Citrus Sinensis ID: 034126

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MSTVSEKRNIEDHKRRLLATKFELKRKLYKSLYRDVNLPTEVREKYLCKLARLPRNSSFTRLRNRCIFTGRSRAVYEKFRMSRIVFRSLANQGMLMGVKKASW
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccHHHHcccccccccHHHHHHccccHHHHHHHHHcccccccccccc
*********IEDHKRRLLATKFELKRKLYKSLYRDVNLPTEVREKYLCKLARLPRNSSFTRLRNRCIFTGRSRAVYEKFRMSRIVFRSLANQGMLMGVKKASW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTVSEKRNIEDHKRRLLATKFELKRKLYKSLYRDVNLPTEVREKYLCKLARLPRNSSFTRLRNRCIFTGRSRAVYEKFRMSRIVFRSLANQGMLMGVKKASW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
30S ribosomal protein S14 Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.probableQ0ANR3
30S ribosomal protein S14 Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.probableQ28UU1
Ribosomal protein S14, mitochondrial probableP49387

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBN, chain N
Confidence level:very confident
Coverage over the Query: 5-103
View the alignment between query and template
View the model in PyMOL