Citrus Sinensis ID: 034103


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQA
ccccHHHHHHcHHHHHHccHHHHHHHHHHHcccccccHHHHHHcHHHHHHHHccccHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHcc
MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable V-type proton ATPase subunit H Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit H activates the ATPase activity of the enzyme and couples ATPase activity to proton flow. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.probableQ84ZC0
V-type proton ATPase subunit H Subunit of the peripheral V1 complex of vacuolar ATPase. Subunit H activates the ATPase activity of the enzyme and couples ATPase activity to proton flow. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system.probableQ9LX65

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HO8, chain A
Confidence level:very confident
Coverage over the Query: 1-95
View the alignment between query and template
View the model in PyMOL