Citrus Sinensis ID: 034107

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MSSGQGKKRLTNNSGEVGFLAKVTRRVSDTPIVAYTKQKASDAAYVSHKLLKSTGKAAWIAGTTFLILVVPLIIEMDREQQFNELEMQQQSLLGAPPLAPAQK
ccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEccEEEEEEEHHEEEEcHHHHHHHHHHHHHHHHcccccccccc
*********************K**RRVSDTPIVAYTKQKASDAAYVSHKLLKSTGKAAWIAGTTFLILVVPLIIEMDREQQFNELEM****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSGQGKKRLTNNSGEVGFLAKVTRRVSDTPIVAYTKQKASDAAYVSHKLLKSTGKAAWIAGTTFLILVVPLIIEMDREQQFNELEMQQQSLLGAPPLAPAQK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitochondrial import receptor subunit TOM9-2 Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM20 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore.probableQ9FNC9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted