Query         034099
Match_columns 104
No_of_seqs    20 out of 22
Neff          2.5 
Searched_HMMs 46136
Date          Fri Mar 29 09:46:04 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034099.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034099hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF07172 GRP:  Glycine rich pro  83.4     1.1 2.4E-05   31.1   2.5   18   16-33      6-23  (95)
  2 KOG3164 Uncharacterized protei  81.6    0.74 1.6E-05   37.5   1.2   16   88-103   192-207 (236)
  3 PF09680 Tiny_TM_bacill:  Prote  71.6     3.7 7.9E-05   23.3   1.8   15   17-31      7-21  (24)
  4 TIGR01732 tiny_TM_bacill conse  71.6     3.6 7.9E-05   23.6   1.9   16   17-32      9-24  (26)
  5 PF10669 Phage_Gp23:  Protein g  38.6      27 0.00058   26.1   2.1   11   17-27     22-32  (121)
  6 PLN02708 Probable pectinestera  36.9      52  0.0011   29.2   4.0   30   18-47      5-35  (553)
  7 PF07265 TAP35_44:  Tapetum spe  33.2      54  0.0012   24.5   3.0   18   20-37      9-26  (119)
  8 PF13956 Ibs_toxin:  Toxin Ibs,  32.3      22 0.00048   19.2   0.7   12   19-30      5-16  (19)
  9 PF04367 DUF502:  Protein of un  31.8      24 0.00051   24.2   0.9   12   91-102    96-107 (108)
 10 PF07127 Nodulin_late:  Late no  30.6      58  0.0013   19.9   2.5   13   17-29      8-20  (54)
 11 COG5374 Uncharacterized conser  30.4      44 0.00095   26.8   2.3   25    9-33     41-67  (192)
 12 PF05564 Auxin_repressed:  Dorm  28.6      87  0.0019   23.0   3.4   20   80-99     82-101 (119)
 13 MTH00261 ATP8 ATP synthase F0   27.1      71  0.0015   21.8   2.6    9   21-29     19-27  (68)
 14 PF01004 Flavi_M:  Flavivirus e  26.5      52  0.0011   22.4   1.8   13   21-33     62-74  (75)
 15 PF13198 DUF4014:  Protein of u  25.1      62  0.0013   22.4   2.0   14   15-29     18-31  (72)
 16 PF10717 ODV-E18:  Occlusion-de  24.2 1.5E+02  0.0032   21.1   3.8    8   23-30     37-44  (85)
 17 PF02038 ATP1G1_PLM_MAT8:  ATP1  23.4      97  0.0021   20.0   2.6   16   17-32     20-35  (50)
 18 PLN00055 photosystem II reacti  23.0      70  0.0015   22.1   1.9   17   17-33     45-61  (73)
 19 PLN03207 stomagen; Provisional  22.6      74  0.0016   23.6   2.2   21   82-102    81-102 (113)
 20 CHL00066 psbH photosystem II p  22.3      73  0.0016   22.1   1.9   18   17-34     45-62  (73)
 21 KOG2678 Predicted membrane pro  21.6      63  0.0014   26.7   1.8   14    8-21    208-222 (244)
 22 PHA02973 hypothetical protein;  21.6      64  0.0014   23.6   1.6    7   18-24      3-9   (102)
 23 PRK02624 psbH photosystem II r  21.3      80  0.0017   21.4   1.9   18   17-34     33-50  (64)

No 1  
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=83.42  E-value=1.1  Score=31.14  Aligned_cols=18  Identities=22%  Similarity=0.168  Sum_probs=10.1

Q ss_pred             HHHHHHHHHHHHHHhccC
Q 034099           16 LLFALVCFIFLLFQFSTT   33 (104)
Q Consensus        16 l~F~~l~fIlllli~~s~   33 (104)
                      ++||+|||..||||++..
T Consensus         6 ~llL~l~LA~lLlisSev   23 (95)
T PF07172_consen    6 FLLLGLLLAALLLISSEV   23 (95)
T ss_pred             HHHHHHHHHHHHHHHhhh
Confidence            455556666666665443


