence            33444445555666665 3345555 6789987


No 27 
>PF12686 DUF3800:  Protein of unknown function (DUF3800);  InterPro: IPR024524 This family of proteins is functionally uncharacterised. Some family members possess a DE motif at their N terminus and a QXXD motif at their C terminus that may be functionally important.
Probab=32.71  E-value=3  Score=28.81  Aligned_cols=16  Identities=25%  Similarity=0.395  Sum_probs=12.6

Q ss_pred             cccCCC--------chhHHHHHHH
Q 034094            4 TEENSQ--------LFPIFILTIM   19 (104)
Q Consensus         4 YDE~g~--------~f~yFvlt~l   19 (104)
                      .||||+        .-|||+++.+
T Consensus         4 iDESG~~~~~~~~~~~~~fvl~gv   27 (235)
T PF12686_consen    4 IDESGNTGPNYSDKNSPYFVLGGV   27 (235)
T ss_pred             EeCCCCCCCCcCCCCCCEEEEEEE
Confidence            499998        4899987765


No 28 
>PF09878 DUF2105:  Predicted membrane protein (DUF2105);  InterPro: IPR019212  This entry represents a protein found in various hypothetical archaeal proteins, has no known function. 
Probab=32.66  E-value=23  Score=25.89  Aligned_cols=23  Identities=17%  Similarity=0.330  Sum_probs=20.6

Q ss_pred             CCCchhHHHHHHHhhhhhhhhhh
Q 034094            7 NSQLFPIFILTIMALPLVPYTIL   29 (104)
Q Consensus         7 ~g~~f~yFvlt~l~lvLiP~T~~   29 (104)
                      ||-+|.++++.|+.+++.|--+.
T Consensus       164 SGiaWalWi~gF~~Ff~~P~~Wl  186 (212)
T PF09878_consen  164 SGIAWALWIAGFIGFFLFPQYWL  186 (212)
T ss_pred             hhHHHHHHHHHHHHHHHhHHHHH
Confidence            78899999999999999997653


No 29 
>TIGR03778 VPDSG_CTERM VPDSG-CTERM exosortase interaction domain. Through in silico analysis, we previously described the PEP-CTERM/exosortase system (PubMed:16930487). This model describes a PEP-CTERM-like variant C-terminal protein sorting signal, as found at the C-terminus of twenty otherwise unrelated proteins in Verrucomicrobiae bacterium DG1235. The variant motif, VPDSG, seems an intermediate between the VPEP motif (TIGR02595) of typical exosortase systems and the classical LPXTG of sortase in Gram-positive bacteria.
Probab=32.38  E-value=43  Score=16.47  Aligned_cols=18  Identities=11%  Similarity=0.220  Sum_probs=12.5

Q ss_pred             cCCCchhHHHHHHHhhhh
Q 034094            6 ENSQLFPIFILTIMALPL   23 (104)
Q Consensus         6 E~g~~f~yFvlt~l~lvL   23 (104)
                      ++|+|..-+.+++++++.
T Consensus         3 DsGST~~Ll~~~l~~l~~   20 (26)
T TIGR03778         3 DSGSTLALLGLGLLGLLG   20 (26)
T ss_pred             CchhHHHHHHHHHHHHHH
Confidence            467787777777766654


No 30 
>PF12273 RCR:  Chitin synthesis regulation, resistance to Congo red;  InterPro: IPR020999  RCR proteins are ER membrane proteins that regulate chitin deposition in fungal cell walls. Although chitin, a linear polymer of beta-1,4-linked N-acetylglucosamine, constitutes only 2% of the cell wall it plays a vital role in the overall protection of the cell wall against stress, noxious chemicals and osmotic pressure changes. Congo red is a cell wall-disrupting benzidine-type dye extensively used in many cell wall mutant studies that specifically targets chitin in yeast cells and inhibits growth. RCR proteins render the yeasts resistant to Congo red by diminishing the content of chitin in the cell wall []. RCR proteins are probably regulating chitin synthase III interact directly with ubiquitin ligase Rsp5, and the VPEY motif is necessary for this, via interaction with the WW domains of Rsp5 []. 
Probab=31.87  E-value=29  Score=22.87  Aligned_cols=24  Identities=17%  Similarity=0.301  Sum_probs=12.0

Q ss_pred             hhHHHHHHHhhhhhhhhhhhhhcc
Q 034094           11 FPIFILTIMALPLVPYTILKLCHA   34 (104)
Q Consensus        11 f~yFvlt~l~lvLiP~T~~~l~~~   34 (104)
                      |.+|++-+++++++=+...+..++
T Consensus         2 W~l~~iii~~i~l~~~~~~~~~rR   25 (130)
T PF12273_consen    2 WVLFAIIIVAILLFLFLFYCHNRR   25 (130)
T ss_pred             eeeHHHHHHHHHHHHHHHHHHHHH
Confidence            455655555555554444444333


No 31 
>KOG0863 consensus 20S proteasome, regulatory subunit alpha type PSMA1/PRE5 [Posttranslational modification, protein turnover, chaperones]
Probab=31.42  E-value=16  Score=27.33  Aligned_cols=10  Identities=20%  Similarity=0.272  Sum_probs=8.0

Q ss_pred             CCccccCCCc
Q 034094            1 MAATEENSQL   10 (104)
Q Consensus         1 ~~~YDE~g~~   10 (104)
                      |++|||+|--
T Consensus       134 v~gYDe~G~h  143 (264)
T KOG0863|consen  134 VAGYDESGPH  143 (264)
T ss_pred             EEeecCCCce
Confidence            6889999954


No 32 
>PF02468 PsbN:  Photosystem II reaction centre N protein (psbN);  InterPro: IPR003398 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].   This family represents the low molecular weight transmembrane protein PsbN found in PSII. PsbN may have a role in PSII stability, however its actual function unknown. PsbN does not appear to be essential for photoautotrophic growth or normal PSII function.; GO: 0015979 photosynthesis, 0009523 photosystem II, 0009539 photosystem II reaction center, 0016020 membrane
Probab=29.75  E-value=1e+02  Score=16.90  Aligned_cols=26  Identities=15%  Similarity=-0.004  Sum_probs=14.2

Q ss_pred             HHHHHHHHHHHH-Hhccccc-CccCCcc
Q 034094           77 LWVIMIILIYYI-KSTSREV-WNMGPQI  102 (104)
Q Consensus        77 gW~l~~~L~y~i-~~~~~~~-~~fDPye  102 (104)
                      +=+++....|.+ ....+.+ +.=||||
T Consensus        12 ~~~lv~~Tgy~iYtaFGppSk~LrDPfe   39 (43)
T PF02468_consen   12 SCLLVSITGYAIYTAFGPPSKELRDPFE   39 (43)
T ss_pred             HHHHHHHHhhhhhheeCCCccccCCccc
Confidence            334444444544 2344445 6789987


No 33 
>CHL00020 psbN photosystem II protein N
Probab=29.46  E-value=52  Score=18.12  Aligned_cols=29  Identities=7%  Similarity=0.025  Sum_probs=16.6

Q ss_pred             HHHHHHHHHHHHHHH-Hhccccc-CccCCcc
Q 034094           74 LVLLWVIMIILIYYI-KSTSREV-WNMGPQI  102 (104)
Q Consensus        74 lv~gW~l~~~L~y~i-~~~~~~~-~~fDPye  102 (104)
                      +.++=+++....|.+ +...+.+ +.=||||
T Consensus         9 i~i~~ll~~~Tgy~iYtaFGppSk~LrDPfe   39 (43)
T CHL00020          9 IFISGLLVSFTGYALYTAFGQPSKQLRDPFE   39 (43)
T ss_pred             HHHHHHHHHhhheeeeeccCCchhccCCchh
Confidence            333444555555665 3344455 6789987


No 34 
>COG0713 NuoK NADH:ubiquinone oxidoreductase subunit 11 or 4L (chain K) [Energy production and conversion]
Probab=27.90  E-value=36  Score=22.13  Aligned_cols=17  Identities=35%  Similarity=0.733  Sum_probs=13.7

Q ss_pred             cccCCCchhHHHHHHHh
Q 034094            4 TEENSQLFPIFILTIMA   20 (104)
Q Consensus         4 YDE~g~~f~yFvlt~l~   20 (104)
                      +|-+||.|.+|++|+-+
T Consensus        54 ~~~~gQvfaifvitvAA   70 (100)
T COG0713          54 GDLDGQVFAIFVITVAA   70 (100)
T ss_pred             ccccchHHHHHHHHHHH
Confidence            35589999999998754


No 35 
>PRK14584 hmsS hemin storage system protein; Provisional
Probab=27.29  E-value=77  Score=22.09  Aligned_cols=19  Identities=16%  Similarity=0.258  Sum_probs=16.3

Q ss_pred             HHHHHHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIILIYYI   88 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i   88 (104)
                      -.++-+++|+.|+|+.++.
T Consensus        18 D~~lT~~aW~gfi~l~~~~   36 (153)
T PRK14584         18 DIILTALAWFGFLFLLVRG   36 (153)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            6677788999999999886


No 36 
>PF15128 T_cell_tran_alt:  T-cell leukemia translocation-altered
Probab=26.34  E-value=1.3e+02  Score=19.13  Aligned_cols=18  Identities=22%  Similarity=0.521  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIILIYY   87 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~   87 (104)
                      .++-+++||.++..++-.
T Consensus        26 ~ifkllL~WlvlsLl~I~   43 (92)
T PF15128_consen   26 QIFKLLLGWLVLSLLAIH   43 (92)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            556688899988766543


