Query         034135
Match_columns 103
No_of_seqs    10 out of 12
Neff          1.5 
Searched_HMMs 46136
Date          Fri Mar 29 10:09:25 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034135.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034135hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01436 NHL:  NHL repeat;  Int  65.4     7.5 0.00016   20.6   2.2   19   75-95      1-19  (28)
  2 PF00595 PDZ:  PDZ domain (Also  50.6      30 0.00066   20.6   3.4   25   76-100     9-36  (81)
  3 KOG1004 Exosomal 3'-5' exoribo  47.7      14 0.00031   29.9   2.1   26   72-97    169-194 (230)
  4 PRK05641 putative acetyl-CoA c  40.6      33 0.00071   25.0   2.9   29   64-93      6-35  (153)
  5 KOG2358 NifU-like domain-conta  35.6      30 0.00065   27.7   2.2   44    6-49     32-79  (213)
  6 PF13986 DUF4224:  Domain of un  31.4      32 0.00069   20.8   1.3   15   79-93     27-41  (47)
  7 PRK10858 nitrogen regulatory p  29.4      29 0.00062   24.0   1.0   13   85-97     85-97  (112)
  8 PF10647 Gmad1:  Lipoprotein Lp  29.4      60  0.0013   24.1   2.8   22   78-99    121-146 (253)
  9 PF07646 Kelch_2:  Kelch motif;  29.3      49  0.0011   18.4   1.8   12   84-95      7-18  (49)
 10 cd00136 PDZ PDZ domain, also c  29.3      57  0.0012   18.4   2.1   24   77-100     1-24  (70)
 11 PF13540 RCC1_2:  Regulator of   29.0      51  0.0011   17.6   1.8   12   83-94     12-23  (30)
 12 PF15614 WHIM3:  WSTF, HB1, Itc  28.4     7.4 0.00016   24.4  -1.8   16   67-82      9-24  (46)
 13 PF11805 DUF3326:  Protein of u  28.4      13 0.00029   31.4  -0.9   52   39-91     78-134 (340)
 14 KOG1784 Small Nuclear ribonucl  27.7      45 0.00097   24.1   1.8   13   85-97     16-28  (96)
 15 PRK10665 nitrogen regulatory p  27.4      32  0.0007   23.7   1.0   13   85-97     85-97  (112)
 16 PF06462 Hyd_WA:  Propeller;  I  26.3      50  0.0011   18.3   1.5   12   83-94      4-15  (32)
 17 PF13186 SPASM:  Iron-sulfur cl  26.2      59  0.0013   18.0   1.8   13   81-93      6-18  (64)
 18 PF12900 Pyridox_ox_2:  Pyridox  26.0      82  0.0018   20.9   2.7   19   81-100    30-48  (143)
 19 PF04683 Proteasom_Rpn13:  Prot  25.7      72  0.0016   21.1   2.4   26   64-89      1-27  (85)
 20 KOG1520 Predicted alkaloid syn  25.0      33 0.00071   29.1   0.8   18   76-94    115-132 (376)
 21 PF13964 Kelch_6:  Kelch motif   25.0      67  0.0014   17.7   1.8   11   84-94      7-17  (50)
 22 PF10781 DSRB:  Dextransucrase   24.7      48   0.001   22.4   1.4   24   71-94     33-59  (62)
 23 PRK11112 tRNA pseudouridine sy  24.4      34 0.00073   25.7   0.7   15   69-83      8-22  (257)
 24 KOG1417 Homogentisate 1,2-diox  23.8      41 0.00089   29.3   1.2   21   67-90    178-198 (446)
 25 cd02563 PseudoU_synth_TruC tRN  23.5      36 0.00078   24.7   0.7   14   69-82      7-20  (223)
 26 PF01344 Kelch_1:  Kelch motif;  23.1      80  0.0017   16.8   1.9   11   84-94      7-17  (47)
 27 PF13313 DUF4082:  Domain of un  22.9      60  0.0013   24.2   1.7   17   79-97     21-37  (149)
 28 KOG1190 Polypyrimidine tract-b  22.7      26 0.00057   31.0  -0.2   14   65-78    302-315 (492)
 29 PRK10158 23S rRNA/tRNA pseudou  22.3      39 0.00085   24.7   0.7   14   69-82     20-33  (219)
 30 PF08068 DKCLD:  DKCLD (NUC011)  22.3      37 0.00081   22.3   0.5   19   62-80     30-52  (59)
 31 PF07995 GSDH:  Glucose / Sorbo  22.2      61  0.0013   24.9   1.7   21   83-103   311-331 (331)
 32 PF00543 P-II:  Nitrogen regula  22.0      44 0.00096   21.6   0.8   12   86-97     83-94  (102)
 33 PF09696 Ctf8:  Ctf8;  InterPro  21.8      47   0.001   23.2   0.9   11   71-81     71-81  (122)
 34 KOG2509 Seryl-tRNA synthetase   21.8      35 0.00076   29.9   0.4   21   77-97    377-400 (455)
 35 COG1097 RRP4 RNA-binding prote  21.3      67  0.0015   25.8   1.8   23   74-96    170-192 (239)
 36 PF03725 RNase_PH_C:  3' exorib  21.0 1.2E+02  0.0027   17.7   2.6   17   78-95      3-19  (68)
 37 TIGR01621 RluA-like pseudourid  20.4      45 0.00098   24.4   0.7   14   69-82      8-21  (217)
 38 cd00992 PDZ_signaling PDZ doma  20.4 1.5E+02  0.0032   17.0   2.8   25   76-100    11-37  (82)
 39 cd02557 PseudoU_synth_ScRIB2 P  20.3      46 0.00099   24.2   0.7   13   69-81     22-34  (213)
 40 TIGR00005 rluA_subfam pseudour  20.3      45 0.00099   24.9   0.7   15   69-83     78-92  (299)

No 1  
>PF01436 NHL:  NHL repeat;  InterPro: IPR001258 The NHL repeat, named after NCL-1, HT2A and Lin-41, is found largely in a large number of eukaryotic and prokaryotic proteins. For example, the repeat is found in a variety of enzymes of the copper type II, ascorbate-dependent monooxygenase family which catalyse the C terminus alpha-amidation of biological peptides []. In many it occurs in tandem arrays, for example in the ringfinger beta-box, coiled-coil (RBCC) eukaryotic growth regulators []. The 'Brain Tumor' protein (Brat) is one such growth regulator that contains a 6-bladed NHL-repeat beta-propeller [, ].  The NHL repeats are also found in serine/threonine protein kinase (STPK) in diverse range of pathogenic bacteria. These STPK are transmembrane receptors with a intracellular N-terminal kinase domain and extracellular C-terminal sensor domain. In the STPK, PknD, from Mycobacterium tuberculosis, the sensor domain forms a rigid, six-bladed b-propeller composed of NHL repeats with a flexible tether to the transmembrane domain.; GO: 0005515 protein binding; PDB: 3FVZ_A 3FW0_A 1RWL_A 1RWI_A 1Q7F_A.
Probab=65.37  E-value=7.5  Score=20.57  Aligned_cols=19  Identities=32%  Similarity=0.665  Sum_probs=14.4

Q ss_pred             eccceeeEEEEeeCCeEEeee
Q 034135           75 LEKPLGIRFALTVDGKIFVHA   95 (103)
Q Consensus        75 leKPLGIRFALtvdGKVfVHa   95 (103)
                      +..|.||-..  .+|.|||--
T Consensus         1 f~~P~gvav~--~~g~i~VaD   19 (28)
T PF01436_consen    1 FNYPHGVAVD--SDGNIYVAD   19 (28)
T ss_dssp             BSSEEEEEEE--TTSEEEEEE
T ss_pred             CcCCcEEEEe--CCCCEEEEE
Confidence            4578888554  999999954


No 2  
>PF00595 PDZ:  PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available;  InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ]. PDZ domains can occur in one or multiple copies and are nearly always found in cytoplasmic proteins. They bind either the carboxyl-terminal sequences of proteins or internal peptide sequences []. In most cases, interaction between a PDZ domain and its target is constitutive, with a binding affinity of 1 to 10 microns. However, agonist-dependent activation of cell surface receptors is sometimes required to promote interaction with a PDZ protein. PDZ domain proteins are frequently associated with the plasma membrane, a compartment where high concentrations of phosphatidylinositol 4,5-bisphosphate (PIP2) are found. Direct interaction between PIP2 and a subset of class II PDZ domains (syntenin, CASK, Tiam-1) has been demonstrated.  PDZ domains consist of 80 to 90 amino acids comprising six beta-strands (beta-A to beta-F) and two alpha-helices, A and B, compactly arranged in a globular structure. Peptide binding of the ligand takes place in an elongated surface groove as an anti-parallel beta-strand interacts with the beta-B strand and the B helix. The structure of PDZ domains allows binding to a free carboxylate group at the end of a peptide through a carboxylate-binding loop between the beta-A and beta-B strands.; GO: 0005515 protein binding; PDB: 3AXA_A 1WF8_A 1QAV_B 1QAU_A 1B8Q_A 1MC7_A 2KAW_A 1I16_A 1VB7_A 1WI4_A ....
Probab=50.61  E-value=30  Score=20.60  Aligned_cols=25  Identities=28%  Similarity=0.493  Sum_probs=20.7

Q ss_pred             ccceeeEEEEeeCC---eEEeeeecccc
Q 034135           76 EKPLGIRFALTVDG---KIFVHALRKGV  100 (103)
Q Consensus        76 eKPLGIRFALtvdG---KVfVHaLkKG~  100 (103)
                      +.|+|+.+.-..+.   -+||..+.+|+
T Consensus         9 ~~~lG~~l~~~~~~~~~~~~V~~v~~~~   36 (81)
T PF00595_consen    9 NGPLGFTLRGGSDNDEKGVFVSSVVPGS   36 (81)
T ss_dssp             TSBSSEEEEEESTSSSEEEEEEEECTTS
T ss_pred             CCCcCEEEEecCCCCcCCEEEEEEeCCC
Confidence            45899999988885   89999888774


No 3  
>KOG1004 consensus Exosomal 3'-5' exoribonuclease complex subunit Rrp40 [Translation, ribosomal structure and biogenesis]
Probab=47.65  E-value=14  Score=29.86  Aligned_cols=26  Identities=27%  Similarity=0.460  Sum_probs=20.4

Q ss_pred             eeeeccceeeEEEEeeCCeEEeeeec
Q 034135           72 MVTLEKPLGIRFALTVDGKIFVHALR   97 (103)
Q Consensus        72 MVtleKPLGIRFALtvdGKVfVHaLk   97 (103)
                      +-+|-|=+-.+.|+..+|||||||=+
T Consensus       169 Lq~vGk~~~FEia~GlNGriWV~ae~  194 (230)
T KOG1004|consen  169 LQTVGKKYPFEIAFGLNGRIWVKAET  194 (230)
T ss_pred             HHHhhcccceEEEEecCceEEEeccC
Confidence            33566666788899999999999843


No 4  
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated
Probab=40.60  E-value=33  Score=24.99  Aligned_cols=29  Identities=31%  Similarity=0.554  Sum_probs=20.9

Q ss_pred             cccccceeeeeeccceeeE-EEEeeCCeEEe
Q 034135           64 LKMNLNEYMVTLEKPLGIR-FALTVDGKIFV   93 (103)
Q Consensus        64 fKMNLNEYMVtleKPLGIR-FALtvdGKVfV   93 (103)
                      +.||=+||=|.++. |+.| |-.|+||+.|.
T Consensus         6 ~~~~g~~~~v~v~~-~~~~~~~itvnG~~y~   35 (153)
T PRK05641          6 VIVDGVEYEVEVEE-LGPGKFRVSFEGKTYE   35 (153)
T ss_pred             EEECCEEEEEEEEe-ecCccEEEEECCEEEE
Confidence            45677788888765 3354 88888888883


No 5  
>KOG2358 consensus NifU-like domain-containing proteins [Posttranslational modification, protein turnover, chaperones]
Probab=35.57  E-value=30  Score=27.69  Aligned_cols=44  Identities=30%  Similarity=0.280  Sum_probs=35.0

Q ss_pred             cccccccccCC----ChhhhhhccccccCcccccccccceEEEEeehh
Q 034135            6 LSSRRTTSFPS----SSSFLEKNLFSINGVPKQLSFGRDRVKVRFSKK   49 (103)
Q Consensus         6 lssrrttsfps----sssfleknlfsingvpkqlsfgrdrv~~~~sk~   49 (103)
                      ++.|.+.+||.    .+++|-+.+|.++|-++..-||-|-|.+.=++.
T Consensus        32 ~~~~~~~~~~~~~s~~~s~La~s~~~~~~gvv~~~~g~dfvtv~k~~e   79 (213)
T KOG2358|consen   32 LSERGLGDFATPCSAFFSPLAKSILFRDGGVVKVFFGPDFVTVTKLTE   79 (213)
T ss_pred             cccccccccccccchhhcHHHHHHHhhcCCcEEEEecCCeEEEeccch
Confidence            34677777776    467899999999998899999999887765544


No 6  
>PF13986 DUF4224:  Domain of unknown function (DUF4224)
Probab=31.38  E-value=32  Score=20.76  Aligned_cols=15  Identities=40%  Similarity=0.696  Sum_probs=13.6

Q ss_pred             eeeEEEEeeCCeEEe
Q 034135           79 LGIRFALTVDGKIFV   93 (103)
Q Consensus        79 LGIRFALtvdGKVfV   93 (103)
                      .||+|-...||+..|
T Consensus        27 ~Gi~~~~~~~G~p~V   41 (47)
T PF13986_consen   27 NGIPFVVRADGRPIV   41 (47)
T ss_pred             CCCeeEECCCCCEEe
Confidence            499999999999887


No 7  
>PRK10858 nitrogen regulatory protein P-II 1; Provisional
Probab=29.41  E-value=29  Score=23.97  Aligned_cols=13  Identities=46%  Similarity=0.608  Sum_probs=9.3

Q ss_pred             EeeCCeEEeeeec
Q 034135           85 LTVDGKIFVHALR   97 (103)
Q Consensus        85 LtvdGKVfVHaLk   97 (103)
                      ..=||||||--+.
T Consensus        85 ~~GDGkIfV~pV~   97 (112)
T PRK10858         85 KIGDGKIFVFDVA   97 (112)
T ss_pred             CCCCcEEEEEEhh
Confidence            4459999996543


No 8  
>PF10647 Gmad1:  Lipoprotein LpqB beta-propeller domain;  InterPro: IPR018910  The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation. It is predicted to have a beta-propeller fold and to have a passive binding role rather than a catalytic function owing to the low number of conserved hydrophilic residues. 
Probab=29.35  E-value=60  Score=24.09  Aligned_cols=22  Identities=32%  Similarity=0.687  Sum_probs=18.7

Q ss_pred             ceeeEEEEee----CCeEEeeeeccc
Q 034135           78 PLGIRFALTV----DGKIFVHALRKG   99 (103)
Q Consensus        78 PLGIRFALtv----dGKVfVHaLkKG   99 (103)
                      |=|.|.|+-+    +|+|+|-.+.++
T Consensus       121 pDG~RvA~v~~~~~~~~v~va~V~r~  146 (253)
T PF10647_consen  121 PDGTRVAVVVEDGGGGRVYVAGVVRD  146 (253)
T ss_pred             CCCcEEEEEEecCCCCeEEEEEEEeC
Confidence            6699999999    999999887643


No 9  
>PF07646 Kelch_2:  Kelch motif;  InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []. This sequence motif represents one beta-sheet blade, and several of these repeats can associate to form a beta-propeller. For instance, the motif appears 6 times in Drosophila egg-chamber regulatory protein, creating a 6-bladed beta-propeller. The motif is also found in mouse protein MIPP [] and in a number of poxviruses. In addition, kelch repeats have been recognised in alpha- and beta-scruin [, ], and in galactose oxidase from the fungus Dactylium dendroides [, ]. The structure of galactose oxidase reveals that the repeated sequence corresponds to a 4-stranded anti-parallel beta-sheet motif that forms the repeat unit in a super-barrel structural fold []. The known functions of kelch-containing proteins are diverse: scruin is an actin cross-linking protein; galactose oxidase catalyses the oxidation of the hydroxyl group at the C6 position in D-galactose; neuraminidase hydrolyses sialic acid residues from glycoproteins; and kelch may have a cytoskeletal function, as it is localised to the actin-rich ring canals that connect the 15 nurse cells to the developing oocyte in Drosophila []. Nevertheless, based on the location of the kelch pattern in the catalytic unit in galactose oxidase, functionally important residues have been predicted in glyoxal oxidase []. This entry represents a type of kelch sequence motif that comprises one beta-sheet blade.; GO: 0005515 protein binding
Probab=29.33  E-value=49  Score=18.44  Aligned_cols=12  Identities=50%  Similarity=0.927  Sum_probs=9.4

Q ss_pred             EEeeCCeEEeee
Q 034135           84 ALTVDGKIFVHA   95 (103)
Q Consensus        84 ALtvdGKVfVHa   95 (103)
                      +..+||||||-.
T Consensus         7 ~~~~~~kiyv~G   18 (49)
T PF07646_consen    7 AVVLDGKIYVFG   18 (49)
T ss_pred             EEEECCEEEEEC
Confidence            567899999853


No 10 
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. Heterodimerization through PDZ-PDZ domain interactions adds to the domain's versatility, and PDZ domain-mediated interactions may be modulated dynamically through target phosphorylation. Some PDZ domains play a role in scaffolding supramolecular complexes. PDZ domains are found in diverse signaling proteins in bacteria, archebacteria, and eurkayotes. This CD contains two distinct structural subgroups with either a N- or C-terminal beta-strand forming the peptide-binding groove base. The circular permutation placing the strand on the N-terminus appears to be found in Eumetazoa only, while the C-terminal variant is found in all three kingdoms of life, and seems to co-occur with protease domains. PDZ domains have been named after PSD95(pos
Probab=29.30  E-value=57  Score=18.44  Aligned_cols=24  Identities=21%  Similarity=0.346  Sum_probs=16.7

Q ss_pred             cceeeEEEEeeCCeEEeeeecccc
Q 034135           77 KPLGIRFALTVDGKIFVHALRKGV  100 (103)
Q Consensus        77 KPLGIRFALtvdGKVfVHaLkKG~  100 (103)
                      .|+|+++.-.-++.++|..+.+|+
T Consensus         1 ~~~G~~~~~~~~~~~~V~~v~~~s   24 (70)
T cd00136           1 GGLGFSIRGGTEGGVVVLSVEPGS   24 (70)
T ss_pred             CCccEEEecCCCCCEEEEEeCCCC
Confidence            367888777666578887776654


No 11 
>PF13540 RCC1_2:  Regulator of chromosome condensation (RCC1) repeat; PDB: 3QI0_D 1JTD_B 3QHY_B.
Probab=29.00  E-value=51  Score=17.61  Aligned_cols=12  Identities=42%  Similarity=0.750  Sum_probs=8.5

Q ss_pred             EEEeeCCeEEee
Q 034135           83 FALTVDGKIFVH   94 (103)
Q Consensus        83 FALtvdGKVfVH   94 (103)
                      .||+-||+||.-
T Consensus        12 ~al~~~g~v~~w   23 (30)
T PF13540_consen   12 CALTSDGEVYCW   23 (30)
T ss_dssp             EEEE-TTEEEEE
T ss_pred             EEEEcCCCEEEE
Confidence            578889998854


