Query         034116
Match_columns 103
No_of_seqs    104 out of 173
Neff          4.8 
Searched_HMMs 46136
Date          Fri Mar 29 09:57:01 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034116.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034116hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF08293 MRP-S33:  Mitochondria 100.0 5.2E-36 1.1E-40  201.7   7.5   78   15-92      2-87  (87)
  2 KOG4844 Mitochondrial ribosoma 100.0 5.9E-31 1.3E-35  180.6   6.7   91   13-103     5-102 (102)
  3 KOG4104 Ganglioside-induced di 100.0 1.6E-29 3.5E-34  175.5   5.3   98    4-102     4-113 (113)
  4 PF12752 SUZ:  SUZ domain;  Int  61.1     8.5 0.00018   23.7   2.2   16   14-29     42-57  (59)
  5 PF04844 Ovate:  Transcriptiona  32.3      54  0.0012   20.7   2.5   19   68-86      2-20  (59)
  6 TIGR03398 plc_access_R phospho  29.2      69  0.0015   23.6   3.0   29    6-35    106-139 (141)
  7 PF06904 Extensin-like_C:  Exte  26.1      67  0.0014   24.2   2.6   27   11-37    131-157 (178)
  8 PF07874 DUF1660:  Prophage pro  24.7      23 0.00049   22.9  -0.1   13   21-33      2-14  (64)
  9 PF14907 NTP_transf_5:  Unchara  24.1      38 0.00083   24.9   0.9   27   47-73     77-106 (249)
 10 TIGR01568 A_thal_3678 uncharac  20.5 1.1E+02  0.0025   19.7   2.5   19   68-86      8-26  (66)
 11 PRK13868 type IV secretion sys  20.3      64  0.0014   28.0   1.6   31    5-60    134-164 (556)

No 1  
>PF08293 MRP-S33:  Mitochondrial ribosomal subunit S27;  InterPro: IPR013219 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This entry represents a mitochondrial ribosomal subunit annotated as S27 in yeast and S33 in humans [, ]. It is a small 106 residue protein. The evolutionary history of the mitoribosomal proteome that is encoded by a diverse subset of eukaryotic genomes, reveals an ancestral ribosome of alpha-proteobacterial descent that more than doubled its protein content in most eukaryotic lineages. Several new MRPs have originated via duplication of existing MRPs as well as by recruitment from outside of the mitoribosomal proteome [].
Probab=100.00  E-value=5.2e-36  Score=201.74  Aligned_cols=78  Identities=47%  Similarity=0.728  Sum_probs=73.2

Q ss_pred             HHHHHHHHHHhhhcccCCCCCCCchhHHhhhccccccccccCCCCCC--------ccCCCCCChHHHHHHHHHHHHHhcC
Q 034116           15 VTTGLTEARAKIFGHVLNPAGQRSPHKILRKKLIGDKVAGWYPYDIK--------KDDPLVMARQQQERLSKLEMLKRRG   86 (103)
Q Consensus        15 r~~~l~~ls~rIFg~~~nPt~~Rsg~kvlr~~lkG~~v~~YYP~~~~--------r~~g~~~De~e~~R~~~~~~rk~RG   86 (103)
                      |+++|++|||+||||++|||++|||+||||++|+|++|++|||+++.        +.+++|+||||++|+++++++++||
T Consensus         2 r~~~l~~ls~rIFg~~~nP~~~Rsg~Kilr~~lkg~~~~~YYP~~~~~~~~l~~l~~~~~~~De~e~~R~e~~~~rk~RG   81 (87)
T PF08293_consen    2 RLLRLARLSARIFGTVYNPTGSRSGNKILRKRLKGPKLASYYPPHIVTFKLLKRLRPDGLFRDEHEDFREEMVELRKRRG   81 (87)
T ss_pred             HHHHHHHHHHHHhCCCCCCccchHHHHHHhhcCCCchHhHhCCCcchHHHHHHHHccccCcCChhHHHHHHHHHHHHhCC
Confidence            78999999999999999999999999999999999999999999763        3455699999999999999999999


Q ss_pred             CCCCCC
Q 034116           87 KGPPKK   92 (103)
Q Consensus        87 Kg~PKK   92 (103)
                      ||+|||
T Consensus        82 Kg~PKK   87 (87)
T PF08293_consen   82 KGPPKK   87 (87)
T ss_pred             CCCCCC
Confidence            999997


No 2  
>KOG4844 consensus Mitochondrial ribosomal protein S27 [Translation, ribosomal structure and biogenesis]
Probab=99.97  E-value=5.9e-31  Score=180.60  Aligned_cols=91  Identities=63%  Similarity=0.887  Sum_probs=84.4

Q ss_pred             HHHHHHHHHHHHhhhcccCCCCCCCchhHHhhhccccccccccCCCCC-CccCC------CCCChHHHHHHHHHHHHHhc
Q 034116           13 TVVTTGLTEARAKIFGHVLNPAGQRSPHKILRKKLIGDKVAGWYPYDI-KKDDP------LVMARQQQERLSKLEMLKRR   85 (103)
Q Consensus        13 ~~r~~~l~~ls~rIFg~~~nPt~~Rsg~kvlr~~lkG~~v~~YYP~~~-~r~~g------~~~De~e~~R~~~~~~rk~R   85 (103)
                      +|++..++.||++||||.|||||+|||+|||+++|+|+.|++|||+.+ ++.++      .|.|-+|+.|+++++.+++|
T Consensus         5 kAvl~~v~elsakIFg~~~np~g~Rtg~Kil~~~LkG~kvasyYp~~~~~r~l~tll~d~ef~d~~e~~R~s~~e~~kRr   84 (102)
T KOG4844|consen    5 KAVLRGVTELSAKIFGHMLNPTGQRTGHKILRKKLKGDKVASYYPPYDIKRELPTLLADEEFDDIAEWGRISKLEMLKRR   84 (102)
T ss_pred             HHHHHHHHHHHHHHHhcccCCCCCcchhHHHHHHhccchHhhhcchHHhhhhhhhhhcccccccHHHHHHHHHHHHHHHc
Confidence            899999999999999999999999999999999999999999999954 46555      28899999999999999999


Q ss_pred             CCCCCCCCCChhHhhhcC
Q 034116           86 GKGPPKKGQGKRAAKRSK  103 (103)
Q Consensus        86 GKg~PKKg~gkra~kkk~  103 (103)
                      |||+|||++++++++.++
T Consensus        85 gKGapKk~kk~~aa~~~~  102 (102)
T KOG4844|consen   85 GKGAPKKGKKKRAAKRNK  102 (102)
T ss_pred             cCCCCcccchhhhhhccC
Confidence            999999999999988764


No 3  
>KOG4104 consensus Ganglioside-induced differentiation associated protein 3 [Signal transduction mechanisms]
Probab=99.96  E-value=1.6e-29  Score=175.49  Aligned_cols=98  Identities=28%  Similarity=0.443  Sum_probs=88.1

Q ss_pred             chhhhhhhhHHHHHHHHHHHHhhhcccCCCCCCCchhHH--hhhcc--ccccccccCCCCCC--------ccCCCCCChH
Q 034116            4 GGRLKNILATVVTTGLTEARAKIFGHVLNPAGQRSPHKI--LRKKL--IGDKVAGWYPYDIK--------KDDPLVMARQ   71 (103)
Q Consensus         4 ~~~~~~~~s~~r~~~l~~ls~rIFg~~~nPt~~Rsg~kv--lr~~l--kG~~v~~YYP~~~~--------r~~g~~~De~   71 (103)
                      +|.+-+.||. +..+|++||++|||+|.+|||.+|+++|  ||+.|  +-+++.+|||++..        |++|+|+|||
T Consensus         4 ~~~~is~~t~-ya~RM~rLSnRvfGEV~rpTn~KSmKVVr~fSeeP~~kk~~~~~wYPnh~~~h~Lmk~LRf~GLfrDeH   82 (113)
T KOG4104|consen    4 AGRGISQPTP-YAKRMDRLSNRVFGEVVRPTNTKSMKVVRVFSEEPYEKKEQLSKWYPNHPMFHYLMKMLRFHGLFRDEH   82 (113)
T ss_pred             cccccCCccH-HHHHHHHHHHHHHhhccccCCCcceehhhhccccchhhHHHHHHhccCchHHHHHHHHHHHhhhhhhhH
Confidence            4445556665 8899999999999999999999999976  99999  56889999999653        8999999999


Q ss_pred             HHHHHHHHHHHHhcCCCCCCCCCChhHhhhc
Q 034116           72 QQERLSKLEMLKRRGKGPPKKGQGKRAAKRS  102 (103)
Q Consensus        72 e~~R~~~~~~rk~RGKg~PKKg~gkra~kkk  102 (103)
                      ++|++++.+++++|||.+||||+||||++++
T Consensus        83 qdF~deqkrLkklRGK~~PkkGeGKRA~kr~  113 (113)
T KOG4104|consen   83 QDFRDEQKRLKKLRGKVVPKKGEGKRAQKRG  113 (113)
T ss_pred             HHHHHHHHHHHHhcCCCCCCCCcchhhhhcC
Confidence            9999999999999999999999999999864


No 4  
>PF12752 SUZ:  SUZ domain;  InterPro: IPR024771 The SUZ domain is a conserved RNA-binding domain found in eukaryotes and enriched in positively charged amino acids. It was first characterised in the Caenorhabditis elegans protein SZY-20 where it has been shown to bind RNA and allow their localization to the centrosome [].
Probab=61.10  E-value=8.5  Score=23.74  Aligned_cols=16  Identities=44%  Similarity=0.617  Sum_probs=13.2

Q ss_pred             HHHHHHHHHHHhhhcc
Q 034116           14 VVTTGLTEARAKIFGH   29 (103)
Q Consensus        14 ~r~~~l~~ls~rIFg~   29 (103)
                      +|-..-+++++||||.
T Consensus        42 ERE~eY~~AR~RIFg~   57 (59)
T PF12752_consen   42 EREAEYAEARARIFGS   57 (59)
T ss_pred             HHHHHHHHHHHHHhCC
Confidence            5666778999999996


No 5  
>PF04844 Ovate:  Transcriptional repressor, ovate;  InterPro: IPR006458  This group of sequences contain an uncharacterised domain of about 70 residues found exclusively in plants, generally toward the C terminus of proteins of 200 to 350 amino acids in length. At least 14 such proteins are found in Arabidopsis thaliana (Mouse-ear cress). Other regions of these proteins tend to consist largely of low-complexity sequence. Function is not known. 
Probab=32.26  E-value=54  Score=20.69  Aligned_cols=19  Identities=26%  Similarity=0.319  Sum_probs=16.1

Q ss_pred             CChHHHHHHHHHHHHHhcC
Q 034116           68 MARQQQERLSKLEMLKRRG   86 (103)
Q Consensus        68 ~De~e~~R~~~~~~rk~RG   86 (103)
                      .||.+|||..|+++-..+|
T Consensus         2 ~DP~~DFr~SM~EMI~~~~   20 (59)
T PF04844_consen    2 SDPYEDFRESMVEMIEENG   20 (59)
T ss_pred             CCHHHHHHHHHHHHHHHcC
Confidence            4899999999999877665


No 6  
>TIGR03398 plc_access_R phospholipase C accessory protein PlcR. The class of microbial phosphocholine-preferring phospholipase C enzymes described by model TIGR03396 has two members in Pseudomonas aeruginosa, one of which (PlcH) is hemolytic and can hydrolyzes sphingomyelin as well as phosphatidylcholine. This model describes PlcR, an accessory protein for PlcH with which it forms a heterodimer. The member of the family from P. aeruginosa, although not the members from various Burkholderia species, is encoded immediately downstream of phospholipase C.
Probab=29.21  E-value=69  Score=23.58  Aligned_cols=29  Identities=21%  Similarity=0.355  Sum_probs=19.9

Q ss_pred             hhhhhhhH-----HHHHHHHHHHHhhhcccCCCCC
Q 034116            6 RLKNILAT-----VVTTGLTEARAKIFGHVLNPAG   35 (103)
Q Consensus         6 ~~~~~~s~-----~r~~~l~~ls~rIFg~~~nPt~   35 (103)
                      ++..+|.+     ++-++|..|+-.|||+ -+|..
T Consensus       106 V~asVpD~eQq~aaid~RL~aLR~Qifg~-~sp~~  139 (141)
T TIGR03398       106 VQASVPDPEQQQAAIDQRLQALRVQIFGE-ASPSL  139 (141)
T ss_pred             HHhcCCCHHHHHHHHHHHHHHHHHHHhcC-cCccc
Confidence            34455544     4567899999999997 44443


No 7  
>PF06904 Extensin-like_C:  Extensin-like protein C-terminus;  InterPro: IPR009683 This entry represents the C terminus (approx. 120 residues) of a number of bacterial extensin-like proteins. Extensins are cell wall glycoproteins normally associated with plants, where they strengthen the cell wall in response to mechanical stress []. Many proteins in this entry are hypothetical.
Probab=26.06  E-value=67  Score=24.23  Aligned_cols=27  Identities=19%  Similarity=0.255  Sum_probs=22.0