No 37 
>PHA00024 IX minor coat protein
Probab=25.42  E-value=1.1e+02  Score=15.84  Aligned_cols=16  Identities=13%  Similarity=0.299  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034094           71 NLSLVLLWVIMIILIY   86 (104)
Q Consensus        71 ~i~lv~gW~l~~~L~y   86 (104)
                      .-..++||++..-+.+
T Consensus         9 fgA~ilG~~l~~~Il~   24 (33)
T PHA00024          9 FGAYILGWALFYGILV   24 (33)
T ss_pred             HHHHHHHHHHHHHHHH
Confidence            3457789999855443


No 38 
>PF04505 Dispanin:  Interferon-induced transmembrane protein;  InterPro: IPR007593 This family includes the human leukocyte antigen CD225, which is an interferon inducible transmembrane protein, and is associated with interferon induced cell growth suppression [].; GO: 0009607 response to biotic stimulus, 0016021 integral to membrane
Probab=24.79  E-value=72  Score=19.53  Aligned_cols=19  Identities=21%  Similarity=0.427  Sum_probs=10.0

Q ss_pred             HHHHHHhhhh--hhhhhhhhh
Q 034094           14 FILTIMALPL--VPYTILKLC   32 (104)
Q Consensus        14 Fvlt~l~lvL--iP~T~~~l~   32 (104)
                      ..+++++++.  .|+.+.-+.
T Consensus        19 l~~sI~s~l~Cc~PlGi~Ai~   39 (82)
T PF04505_consen   19 LVLSIFSTLCCCWPLGIVAIV   39 (82)
T ss_pred             eeHHHHHHHHHHhhHHHHHhe
Confidence            3444444444  477765553


No 39 
>PF03311 Cornichon:  Cornichon protein;  InterPro: IPR003377  The drosophila cornichon protein (gene: cni) [] is required in the germline for dorsal-ventral signalling. The dorsal-ventral pattern formation involves a reorganisation of the microtubule network correlated with the movement of the oocyte nucleus, and depending on the initial correct establishment of the anterior-posterior axis via a signal from the oocyte produced by cornichon and gurken and received by torpedo protein in the follicle cells. The biochemical function of the cornichon protein is currently not known. It is a protein of 144 residues that seems to contain three transmembrane regions. ; GO: 0035556 intracellular signal transduction, 0016020 membrane
Probab=24.68  E-value=1.9e+02  Score=19.18  Aligned_cols=24  Identities=13%  Similarity=0.303  Sum_probs=13.8

Q ss_pred             CCchhHHHHHHHh-hhhhhhhhhhh
Q 034094            8 SQLFPIFILTIMA-LPLVPYTILKL   31 (104)
Q Consensus         8 g~~f~yFvlt~l~-lvLiP~T~~~l   31 (104)
                      ++.+..|+++++. .+++-++.+.+
T Consensus         3 ~~~~~~~i~alll~~~ll~~~vy~i   27 (128)
T PF03311_consen    3 FDFIVLWILALLLTAALLFIVVYFI   27 (128)
T ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4555566666655 55555555554


No 40 
>PF01542 HCV_core:  Hepatitis C virus core protein;  InterPro: IPR002521 The Hepatitis C virus (HCV) is a small (50 nm in size), enveloped, single-stranded, positive sense RNA virus. It is the only known member of the hepacivirus genus in the family Flaviviridae. There are six major genotypes of the hepatitis C virus, which are identified numerically (e.g., genotype 1, genotype 2, etc.). Although Hepatitis A virus, Hepatitis B virus, and Hepatitis C virus have similar names, because they all cause liver inflammation, these are distinctly different viruses both genetically and clinically. HCV has a positive sense RNA genome that consists of a single open reading frame of 9600 nucleotides. At the 5' and 3' ends of the RNA are the UTR regions that are not translated into proteins but are important to translation and replication of the viral RNA. The 5' UTR has a ribosome binding site (IRES - Internal ribosome entry site) that starts the translation of a 3000 amino acid containing protein that is later cut by cellular and viral proteases into 10 active structural and non-structural smaller proteins. The HCV core protein is located at the N terminus of the polyprotein and is followed by the signal sequence located between the core protein and the E1 envelope glycoprotein. This signal sequence targets the nascent HCV polyprotein to the endoplasmic reticulum (ER), allowing the translocation of E1 to the ER lumen. Cleavage by a signal peptidase in the ER lumen releases the N-terminal end of E1, leaving the 191-amino acids (aa) core protein anchored by its C-terminal signal peptide [, ]. This 191aa polypeptide, also known as p23, is the immature form of the core protein; p23 is further processed by an intramembrane protease, the signal peptide peptidase (SPP), that removes the ER anchor , releasing p21, the N-terminal 179aa mature form of the core protein []. Core protein (p21) is responsible for packaging viral RNA to form a viral nucleocapsid, and it also promotes virion budding [].  Two domains have been identified in the mature form of the HCV core protein, based on predicted structural and functional characteristics []. Domain I, corresponding to the N-terminal region of approximately 120 aa, is a highly basic domain that is probably involved in the recruitment of viral RNA during particle morphogenesis. Domain II, located between aa 120 and aa 175, is a hydrophobic region predicted to form one or two alpha-helices that are probably involved in the association of core with the ER membrane and lipid droplets.  This entry represents domain II and domain III (ER anchor sequence) of the core protein p23. ; GO: 0005198 structural molecule activity
Probab=24.66  E-value=57  Score=19.89  Aligned_cols=19  Identities=32%  Similarity=0.564  Sum_probs=16.0