No 12 
>PF15614 WHIM3:  WSTF, HB1, Itc1p, MBD9 motif 3
Probab=28.43  E-value=7.4  Score=24.40  Aligned_cols=16  Identities=44%  Similarity=0.737  Sum_probs=13.3

Q ss_pred             ccceeeeeeccceeeE
Q 034135           67 NLNEYMVTLEKPLGIR   82 (103)
Q Consensus        67 NLNEYMVtleKPLGIR   82 (103)
                      +|||-+.+|+-|.|+|
T Consensus         9 ~ld~L~~aL~~prG~R   24 (46)
T PF15614_consen    9 ELDELLKALENPRGKR   24 (46)
T ss_pred             HHHHHHHHHcCcccHh
Confidence            5778888888899998


No 13 
>PF11805 DUF3326:  Protein of unknown function (DUF3326);  InterPro: IPR021763  This family of functionally uncharacterised proteins is found in plants and bacteria. 
Probab=28.38  E-value=13  Score=31.38  Aligned_cols=52  Identities=21%  Similarity=0.408  Sum_probs=38.7

Q ss_pred             cceEEEEeehh-----heeeeeeeecCccccccccceeeeeeccceeeEEEEeeCCeE
Q 034135           39 RDRVKVRFSKK-----IVRVHALSSNSNSYLKMNLNEYMVTLEKPLGIRFALTVDGKI   91 (103)
Q Consensus        39 rdrv~~~~sk~-----~~R~l~~s~~~~s~fKMNLNEYMVtleKPLGIRFALtvdGKV   91 (103)
                      +.||-+-|.+-     .+|-+-++.++-.++-.|+-+|++| |+|||++.-.+.+|.=
T Consensus        78 ~nrVGlilD~gie~el~~rhlq~ada~RAtlGl~i~~~v~T-d~pl~v~~~~~~sG~s  134 (340)
T PF11805_consen   78 QNRVGLILDAGIEPELRLRHLQVADAARATLGLNITPVVVT-DAPLGVELRYSPSGAS  134 (340)
T ss_pred             cceEEEEEecCCCHHHHHHHHHHHHHHHHhcCCCCcceEEc-CCCcEEEEEEcCCCcc
Confidence            35555555443     4555556666668899999999887 9999999998888853


No 14 
>KOG1784 consensus Small Nuclear ribonucleoprotein splicing factor [RNA processing and modification]
Probab=27.68  E-value=45  Score=24.08  Aligned_cols=13  Identities=38%  Similarity=0.795  Sum_probs=11.8

Q ss_pred             EeeCCeEEeeeec
Q 034135           85 LTVDGKIFVHALR   97 (103)
Q Consensus        85 LtvdGKVfVHaLk   97 (103)
                      .|.||+++|-+||
T Consensus        16 It~DGr~ivgsLk   28 (96)
T KOG1784|consen   16 ITNDGRVIVGSLK   28 (96)
T ss_pred             EecCCeEEEEEec
Confidence            6999999999986


No 15 
>PRK10665 nitrogen regulatory protein P-II 2; Provisional
Probab=27.43  E-value=32  Score=23.69  Aligned_cols=13  Identities=54%  Similarity=0.708  Sum_probs=9.3

Q ss_pred             EeeCCeEEeeeec
Q 034135           85 LTVDGKIFVHALR   97 (103)
Q Consensus        85 LtvdGKVfVHaLk   97 (103)
                      ..=||||||--+.
T Consensus        85 ~~GDGkIfV~pV~   97 (112)
T PRK10665         85 KIGDGKIFVAELQ   97 (112)
T ss_pred             CCCCcEEEEEEhh
Confidence            4569999996543


No 16 
>PF06462 Hyd_WA:  Propeller;  InterPro: IPR006624  Tectonins I and II are two dominant proteins in the nuclei and nuclear matrix from plasmodia of Physarum polycephalum (Slime mold) which encode 217 and 353 amino acids, respectively. Tectonin I is homologous to the C-terminal two-thirds of tectonin II. Both proteins contain six tandem repeats that are each 33-37 amino acids in length and define a new consensus sequence. Homologous repeats are found in L-6, a bacterial lipopolysaccharide-binding lectin from horseshoe crab hemocytes. The repetitive sequences of the tectonins and L-6 are reminiscent of the WD repeats of the beta-subunit of G proteins, suggesting that they form beta-propeller domains. The tectonins may be lectins that function as part of a transmembrane signalling complex during phagocytosis [].
Probab=26.27  E-value=50  Score=18.34  Aligned_cols=12  Identities=33%  Similarity=0.822  Sum_probs=10.4