No 2  
>KOG3164 consensus Uncharacterized proteins of PilT N-term./Vapc superfamily [General function prediction only]
Probab=81.65  E-value=0.74  Score=37.54  Aligned_cols=16  Identities=38%  Similarity=0.742  Sum_probs=12.9

Q ss_pred             CCccccCCCCCCCCCC
Q 034099           88 GADEHEVPSGPNPISN  103 (104)
Q Consensus        88 ~a~kHEVPSGPNPiSN  103 (104)
                      ..-+|.+|+||||+|=
T Consensus       192 ~~kk~k~~k~pNpLs~  207 (236)
T KOG3164|consen  192 KEKKRKGPKGPNPLSC  207 (236)
T ss_pred             hhhcCCCCCCCCCccc
Confidence            4457889999999983


No 3  
>PF09680 Tiny_TM_bacill:  Protein of unknown function (Tiny_TM_bacill);  InterPro: IPR010070 This entry represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=71.60  E-value=3.7  Score=23.26  Aligned_cols=15  Identities=27%  Similarity=0.421  Sum_probs=10.9

Q ss_pred             HHHHHHHHHHHHHhc
Q 034099           17 LFALVCFIFLLFQFS   31 (104)
Q Consensus        17 ~F~~l~fIlllli~~   31 (104)
                      -++.++||||+++.-
T Consensus         7 alivVLFILLiIvG~   21 (24)
T PF09680_consen    7 ALIVVLFILLIIVGA   21 (24)
T ss_pred             hhHHHHHHHHHHhcc
Confidence            456688888887754


No 4  
>TIGR01732 tiny_TM_bacill conserved hypothetical tiny transmembrane protein. This model represents a family of hypothetical proteins, half of which are 40 residues or less in length. Members are found only in spore-forming species. A Gly-rich variable region is followed by a strongly conserved, highly hydrophobic region, predicted to form a transmembrane helix, ending with an invariant Gly. The consensus for this stretch is FALLVVFILLIIV.
Probab=71.58  E-value=3.6  Score=23.64  Aligned_cols=16  Identities=25%  Similarity=0.386  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHhcc
Q 034099           17 LFALVCFIFLLFQFST   32 (104)
Q Consensus        17 ~F~~l~fIlllli~~s   32 (104)
                      -++.++||||+++..+
T Consensus         9 ~livVLFILLIIiga~   24 (26)
T TIGR01732         9 ALIVVLFILLVIVGAA   24 (26)
T ss_pred             HHHHHHHHHHHHhhee
Confidence            4667888888887643


No 5  
>PF10669 Phage_Gp23:  Protein gp23 (Bacteriophage A118);  InterPro: IPR018926  This entry is represented by the major tail subunit protein, Gp23 of Listeria phage A118 and prophage found in Bacilli. The function is currently unknown. 
Probab=38.63  E-value=27  Score=26.08  Aligned_cols=11  Identities=45%  Similarity=0.860  Sum_probs=5.6

Q ss_pred             HHHHHHHHHHH
Q 034099           17 LFALVCFIFLL   27 (104)
Q Consensus        17 ~F~~l~fIlll   27 (104)
                      +|+++|+|||+
T Consensus        22 L~i~~FiILLI   32 (121)
T PF10669_consen   22 LFIVVFIILLI   32 (121)
T ss_pred             HHHHHHHHHHH
Confidence            55555555444