Q ss_pred             CCchhHHHHHHHhhhhhhh
Q 034094            8 SQLFPIFILTIMALPLVPY   26 (104)
Q Consensus         8 g~~f~yFvlt~l~lvLiP~   26 (104)
                      |=-|..|++++++++..|.
T Consensus        56 gcsfsIFllaLlSc~~~p~   74 (75)
T PF01542_consen   56 GCSFSIFLLALLSCLTVPA   74 (75)
T ss_pred             CccHHHHHHHHHHhccccC
Confidence            5568899999999998874


No 41 
>COG3083 Predicted hydrolase of alkaline phosphatase superfamily [General function prediction only]
Probab=24.38  E-value=50  Score=27.66  Aligned_cols=24  Identities=25%  Similarity=0.566  Sum_probs=20.2

Q ss_pred             hhHHHHHHHhhhhhhhhhhhhhcc
Q 034094           11 FPIFILTIMALPLVPYTILKLCHA   34 (104)
Q Consensus        11 f~yFvlt~l~lvLiP~T~~~l~~~   34 (104)
                      |.|++.+..++++.|+|...++++
T Consensus        61 FsflvFA~yLlvlfpltfiv~s~r   84 (600)
T COG3083          61 FSFLVFALYLLVLFPLTFIVLSQR   84 (600)
T ss_pred             HHHHHHHHHHHHHhhhhhhcccHH
Confidence            678889999999999998777655


No 42 
>TIGR01150 puhA photosynthetic reaction center, subunit H, bacterial. This model describes the photosynthetic reaction center H subunit in non-oxygenic photosynthetic bacteria. The reaction center is an integral membrane pigment-protein that carries out light-driven electron transfer reactions. At the core of reaction center is a collection light-harvesting cofactors and closely associated polypeptides. The core protein complex is made of L, M and H subunits. The common cofactors include bacterichlorophyll, bacteriopheophytins, ubiquinone and no-heme ferrous iron. The net result of electron tranfer reactions is the establishment of proton electrochemical gradient and production of reducing equivalents in the form of NADH. Ultimately, the process results in the reduction of C02 to carbohydrates(C6H12O6) In non-oxygenic organisms, the electron donor is an organic acid rather than water. Much of our current functional understanding of photosynthesis comes from the structural determination 
Probab=24.26  E-value=94  Score=23.41  Aligned_cols=21  Identities=29%  Similarity=0.825  Sum_probs=16.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHh
Q 034094           70 SNLSLVLLWVIMIILIYYIKS   90 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i~~   90 (104)
                      --+.|-+.|+.|+.|+|+...
T Consensus        13 Aq~~ly~FwiFFA~Li~YLrr   33 (252)
T TIGR01150        13 AQLVIYAFWIFLAGLIYYLRR   33 (252)
T ss_pred             HHHHHHHHHHHHHHHHHHHhc
Confidence            345677899999999999853


No 43 
>TIGR02736 cbb3_Q_epsi cytochrome c oxidase, cbb3-type, CcoQ subunit, epsilon-Proteobacterial. Members of this protein family are restricted to the epsilon branch of the Proteobacteria. All members are found in operons containing the other three structural subunits of the cbb3 type of cytochrome c oxidase. These small proteins show remote sequence similarity to the CcoQ subunit in other cytochrome c oxidase systems, so this family is assumed to represent the epsilonproteobacterial variant of CcoQ.
Probab=24.01  E-value=79  Score=18.37  Aligned_cols=23  Identities=17%  Similarity=0.353  Sum_probs=12.4