Q ss_pred             EEEeeCCeEEee
Q 034135           83 FALTVDGKIFVH   94 (103)
Q Consensus        83 FALtvdGKVfVH   94 (103)
                      +|++-||+||.-
T Consensus         4 Wav~~~G~v~~R   15 (32)
T PF06462_consen    4 WAVTSDGSVYFR   15 (32)
T ss_pred             EEEcCCCCEEEE
Confidence            789999999974


No 17 
>PF13186 SPASM:  Iron-sulfur cluster-binding domain
Probab=26.19  E-value=59  Score=17.97  Aligned_cols=13  Identities=15%  Similarity=0.411  Sum_probs=10.7

Q ss_pred             eEEEEeeCCeEEe
Q 034135           81 IRFALTVDGKIFV   93 (103)
Q Consensus        81 IRFALtvdGKVfV   93 (103)
                      -.++++.||.|+.
T Consensus         6 ~~~~I~~dG~v~p   18 (64)
T PF13186_consen    6 NSLYIDPDGDVYP   18 (64)
T ss_pred             eEEEEeeCccEEe
Confidence            3678999999986


No 18 
>PF12900 Pyridox_ox_2:  Pyridoxamine 5'-phosphate oxidase;  InterPro: IPR024747 Pyridoxamine 5'-phosphate oxidase is a FMN flavoprotein that catalyses the oxidation of pyridoxamine-5-P (PMP) and pyridoxine-5-P (PNP) to pyridoxal-5-P (PLP). This entry contains several uncharacterised proteins, some annotated as pyridoxamine 5'-phosphate oxidase-related.; PDB: 3U5W_A 3U0I_A 2X1K_A 1W3Q_A 1W3P_A 1W3O_A 2VPA_A 2X1J_A 1W3R_A 3FKH_A ....
Probab=26.04  E-value=82  Score=20.93  Aligned_cols=19  Identities=26%  Similarity=0.686  Sum_probs=14.9

Q ss_pred             eEEEEeeCCeEEeeeecccc
Q 034135           81 IRFALTVDGKIFVHALRKGV  100 (103)
Q Consensus        81 IRFALtvdGKVfVHaLkKG~  100 (103)
                      +.|+.. ||+||+|.-+.|.
T Consensus        30 ~~f~~~-~~~ly~h~~~~g~   48 (143)
T PF12900_consen   30 VNFVYD-GGSLYFHGARGGK   48 (143)
T ss_dssp             EEEEEE-TTEEEEEECSHSH
T ss_pred             EEEEEE-CCEEEEEECCcch
Confidence            356766 8899999988764


No 19 
>PF04683 Proteasom_Rpn13:  Proteasome complex subunit Rpn13 ubiquitin receptor;  InterPro: IPR006773  This family was thought originally to be involved in cell-adhesion [, ], but the members are now known to be proteasome subunit Rpn13, a novel ubiquitin receptor. The 26S proteasome is a huge macromolecular protein-degradation machine consisting of a proteolytically active 20S core, in the form of four disc-like proteins, and one or two 19S regulatory particles. The regulatory particle(s) sit on the top and or bottom of the core, de-ubiquitinate the substrate peptides, unfold them and guide them into the narrow channel through the centre of the core. Rpn13 and its homologues dock onto the regulatory particle through the N-terminal region which binds Rpn2. The C-terminal part of the domain binds de-ubiquitinating enzyme Uch37/UCHL5 and enhances its isopeptidase activity. Rpn13 binds ubiquitin via a conserved amino-terminal region called the pleckstrin-like receptor for ubiquitin, termed Pru, domain []. The domain forms two contiguous anti-parallel beta-sheets with a configuration similar to the pleckstrin-homology domain (PHD) fold []. Rpn13's ability to bind ubiquitin and the proteasome subunit Rpn2/S1 simultaneously supports evidence of its role as a ubiquitin receptor. Finally, when complexed to di-ubiquitin, via the Pru, and Uch37 via the C-terminal part, it frees up the distal ubiquitin for de-ubiquitination by the Uch37 []. ; GO: 0005634 nucleus, 0005737 cytoplasm; PDB: 2Z4D_A 2KR0_A 2Z59_A 2R2Y_A.
Probab=25.69  E-value=72  Score=21.05  Aligned_cols=26  Identities=31%  Similarity=0.386  Sum_probs=16.2

Q ss_pred             cccccceeeeeecccee-eEEEEeeCC
Q 034135           64 LKMNLNEYMVTLEKPLG-IRFALTVDG   89 (103)
Q Consensus        64 fKMNLNEYMVtleKPLG-IRFALtvdG   89 (103)
                      +||++++++|+-|.=.| |++..+-||
T Consensus         1 Gk~~~~~~~V~pd~~KG~l~l~~~~d~   27 (85)
T PF04683_consen    1 GKMDLDGKIVTPDPRKGLLYLYKSEDG   27 (85)
T ss_dssp             EEEEEETTEEEE-SS-EEEEEEETTTS
T ss_pred             CcEEEeCCEEeECCCCEEEEEEECCCC
Confidence            47889998888877666 344444444