No 6  
>PLN02708 Probable pectinesterase/pectinesterase inhibitor
Probab=36.90  E-value=52  Score=29.15  Aligned_cols=30  Identities=20%  Similarity=0.334  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHHhccCCC-CcCCCCCCCCCc
Q 034099           18 FALVCFIFLLFQFSTTDP-IKASPSKPDSSV   47 (104)
Q Consensus        18 F~~l~fIlllli~~s~~~-~~~~~~~~~~s~   47 (104)
                      |++||+++||+..+.... .++.|-..+++.
T Consensus         5 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   35 (553)
T PLN02708          5 LLLLLLSLLLFHSPSSSSNRHHHHHTPSPSP   35 (553)
T ss_pred             HHHHHHHHHHHhccccccCcccccCCCCCCC
Confidence            443444444444333333 444444444433


No 7  
>PF07265 TAP35_44:  Tapetum specific protein TAP35/TAP44;  InterPro: IPR009891 This family consists of several plant tapetum specific proteins. Members of this family are found in Arabidopsis thaliana, Brassica napus and Sinapis alba. Members of this family may be involved in sporopollenin formation and/or deposition [].
Probab=33.24  E-value=54  Score=24.52  Aligned_cols=18  Identities=22%  Similarity=0.645  Sum_probs=10.6

Q ss_pred             HHHHHHHHHHhccCCCCc
Q 034099           20 LVCFIFLLFQFSTTDPIK   37 (104)
Q Consensus        20 ~l~fIlllli~~s~~~~~   37 (104)
                      .||+|||.+.+++.|+--
T Consensus         9 slcLlll~~ff~sS~pa~   26 (119)
T PF07265_consen    9 SLCLLLLVVFFLSSQPAL   26 (119)
T ss_pred             HHHHHHHHHHHHcCchhh
Confidence            356666666666666543


No 8  
>PF13956 Ibs_toxin:  Toxin Ibs, type I toxin-antitoxin system
Probab=32.31  E-value=22  Score=19.17  Aligned_cols=12  Identities=25%  Similarity=0.719  Sum_probs=5.3

Q ss_pred             HHHHHHHHHHHh
Q 034099           19 ALVCFIFLLFQF   30 (104)
Q Consensus        19 ~~l~fIlllli~   30 (104)
                      +.++++||++.+
T Consensus         5 vIIlvvLLliSf   16 (19)
T PF13956_consen    5 VIILVVLLLISF   16 (19)
T ss_pred             hHHHHHHHhccc
Confidence            334444554443


No 9  
>PF04367 DUF502:  Protein of unknown function (DUF502);  InterPro: IPR007462 This entry contains proteins that are predicted to be integral membrane proteins.
Probab=31.84  E-value=24  Score=24.21  Aligned_cols=12  Identities=50%  Similarity=0.767  Sum_probs=9.7

Q ss_pred             cccCCCCCCCCC
Q 034099           91 EHEVPSGPNPIS  102 (104)
Q Consensus        91 kHEVPSGPNPiS  102 (104)
                      .--||+.|||.+
T Consensus        96 ~VfvPtsPnPts  107 (108)
T PF04367_consen   96 AVFVPTSPNPTS  107 (108)
T ss_pred             EEEeCCCCCCCC
Confidence            445899999986


No 10 
>PF07127 Nodulin_late:  Late nodulin protein;  InterPro: IPR009810 This family consists of several plant specific late nodulin sequences which are homologous to the Pisum sativum (Garden pea) ENOD3 protein. ENOD3 is expressed in the late stages of root nodule formation and contains two pairs of cysteine residues toward the proteins C terminus which may be involved in metal-binding [].; GO: 0046872 metal ion binding, 0009878 nodule morphogenesis
Probab=30.62  E-value=58  Score=19.93  Aligned_cols=13  Identities=23%  Similarity=0.708  Sum_probs=6.3

Q ss_pred             HHHHHHHHHHHHH
Q 034099           17 LFALVCFIFLLFQ   29 (104)
Q Consensus        17 ~F~~l~fIlllli   29 (104)
                      .|+.++|++|+++
T Consensus         8 vY~mIiflslflv   20 (54)
T PF07127_consen    8 VYAMIIFLSLFLV   20 (54)
T ss_pred             HHHHHHHHHHHHh
Confidence            4554555544444


