BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034120
         (103 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4DRB|C Chain C, The Crystal Structure Of Fancm Bound Mhf Complex
 pdb|4DRB|F Chain F, The Crystal Structure Of Fancm Bound Mhf Complex
 pdb|4DRB|I Chain I, The Crystal Structure Of Fancm Bound Mhf Complex
          Length = 141

 Score = 25.4 bits (54), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 11/53 (20%)

Query: 24  IPYRDQCAHLLIPLNKCRQAEFYLPWKCENERHSYEKCEYELVMERMLQMQKI 76
           + + D+C H +  +              E  RH   +C YEL +E  LQM+ +
Sbjct: 90  VDHSDRCRHFIGLMQMI-----------EGMRHEEGECSYELEVESYLQMEDV 131


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.130    0.384 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,700,648
Number of Sequences: 62578
Number of extensions: 85627
Number of successful extensions: 159
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 156
Number of HSP's gapped (non-prelim): 3
length of query: 103
length of database: 14,973,337
effective HSP length: 68
effective length of query: 35
effective length of database: 10,718,033
effective search space: 375131155
effective search space used: 375131155
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)