No 20 
>KOG1520 consensus Predicted alkaloid synthase/Surface mucin Hemomucin [General function prediction only]
Probab=25.02  E-value=33  Score=29.14  Aligned_cols=18  Identities=44%  Similarity=0.914  Sum_probs=13.2

Q ss_pred             ccceeeEEEEeeCCeEEee
Q 034135           76 EKPLGIRFALTVDGKIFVH   94 (103)
Q Consensus        76 eKPLGIRFALtvdGKVfVH   94 (103)
                      -|||||||-- ..|.+||-
T Consensus       115 GRPLGl~f~~-~ggdL~Va  132 (376)
T KOG1520|consen  115 GRPLGIRFDK-KGGDLYVA  132 (376)
T ss_pred             CCcceEEecc-CCCeEEEE
Confidence            6999999964 34477764


No 21 
>PF13964 Kelch_6:  Kelch motif
Probab=24.99  E-value=67  Score=17.73  Aligned_cols=11  Identities=55%  Similarity=0.905  Sum_probs=8.1

Q ss_pred             EEeeCCeEEee
Q 034135           84 ALTVDGKIFVH   94 (103)
Q Consensus        84 ALtvdGKVfVH   94 (103)
                      +.+++|+|||=
T Consensus         7 ~v~~~~~iyv~   17 (50)
T PF13964_consen    7 AVVVGGKIYVF   17 (50)
T ss_pred             EEEECCEEEEE
Confidence            45688999874


No 22 
>PF10781 DSRB:  Dextransucrase DSRB;  InterPro: IPR019717  DSRB is a novel dextransucrase which produces a dextran different from the typical dextran, as it contains (1-6) and (1-2) linkages, when this strain is grown in the presence of sucrose []. 
Probab=24.66  E-value=48  Score=22.36  Aligned_cols=24  Identities=46%  Similarity=0.696  Sum_probs=17.3

Q ss_pred             eeeeec-cceeeEEEEeeCCe--EEee
Q 034135           71 YMVTLE-KPLGIRFALTVDGK--IFVH   94 (103)
Q Consensus        71 YMVtle-KPLGIRFALtvdGK--VfVH   94 (103)
                      |+|+|| -|.||=|=--.|++  +||.
T Consensus        33 YLvaL~dYP~GiWFFNE~~~~dG~FVe   59 (62)
T PF10781_consen   33 YLVALEDYPAGIWFFNEKDSPDGTFVE   59 (62)
T ss_pred             EEEEcCcCCcceEEEecCCCCCcEEee
Confidence            889985 69999996555443  5664


No 23 
>PRK11112 tRNA pseudouridine synthase C; Provisional
Probab=24.43  E-value=34  Score=25.72  Aligned_cols=15  Identities=33%  Similarity=0.705  Sum_probs=12.9

Q ss_pred             ceeeeeeccceeeEE
Q 034135           69 NEYMVTLEKPLGIRF   83 (103)
Q Consensus        69 NEYMVtleKPLGIRF   83 (103)
                      +|+++.+|||-|+--
T Consensus         8 d~~~lvvnKPaGl~~   22 (257)
T PRK11112          8 DEWLVAVNKPAGWLV   22 (257)
T ss_pred             cCCEEEEECCCCCee
Confidence            688999999999954


No 24 
>KOG1417 consensus Homogentisate 1,2-dioxygenase [Amino acid transport and metabolism]
Probab=23.81  E-value=41  Score=29.33  Aligned_cols=21  Identities=48%  Similarity=0.736  Sum_probs=15.9

Q ss_pred             ccceeeeeeccceeeEEEEeeCCe
Q 034135           67 NLNEYMVTLEKPLGIRFALTVDGK   90 (103)
Q Consensus        67 NLNEYMVtleKPLGIRFALtvdGK   90 (103)
                      +-||--|   -|-||||++.|+|+
T Consensus       178 ~P~EI~V---IpqG~RFsi~v~~~  198 (446)
T KOG1417|consen  178 TPNEIAV---IPQGIRFSIDVPGP  198 (446)
T ss_pred             cccceEE---eecccEEEEecCCC
Confidence            3455544   38999999999985


No 25 
>cd02563 PseudoU_synth_TruC tRNA pseudouridine isomerase C: Pseudouridine synthases catalyze the isomerization of specific uridines in an tRNA molecule to pseudouridines (5-ribosyluracil, psi).  No cofactors are required. TruC makes psi65 in tRNAs.  This psi residue is not universally conserved.
Probab=23.54  E-value=36  Score=24.71  Aligned_cols=14  Identities=36%  Similarity=0.714  Sum_probs=12.1

Q ss_pred             ceeeeeeccceeeE
Q 034135           69 NEYMVTLEKPLGIR   82 (103)
Q Consensus        69 NEYMVtleKPLGIR   82 (103)
                      ||+.+.+|||-|+=
T Consensus         7 d~~~lvvnKP~G~~   20 (223)
T cd02563           7 DEHLVAINKPSGLL   20 (223)
T ss_pred             cCCEEEEECCCCCe
Confidence            67888999999983