No 11 
>COG5374 Uncharacterized conserved protein [Function unknown]
Probab=30.37  E-value=44  Score=26.78  Aligned_cols=25  Identities=28%  Similarity=0.150  Sum_probs=15.3

Q ss_pred             cccchhHH--HHHHHHHHHHHHHhccC
Q 034099            9 YTKSYSLL--LFALVCFIFLLFQFSTT   33 (104)
Q Consensus         9 ~~KS~~~l--~F~~l~fIlllli~~s~   33 (104)
                      ..++-.|.  .+++++||+||||-+..
T Consensus        41 ~~~~~~~k~il~i~~~~IllLFiDS~~   67 (192)
T COG5374          41 SKVYRGFKHILKITFIFILLLFIDSWK   67 (192)
T ss_pred             hhhhhhhHHHHHHHHHHHHHHHHHHhH
Confidence            34444555  56666777888876543


No 12 
>PF05564 Auxin_repressed:  Dormancy/auxin associated protein;  InterPro: IPR008406 This family contains several plant dormancy-associated and auxin-repressed proteins the function of which is poorly understood [].
Probab=28.56  E-value=87  Score=23.01  Aligned_cols=20  Identities=30%  Similarity=0.589  Sum_probs=16.4

Q ss_pred             CCCCCCccCCccccCCCCCC
Q 034099           80 TPSNGQQLGADEHEVPSGPN   99 (104)
Q Consensus        80 ~~s~gref~a~kHEVPSGPN   99 (104)
                      ++-+.+..++++.+.|+.||
T Consensus        82 sn~atk~~Ga~~fdkp~~Pn  101 (119)
T PF05564_consen   82 SNLATKSIGANKFDKPSEPN  101 (119)
T ss_pred             cccchhhhccccccCCCCCC
Confidence            45677788899999998888


No 13 
>MTH00261 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=27.11  E-value=71  Score=21.77  Aligned_cols=9  Identities=22%  Similarity=0.729  Sum_probs=3.7

Q ss_pred             HHHHHHHHH
Q 034099           21 VCFIFLLFQ   29 (104)
Q Consensus        21 l~fIlllli   29 (104)
                      ++|||+++|
T Consensus        19 lf~iliili   27 (68)
T MTH00261         19 LFFILIILI   27 (68)
T ss_pred             HHHHHHHHH
Confidence            334444443


No 14 
>PF01004 Flavi_M:  Flavivirus envelope glycoprotein M;  InterPro: IPR000069 Flaviviruses are small enveloped viruses with virions comprised of three proteins called C, M and E [, , ]. The envelope glycoprotein M is made as a precursor, called prM. The precursor portion of the protein is the signal peptide for the proteins entry into the membrane. prM is cleaved to form M in a late-stage cleavage event. Associated with this cleavage is a change in the infectivity and fusion activity of the virus.; GO: 0019058 viral infectious cycle, 0019028 viral capsid
Probab=26.52  E-value=52  Score=22.42  Aligned_cols=13  Identities=23%  Similarity=0.375  Sum_probs=9.5

Q ss_pred             HHHHHHHHHhccC
Q 034099           21 VCFIFLLFQFSTT   33 (104)
Q Consensus        21 l~fIlllli~~s~   33 (104)
                      ++||++++|-|.+
T Consensus        62 i~iillllvaPaY   74 (75)
T PF01004_consen   62 IFIILLLLVAPAY   74 (75)
T ss_pred             HHHHHHHHhcccc
Confidence            3667888887765


No 15 
>PF13198 DUF4014:  Protein of unknown function (DUF4014)
Probab=25.12  E-value=62  Score=22.38  Aligned_cols=14  Identities=14%  Similarity=0.505  Sum_probs=5.9

