BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034124
(103 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4A18|N Chain N, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 26s Rrna And
Proteins Of Molecule 1
pdb|4A1B|N Chain N, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 26s Rrna And
Proteins Of Molecule 3.
pdb|4A1D|N Chain N, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 26s Rrna And
Proteins Of Molecule 4.
pdb|4A19|N Chain N, T.Thermophila 60s Ribosomal Subunit In Complex With
Initiation Factor 6. This File Contains 26s Rrna And
Proteins Of Molecule 2
Length = 144
Score = 26.9 bits (58), Expect = 3.0, Method: Compositional matrix adjust.
Identities = 13/41 (31%), Positives = 21/41 (51%)
Query: 5 GRLKNILATVVTTGLTEARAKIFGHVLNPAGQRSPHKILRK 45
GR A +V + + + FGHVL +RSP K+ ++
Sbjct: 16 GRFAGKKAVIVKSSEDGTKDRKFGHVLVAGVERSPKKVTKR 56
>pdb|1DVR|A Chain A, Structure Of A Mutant Adenylate Kinase Ligated With An
Atp- Analogue Showing Domain Closure Over Atp
pdb|1DVR|B Chain B, Structure Of A Mutant Adenylate Kinase Ligated With An
Atp- Analogue Showing Domain Closure Over Atp
Length = 220
Score = 25.8 bits (55), Expect = 6.2, Method: Compositional matrix adjust.
Identities = 16/43 (37%), Positives = 23/43 (53%), Gaps = 2/43 (4%)
Query: 24 AKIFGHVLNPAGQRSPHKILR--KKLIGDKVAGWYPYDIKKDD 64
A+I G +++PA RS HKI K+ + D V G I D+
Sbjct: 127 ARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQISDDN 169
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.135 0.388
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,337,326
Number of Sequences: 62578
Number of extensions: 78182
Number of successful extensions: 139
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 136
Number of HSP's gapped (non-prelim): 6
length of query: 103
length of database: 14,973,337
effective HSP length: 68
effective length of query: 35
effective length of database: 10,718,033
effective search space: 375131155
effective search space used: 375131155
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)