Q ss_pred             hhHHHHHHHHHHHHhhhcccCCCCCCC
Q 034116           11 LATVVTTGLTEARAKIFGHVLNPAGQR   37 (103)
Q Consensus        11 ~s~~r~~~l~~ls~rIFg~~~nPt~~R   37 (103)
                      +..+-+..|..-.|..|++|..|..-.
T Consensus       131 ~~~~fl~~v~~~AC~~F~tVLgP~~na  157 (178)
T PF06904_consen  131 PEAAFLRAVRAGACGRFGTVLGPDYNA  157 (178)
T ss_pred             hHHHHHHHHHHHHHhcCCcccCCCCch
Confidence            345678888999999999999987643


No 8  
>PF07874 DUF1660:  Prophage protein (DUF1660);  InterPro: IPR012455 This entry is represented by Bacteriophage bIL285, Orf33. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=24.72  E-value=23  Score=22.92  Aligned_cols=13  Identities=31%  Similarity=0.480  Sum_probs=11.0

Q ss_pred             HHHHhhhcccCCC
Q 034116           21 EARAKIFGHVLNP   33 (103)
Q Consensus        21 ~ls~rIFg~~~nP   33 (103)
                      +|-|+||||.+-+
T Consensus         2 KL~CKLFGHKw~~   14 (64)
T PF07874_consen    2 KLMCKLFGHKWTF   14 (64)
T ss_pred             cchhhhcCCCCCC
Confidence            5789999998874


No 9  
>PF14907 NTP_transf_5:  Uncharacterised nucleotidyltransferase
Probab=24.07  E-value=38  Score=24.89  Aligned_cols=27  Identities=19%  Similarity=0.160  Sum_probs=19.4

Q ss_pred             cccccccccCCCCCCccCCC---CCChHHH
Q 034116           47 LIGDKVAGWYPYDIKKDDPL---VMARQQQ   73 (103)
Q Consensus        47 lkG~~v~~YYP~~~~r~~g~---~~De~e~   73 (103)
                      +||..++.+||..-.|..++   ++.+++.
T Consensus        77 lKG~~l~~~Y~~~~~R~~~DiDlLV~~~d~  106 (249)
T PF14907_consen   77 LKGAALAQLYPDPGLRPMGDIDLLVPPEDL  106 (249)
T ss_pred             EchHHHHHhCCCCCCCCCCCeEEEEeCCcH
Confidence            48999999999876677764   5554443


No 10 
>TIGR01568 A_thal_3678 uncharacterized plant-specific domain TIGR01568. This model describes an uncharacterized domain of about 70 residues found exclusively in plants, generally toward the C-terminus of proteins of 200 to 350 amino acids in length. At least 14 such proteins are found in Arabidopsis thaliana. Other regions of these proteins tend to consist largely of low-complexity sequence.
Probab=20.55  E-value=1.1e+02  Score=19.67  Aligned_cols=19  Identities=26%  Similarity=0.169  Sum_probs=16.7

Q ss_pred             CChHHHHHHHHHHHHHhcC
Q 034116           68 MARQQQERLSKLEMLKRRG   86 (103)
Q Consensus        68 ~De~e~~R~~~~~~rk~RG   86 (103)
                      .||.+|||..|+++-..+|
T Consensus         8 ~DPy~DFr~SM~EMI~~~~   26 (66)
T TIGR01568         8 DDPYEDFRRSMEEMIEERE   26 (66)
T ss_pred             CChHHHHHHHHHHHHHHcC
Confidence            5999999999999888775


No 11 
>PRK13868 type IV secretion system single-stranded DNA binding protein VirE2; Provisional
Probab=20.34  E-value=64  Score=28.04  Aligned_cols=31  Identities=16%  Similarity=0.427  Sum_probs=23.1

Q ss_pred             hhhhhhhhHHHHHHHHHHHHhhhcccCCCCCCCchhHHhhhccccccccccCCCCC
Q 034116            5 GRLKNILATVVTTGLTEARAKIFGHVLNPAGQRSPHKILRKKLIGDKVAGWYPYDI   60 (103)
Q Consensus         5 ~~~~~~~s~~r~~~l~~ls~rIFg~~~nPt~~Rsg~kvlr~~lkG~~v~~YYP~~~   60 (103)
                      |-|-.||+++-    --++|+++-.-                     +-+||||+.
T Consensus       134 GnL~~lPTkaE----FNasCRLYRDG---------------------aGNYyPPPl  164 (556)
T PRK13868        134 GNLDHLPTKAE----FNASCRLYRDG---------------------AGNYYPPPL  164 (556)
T ss_pred             cccccCCcHHH----hhhhhhheecC---------------------CCCcCCCch
Confidence            77888999976    45788877643                     449999975


Done!