Q ss_pred             hhHHHHHHHhhhhhhhhhhhhhc
Q 034094           11 FPIFILTIMALPLVPYTILKLCH   33 (104)
Q Consensus        11 f~yFvlt~l~lvLiP~T~~~l~~   33 (104)
                      +.||++|++..+++=--++-+++
T Consensus         2 y~yf~~ti~lvv~LYgY~yhLYr   24 (56)
T TIGR02736         2 YAYFAFTLLLVIFLYAYIYHLYR   24 (56)
T ss_pred             cchHHHHHHHHHHHHHHHHHhhh
Confidence            35777777666665333334443


No 44 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=23.69  E-value=1.1e+02  Score=26.36  Aligned_cols=18  Identities=17%  Similarity=0.333  Sum_probs=12.9

Q ss_pred             HHHHHHhhhhhhhhhhhh
Q 034094           14 FILTIMALPLVPYTILKL   31 (104)
Q Consensus        14 Fvlt~l~lvLiP~T~~~l   31 (104)
                      .++.++.++++|++-..+
T Consensus        97 ~~i~ll~~il~P~vg~~f  114 (806)
T PF05478_consen   97 AVIGLLFIILMPLVGLCF  114 (806)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            356777778889886554


No 45 
>cd00226 PRCH Photosynthetic reaction center (RC) complex, subunit H;  RC is an integral membrane protein-pigment complex which catalyzes light-induced reduction of ubiquinone to ubiquinol, generating a transmembrane electrochemical gradient of protons used to produce ATP by ATP synthase. Subunit H is positioned mainly in the cytoplasm with one transmembrane alpha helix. Provides proton transfer pathway (water channels) connecting the terminal quinone electron acceptor of RC, to the aqueous phase. Found in photosynthetic bacteria: alpha, beta, and gamma proteobacteria.
Probab=23.66  E-value=98  Score=23.27  Aligned_cols=20  Identities=30%  Similarity=0.850  Sum_probs=16.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIILIYYIK   89 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i~   89 (104)
                      --++|-+.|+.|+.|+|+..
T Consensus        13 A~~~l~~Fw~ffa~Li~YL~   32 (246)
T cd00226          13 AQLVIYAFWIFFAGLIYYLR   32 (246)
T ss_pred             HHHHHHHHHHHHHHHHHHHh
Confidence            44667789999999999985


No 46 
>PF15105 TMEM61:  TMEM61 protein family
Probab=23.04  E-value=90  Score=22.38  Aligned_cols=26  Identities=19%  Similarity=0.249  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHhcccccCccCCcc
Q 034094           77 LWVIMIILIYYIKSTSREVWNMGPQI  102 (104)
Q Consensus        77 gW~l~~~L~y~i~~~~~~~~~fDPye  102 (104)
                      |-.|++-|.+.|....+..-.||||-
T Consensus        66 GlLLl~GLLWSikas~~~~pr~d~y~   91 (198)
T PF15105_consen   66 GLLLLFGLLWSIKASTRGPPRWDPYH   91 (198)
T ss_pred             HHHHHHHHHhhhhcccCCCCCCCccc
Confidence            55556666788865656556799994


No 47 
>PF09125 COX2-transmemb:  Cytochrome C oxidase subunit II, transmembrane;  InterPro: IPR015209 This N-terminal domain forms the transmembrane region in subunit II of cytochrome c oxidase from Thermus thermophilus. This domain adopts a tertiary structure consisting of two antiparallel transmembrane helices, in a transmembrane helix hairpin fold []. ; PDB: 1EHK_B 2QPE_B 3S8F_B 4EV3_B 3BVD_B 3S8G_B 3EH3_B 3S3C_B 3S39_B 3QJQ_B ....
Probab=22.96  E-value=1.1e+02  Score=16.32  Aligned_cols=19  Identities=11%  Similarity=0.116  Sum_probs=13.9

Q ss_pred             chhHHHHHHHhhhhhhhhh
Q 034094           10 LFPIFILTIMALPLVPYTI   28 (104)
Q Consensus        10 ~f~yFvlt~l~lvLiP~T~   28 (104)
                      -|..|.++++.++++-.-|
T Consensus        15 ~Wi~F~l~mi~vFi~li~y   33 (38)
T PF09125_consen   15 GWIAFALAMILVFIALIGY   33 (38)
T ss_dssp             HHHHHHHHHHHHHHHHHHH
T ss_pred             hHHHHHHHHHHHHHHHHHH
Confidence            3888998888777765544


No 48 
>PF14373 Imm_superinfect:  Superinfection immunity protein
Probab=22.23  E-value=1.5e+02  Score=16.15  Aligned_cols=16  Identities=25%  Similarity=0.252  Sum_probs=9.6