Q ss_pred             HHHHHHHHHHHHHHH
Q 034099           15 LLLFALVCFIFLLFQ   29 (104)
Q Consensus        15 ~l~F~~l~fIlllli   29 (104)
                      |++|+ ++|++++.|
T Consensus        18 fLF~i-lfIvlmipI   31 (72)
T PF13198_consen   18 FLFFI-LFIVLMIPI   31 (72)
T ss_pred             HHHHH-HHHHHHHHH
Confidence            44444 444444333


No 16 
>PF10717 ODV-E18:  Occlusion-derived virus envelope protein ODV-E18;  InterPro: IPR019655  Baculovirus occlusion-derived virus (ODV) derives its envelope from an intranuclear membrane source. Occlusion-derived viral envelope proteins that are detected in viral-induced intranuclear microvesicles, but not detected in the plasma membrane, cytoplasmic membranes, or the nuclear envelope. This entry represents ODV-E18 protein which is encoded by baculovirus late genes with transcription initiating from a TAAG motif. ODV-E18 exists as a dimer in the ODV envelope, which contains a hydrophobic domain that putatively acts as a target or retention signal for intranuclear microvesicles []. ; GO: 0019031 viral envelope
Probab=24.19  E-value=1.5e+02  Score=21.13  Aligned_cols=8  Identities=38%  Similarity=0.866  Sum_probs=3.3

Q ss_pred             HHHHHHHh
Q 034099           23 FIFLLFQF   30 (104)
Q Consensus        23 fIlllli~   30 (104)
                      ||||++++
T Consensus        37 IiLlImlf   44 (85)
T PF10717_consen   37 IILLIMLF   44 (85)
T ss_pred             HHHHHHHH
Confidence            33444443


No 17 
>PF02038 ATP1G1_PLM_MAT8:  ATP1G1/PLM/MAT8 family;  InterPro: IPR000272  The FXYD protein family contains at least seven members in mammals []. Two other family members that are not obvious orthologs of any identified mammalian FXYD protein exist in zebrafish. All these proteins share a signature sequence of six conserved amino acids comprising the FXYD motif in the NH2-terminus, and two glycines and one serine residue in the transmembrane domain. FXYD proteins are widely distributed in mammalian tissues with prominent expression in tissues that perform fluid and solute transport or that are electrically excitable.   Initial functional characterisation suggested that FXYD proteins act as channels or as modulators of ion channels however studies have revealed that most FXYD proteins have another specific function and act as tissue-specific regulatory subunits of the Na,K-ATPase. Each of these auxiliary subunits produces a distinct functional effect on the transport characteristics of the Na,K-ATPase that is adjusted to the specific functional demands of the tissue in which the FXYD protein is expressed. FXYD proteins appear to preferentially associate with Na,K-ATPase alpha1-beta isozymes, and affect their function in a way that render them operationally complementary or supplementary to coexisting isozymes.; GO: 0005216 ion channel activity, 0006811 ion transport, 0016020 membrane; PDB: 2JO1_A 2JP3_A 2ZXE_G 3A3Y_G 3N23_E 3B8E_H 3KDP_G 3N2F_E.
Probab=23.40  E-value=97  Score=19.97  Aligned_cols=16  Identities=31%  Similarity=0.451  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHhcc
Q 034099           17 LFALVCFIFLLFQFST   32 (104)
Q Consensus        17 ~F~~l~fIlllli~~s   32 (104)
                      .|++|+||+-++|.++
T Consensus        20 i~A~vlfi~Gi~iils   35 (50)
T PF02038_consen   20 IFAGVLFILGILIILS   35 (50)
T ss_dssp             HHHHHHHHHHHHHHCT
T ss_pred             HHHHHHHHHHHHHHHc
Confidence            7888899866666554


No 18 
>PLN00055 photosystem II reaction center protein H; Provisional
Probab=22.96  E-value=70  Score=22.15  Aligned_cols=17  Identities=12%  Similarity=0.141  Sum_probs=11.0