Q ss_pred             HHHHHHHHHHHHHHHH
Q 034094           71 NLSLVLLWVIMIILIY   86 (104)
Q Consensus        71 ~i~lv~gW~l~~~L~y   86 (104)
                      .+=+.+||.+++.++-
T Consensus        22 ~~Nl~lGWT~iGWv~a   37 (43)
T PF14373_consen   22 LLNLLLGWTGIGWVAA   37 (43)
T ss_pred             hHHHHHHhHHHHHHHH
Confidence            3345567777766643


No 49 
>PRK10726 hypothetical protein; Provisional
Probab=22.14  E-value=83  Score=20.58  Aligned_cols=13  Identities=23%  Similarity=0.516  Sum_probs=8.5

Q ss_pred             HHHHHHHHHHHHH
Q 034094           72 LSLVLLWVIMIIL   84 (104)
Q Consensus        72 i~lv~gW~l~~~L   84 (104)
                      .+..+-|.++.+|
T Consensus        90 ~V~~lFwllF~~L  102 (105)
T PRK10726         90 TVGCLFWLLFSWL  102 (105)
T ss_pred             HHHHHHHHHHHHH
Confidence            3445578888766


No 50 
>KOG0140 consensus Medium-chain acyl-CoA dehydrogenase [Lipid transport and metabolism]
Probab=21.69  E-value=35  Score=26.96  Aligned_cols=9  Identities=11%  Similarity=0.250  Sum_probs=6.3

Q ss_pred             CCccccCCC
Q 034094            1 MAATEENSQ    9 (104)
Q Consensus         1 ~~~YDE~g~    9 (104)
                      |||||++|+
T Consensus        51 aae~Dk~ge   59 (408)
T KOG0140|consen   51 AAEYDKSGE   59 (408)
T ss_pred             hhhhcccCC
Confidence            577777774


No 51 
>PF07672 MFS_Mycoplasma:  Mycoplasma MFS transporter;  InterPro: IPR011699 These proteins share some similarity with members of the Major Facilitator Superfamily (MFS).
Probab=21.63  E-value=1.5e+02  Score=22.49  Aligned_cols=24  Identities=8%  Similarity=0.271  Sum_probs=18.0

Q ss_pred             hhHHHHHHHhhhhhhhhhhhhhcc
Q 034094           11 FPIFILTIMALPLVPYTILKLCHA   34 (104)
Q Consensus        11 f~yFvlt~l~lvLiP~T~~~l~~~   34 (104)
                      |-+-+..+.+++++|+-++.+.+.
T Consensus        40 W~~I~si~~lL~~IpLIly~ifGk   63 (267)
T PF07672_consen   40 WQWILSIFILLIFIPLILYIIFGK   63 (267)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhcc
Confidence            556666777888999998887544


No 52 
>PF06596 PsbX:  Photosystem II reaction centre X protein (PsbX);  InterPro: IPR009518 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  The low molecular weight transmembrane protein PsbX found in PSII is associated with the oxygen-evolving complex. Its expression is light-regulated. PsbX appears to be involved in the regulation of the amount of PSII [], and may be involved in the binding or turnover of quinone molecules at the Qb (PsbA) site [].; GO: 0015979 photosynthesis, 0009523 photosystem II, 0016020 membrane; PDB: 3ARC_x 3A0H_X 3A0B_X 3PRR_X 1S5L_x 4FBY_j 3PRQ_X 3KZI_X 3BZ2_X 3BZ1_X.
Probab=21.61  E-value=89  Score=16.83  Aligned_cols=12  Identities=8%  Similarity=0.238  Sum_probs=9.1

Q ss_pred             hhhhhhhhhhhh
Q 034094           20 ALPLVPYTILKL   31 (104)
Q Consensus        20 ~lvLiP~T~~~l   31 (104)
                      .+|++|.+.-.+
T Consensus        17 ~iVv~~i~~ali   28 (39)
T PF06596_consen   17 VIVVIPIAGALI   28 (39)
T ss_dssp             -HHHHHHHHHHH
T ss_pred             hhhhhhhhhheE
Confidence            378999998766


No 53 
>PF05434 Tmemb_9:  TMEM9;  InterPro: IPR008853 This family contains several eukaryotic transmembrane proteins which are homologous to Homo sapiens transmembrane protein 9 Q9P0T7 from SWISSPROT. The TMEM9 gene encodes a 183 amino-acid protein that contains an N-terminal signal peptide, a single transmembrane region, three potential N-glycosylation sites and three conserved cys-rich domains in the N terminus, but no known functional domains. The protein is highly conserved between species from Caenorhabditis elegans to H. sapiens and belongs to a novel family of transmembrane proteins. The exact function of TMEM9 is unknown although it has been found to be widely expressed and localised to the late endosomes and lysosomes []. Members of this family contain CXCXC repeats IPR004153 from INTERPRO in their N-terminal region.; GO: 0016021 integral to membrane
Probab=21.50  E-value=15  Score=25.54  Aligned_cols=14  Identities=29%  Similarity=0.971  Sum_probs=5.9