Q ss_pred             HHHHHHHHHHHHHhccC
Q 034099           17 LFALVCFIFLLFQFSTT   33 (104)
Q Consensus        17 ~F~~l~fIlllli~~s~   33 (104)
                      .|.+||++||++|.-.+
T Consensus        45 ~~m~lf~vfl~iileiy   61 (73)
T PLN00055         45 VAMALFAVFLSIILEIY   61 (73)
T ss_pred             HHHHHHHHHHHHHHHHh
Confidence            67777777776665443


No 19 
>PLN03207 stomagen; Provisional
Probab=22.60  E-value=74  Score=23.63  Aligned_cols=21  Identities=29%  Similarity=0.599  Sum_probs=15.0

Q ss_pred             CCCCccCCccccCCC-CCCCCC
Q 034099           82 SNGQQLGADEHEVPS-GPNPIS  102 (104)
Q Consensus        82 s~gref~a~kHEVPS-GPNPiS  102 (104)
                      -||-.|+-.+-+||- |-+||.
T Consensus        81 crgcr~kc~~eqvpv~~~dp~n  102 (113)
T PLN03207         81 CRGCRYKCRAEQVPVEGNDPIN  102 (113)
T ss_pred             ccCccccccceeccccCCCCCc
Confidence            466678888889995 556663


No 20 
>CHL00066 psbH photosystem II protein H
Probab=22.32  E-value=73  Score=22.07  Aligned_cols=18  Identities=11%  Similarity=0.174  Sum_probs=11.6

Q ss_pred             HHHHHHHHHHHHHhccCC
Q 034099           17 LFALVCFIFLLFQFSTTD   34 (104)
Q Consensus        17 ~F~~l~fIlllli~~s~~   34 (104)
                      .|.+||++||++|.-.+-
T Consensus        45 v~m~lf~vfl~iiLeiyN   62 (73)
T CHL00066         45 VAMALFAVFLSIILEIYN   62 (73)
T ss_pred             HHHHHHHHHHHHHHHHhC
Confidence            677777777776654443


No 21 
>KOG2678 consensus Predicted membrane protein [Function unknown]
Probab=21.65  E-value=63  Score=26.72  Aligned_cols=14  Identities=29%  Similarity=0.460  Sum_probs=7.3

Q ss_pred             ccccch-hHHHHHHH
Q 034099            8 TYTKSY-SLLLFALV   21 (104)
Q Consensus         8 T~~KS~-~~l~F~~l   21 (104)
                      -+.||+ ++++++++
T Consensus       208 ~y~ksk~s~wf~~~m  222 (244)
T KOG2678|consen  208 KYDKSKLSYWFYITM  222 (244)
T ss_pred             HHHHhhhhHHHHHHH
Confidence            456666 55544433


No 22 
>PHA02973 hypothetical protein; Provisional
Probab=21.64  E-value=64  Score=23.56  Aligned_cols=7  Identities=43%  Similarity=0.899  Sum_probs=3.1

Q ss_pred             HHHHHHH
Q 034099           18 FALVCFI   24 (104)
Q Consensus        18 F~~l~fI   24 (104)
                      |+.++||
T Consensus         3 ~~l~fFi    9 (102)
T PHA02973          3 FLIFFFI    9 (102)
T ss_pred             hHHHHHH
Confidence            3334455


No 23 
>PRK02624 psbH photosystem II reaction center protein H; Provisional
Probab=21.31  E-value=80  Score=21.44  Aligned_cols=18  Identities=22%  Similarity=0.593  Sum_probs=11.5

Q ss_pred             HHHHHHHHHHHHHhccCC
Q 034099           17 LFALVCFIFLLFQFSTTD   34 (104)
Q Consensus        17 ~F~~l~fIlllli~~s~~   34 (104)
                      .|.+||++||++|.-.+.
T Consensus        33 v~m~Lf~vFl~iiLeIYN   50 (64)
T PRK02624         33 VFMVLFLVFLLIILQIYN   50 (64)
T ss_pred             HHHHHHHHHHHHHHHHhC
Confidence            577777777766654443


Done!