Q ss_pred             HHHHHHHHHHHHHH
Q 034094           72 LSLVLLWVIMIILI   85 (104)
Q Consensus        72 i~lv~gW~l~~~L~   85 (104)
                      +++++.|++.+.+.
T Consensus        57 vVIivl~Vi~lLvl   70 (149)
T PF05434_consen   57 VVIIVLWVIGLLVL   70 (149)
T ss_pred             EEEEeHHHHHHHHH
Confidence            33444454443333


No 54 
>COG5264 VTC1 Vacuolar transporter chaperone [Posttranslational modification, protein turnover, chaperones]
Probab=21.12  E-value=1.4e+02  Score=20.18  Aligned_cols=25  Identities=8%  Similarity=0.090  Sum_probs=17.9

Q ss_pred             HHHHHHHHHHHHHHHHhccccc-CccC
Q 034094           74 LVLLWVIMIILIYYIKSTSREV-WNMG   99 (104)
Q Consensus        74 lv~gW~l~~~L~y~i~~~~~~~-~~fD   99 (104)
                      .+..|+++.|+ ++.+.+..-. +.||
T Consensus        73 f~~~ya~~lY~-kRa~~Ir~R~~~pyD   98 (126)
T COG5264          73 FCGFYALMLYL-KRAVNIRQRSAGPYD   98 (126)
T ss_pred             HHHHHHHHHHH-HHHHHHHhcCCCCCc
Confidence            34589999888 7877776654 6665


No 55 
>PF11057 Cortexin:  Cortexin of kidney;  InterPro: IPR020066 Cortexin is a neuron-specific, 82-residue membrane protein which is found especially in vertebrate brain cortex tissue. It may mediate extracellular or intracellular signalling of cortical neurons during forebrain development. Cortexin is present at significant levels in the foetal brain, suggesting that it may be important to neurons of both the developing and adult cerebral cortex. Cortexin has a conserved single membrane-spanning region in the middle of each sequence []. In humans, there is selective expression of Cortexin 3 (CTXN3) in the kidney as well as the brain []. This entry contains Cortexins 1, 2 and 3.; GO: 0031224 intrinsic to membrane
Probab=20.95  E-value=75  Score=19.70  Aligned_cols=19  Identities=26%  Similarity=0.226  Sum_probs=12.2

Q ss_pred             ccCCCchhHHHHHHHhhhh
Q 034094            5 EENSQLFPIFILTIMALPL   23 (104)
Q Consensus         5 DE~g~~f~yFvlt~l~lvL   23 (104)
                      -|++.+|.|.++-++.+++
T Consensus        25 ~eqkt~faFV~~L~~fL~~   43 (81)
T PF11057_consen   25 LEQKTAFAFVGLLCLFLGL   43 (81)
T ss_pred             cccceeehHHHHHHHHHHH
Confidence            3788888887655444433


No 56 
>PF02937 COX6C:  Cytochrome c oxidase subunit VIc;  InterPro: IPR004204 Cytochrome c oxidase, a 13 subunit complex, 1.9.3.1 from EC is the terminal oxidase in the mitochondrial electron transport chain. This family is composed of cytochrome c oxidase subunit VIc.; GO: 0004129 cytochrome-c oxidase activity; PDB: 3AG4_I 2DYS_V 3ASO_I 2EIK_V 2EIM_I 1OCC_V 1V54_V 1OCO_V 3ASN_V 2EIL_I ....
Probab=20.84  E-value=72  Score=19.38  Aligned_cols=33  Identities=9%  Similarity=0.188  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHhccc------cc-CccCCcc
Q 034094           70 SNLSLVLLWVIMIILIYYIKSTSR------EV-WNMGPQI  102 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i~~~~~------~~-~~fDPye  102 (104)
                      +++++.+.=.+.+..+++....++      |- +.|||++
T Consensus        19 ~~i~~a~~ls~~~~~~~kf~v~~pRKk~YadFYknYD~~k   58 (73)
T PF02937_consen   19 RHIVVAFVLSLGVAAAYKFGVAEPRKKAYADFYKNYDPMK   58 (73)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHT--HHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHccChHH
Confidence            445444444445555555422221      33 6789874


No 57 
>PF04341 DUF485:  Protein of unknown function, DUF485;  InterPro: IPR007436 This family includes several putative integral membrane proteins.
Probab=20.78  E-value=1.3e+02  Score=18.63  Aligned_cols=18  Identities=17%  Similarity=0.381  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIILIYY   87 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~   87 (104)
                      -...++++|++..+-+.+
T Consensus        59 g~~~~~~~~~l~~~Yv~~   76 (91)
T PF04341_consen   59 GLGQIVFAWVLTWLYVRR   76 (91)
T ss_pred             HHHHHHHHHHHHHHHHHH
Confidence            445566788887766555


No 58 
>PRK07899 rpsA 30S ribosomal protein S1; Reviewed
Probab=20.63  E-value=42  Score=27.45  Aligned_cols=9  Identities=22%  Similarity=0.320  Sum_probs=7.8

Q ss_pred             CccccCCCc
Q 034094            2 AATEENSQL   10 (104)
Q Consensus         2 ~~YDE~g~~   10 (104)
                      |+|||+|+.
T Consensus       385 ~~~~~~~~~  393 (486)
T PRK07899        385 AEYDEQGNY  393 (486)
T ss_pred             cccccCCCc
Confidence            789999974


No 59 
>PF14475 Mso1_Sec1_bdg:  Sec1-binding region of Mso1
Probab=20.39  E-value=29  Score=18.92  Aligned_cols=11  Identities=27%  Similarity=0.301  Sum_probs=8.4

Q ss_pred             ccccCCCchhH
Q 034094            3 ATEENSQLFPI   13 (104)
Q Consensus         3 ~YDE~g~~f~y   13 (104)
                      =|+|.|+.||=
T Consensus        29 yY~~k~~~~P~   39 (41)
T PF14475_consen   29 YYTEKGRPFPG   39 (41)
T ss_pred             HHHHcCCCCCC
Confidence            48888888873


No 60 
>PHA02955 hypothetical protein; Provisional
Probab=20.22  E-value=79  Score=23.27  Aligned_cols=28  Identities=18%  Similarity=0.145  Sum_probs=20.8

Q ss_pred             CCchhHHHHHHHhhhhhhhhhhhhhccc
Q 034094            8 SQLFPIFILTIMALPLVPYTILKLCHAF   35 (104)
Q Consensus         8 g~~f~yFvlt~l~lvLiP~T~~~l~~~~   35 (104)
                      |..+|+|++....++++-+.++.++|..
T Consensus       176 g~~~~w~ii~~v~ii~~~v~l~yikR~i  203 (213)
T PHA02955        176 SFSIKWFIIYIVLCLLILIILGYIYRTV  203 (213)
T ss_pred             CCCCcchhHHHHHHHHHHHHHHHHHHHh
Confidence            5577888888888877777777776553


No 61 
>PF05461 ApoL:  Apolipoprotein L;  InterPro: IPR008405 Apo L belongs to the high density lipoprotein family that plays a central role in cholesterol transport. The cholesterol content of membranes is important in cellular processes such as modulating gene transcription and signal transduction both in the adult brain and during neurodevelopment. There are six apo L genes located in close proximity to each other on chromosome 22q12 in humans. 22q12 is a confirmed high-susceptibility locus for schizophrenia and close to the region associated with velocardiofacial syndrome that includes symptoms of schizophrenia []. The various functions of apoL are still not entirely clear. Apolipoprotein L-I has been identified as a trypanolytic agent [] and displays similar phylogenetic distribution to the programmed cell death protein Bcl-2 and BH-3 domain-containing proteins, suggesting a possible role in apoptosis [].; GO: 0008289 lipid binding, 0006869 lipid transport, 0042157 lipoprotein metabolic process, 0005576 extracellular region
Probab=20.20  E-value=50  Score=25.46  Aligned_cols=14  Identities=50%  Similarity=0.795  Sum_probs=12.6

Q ss_pred             HHHHHhhhhhhhhh
Q 034094           15 ILTIMALPLVPYTI   28 (104)
Q Consensus        15 vlt~l~lvLiP~T~   28 (104)
                      ++|+++++|.|.|.
T Consensus       111 ilsIlGLaLAPvT~  124 (313)
T PF05461_consen  111 ILSILGLALAPVTA  124 (313)
T ss_pred             HHHHHhHHhccccc
Confidence            68999999999984


No 62 
>PRK10873 hypothetical protein; Provisional
Probab=20.10  E-value=1.2e+02  Score=20.35  Aligned_cols=20  Identities=25%  Similarity=0.504  Sum_probs=16.1

Q ss_pred             HHHHHHHHHHHHHHHHHHHH
Q 034094           70 SNLSLVLLWVIMIILIYYIK   89 (104)
Q Consensus        70 ~~i~lv~gW~l~~~L~y~i~   89 (104)
                      -=+.+++||+++++-+.+.+
T Consensus       105 GG~~li~GWl~la~~a~~~~  124 (131)
T PRK10873        105 GGVSFLAGWALMLIGALRLK  124 (131)
T ss_pred             HHHHHHHHHHHHHHHHHHhc
Confidence            66788899999998877653


Done!