No 26 
>PF01344 Kelch_1:  Kelch motif;  InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified []. This sequence motif represents one beta-sheet blade, and several of these repeats can associate to form a beta-propeller. For instance, the motif appears 6 times in Drosophila egg-chamber regulatory protein, creating a 6-bladed beta-propeller. The motif is also found in mouse protein MIPP [] and in a number of poxviruses. In addition, kelch repeats have been recognised in alpha- and beta-scruin [, ], and in galactose oxidase from the fungus Dactylium dendroides [, ]. The structure of galactose oxidase reveals that the repeated sequence corresponds to a 4-stranded anti-parallel beta-sheet motif that forms the repeat unit in a super-barrel structural fold []. The known functions of kelch-containing proteins are diverse: scruin is an actin cross-linking protein; galactose oxidase catalyses the oxidation of the hydroxyl group at the C6 position in D-galactose; neuraminidase hydrolyses sialic acid residues from glycoproteins; and kelch may have a cytoskeletal function, as it is localised to the actin-rich ring canals that connect the 15 nurse cells to the developing oocyte in Drosophila []. Nevertheless, based on the location of the kelch pattern in the catalytic unit in galactose oxidase, functionally important residues have been predicted in glyoxal oxidase []. This entry represents a type of kelch sequence motif that comprises one beta-sheet blade.; GO: 0005515 protein binding; PDB: 2XN4_A 2WOZ_A 3II7_A 4ASC_A 1U6D_X 1ZGK_A 2FLU_X 2VPJ_A 2DYH_A 1X2R_A ....
Probab=23.08  E-value=80  Score=16.80  Aligned_cols=11  Identities=45%  Similarity=0.655  Sum_probs=8.5

Q ss_pred             EEeeCCeEEee
Q 034135           84 ALTVDGKIFVH   94 (103)
Q Consensus        84 ALtvdGKVfVH   94 (103)
                      +.+++|+|||-
T Consensus         7 ~~~~~~~iyv~   17 (47)
T PF01344_consen    7 AVVVGNKIYVI   17 (47)
T ss_dssp             EEEETTEEEEE
T ss_pred             EEEECCEEEEE
Confidence            45788999985


No 27 
>PF13313 DUF4082:  Domain of unknown function (DUF4082)
Probab=22.93  E-value=60  Score=24.24  Aligned_cols=17  Identities=35%  Similarity=0.847  Sum_probs=13.9

Q ss_pred             eeeEEEEeeCCeEEeeeec
Q 034135           79 LGIRFALTVDGKIFVHALR   97 (103)
Q Consensus        79 LGIRFALtvdGKVfVHaLk   97 (103)
                      ||+||--+++|.|  .+|+
T Consensus        21 LG~kF~~~~~G~v--tgvr   37 (149)
T PF13313_consen   21 LGVKFRSSVAGQV--TGVR   37 (149)
T ss_pred             EEeEEEecCCcEE--EEEE
Confidence            8999999999976  4554


No 28 
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification]
Probab=22.75  E-value=26  Score=31.05  Aligned_cols=14  Identities=43%  Similarity=0.264  Sum_probs=11.8

Q ss_pred             ccccceeeeeeccc
Q 034135           65 KMNLNEYMVTLEKP   78 (103)
Q Consensus        65 KMNLNEYMVtleKP   78 (103)
                      -.||||||||.|.=
T Consensus       302 vsnln~~~VT~d~L  315 (492)
T KOG1190|consen  302 VSNLNEEAVTPDVL  315 (492)
T ss_pred             EecCchhccchhHH
Confidence            35899999999974


No 29 
>PRK10158 23S rRNA/tRNA pseudouridine synthase A; Provisional
Probab=22.34  E-value=39  Score=24.70  Aligned_cols=14  Identities=29%  Similarity=0.627  Sum_probs=11.6

Q ss_pred             ceeeeeeccceeeE
Q 034135           69 NEYMVTLEKPLGIR   82 (103)
Q Consensus        69 NEYMVtleKPLGIR   82 (103)
                      +|.++.+|||-|+-
T Consensus        20 d~~~lvvnKPaGl~   33 (219)
T PRK10158         20 DEHIMVVNKPSGLL   33 (219)
T ss_pred             CCCEEEEECCCCCc
Confidence            56777899999994


No 30 
>PF08068 DKCLD:  DKCLD (NUC011) domain;  InterPro: IPR012960 This is an N-terminal domain of dyskerin-like proteins, which is often associated with the TruB N-terminal(IPR002501 from INTERPRO) and PUA(IPR002478 from INTERPRO) domains [].; PDB: 3ZV0_D 3UAI_A 3U28_A 2AUS_C 2RFK_A 3LWV_A 3HJY_A 3HAX_A 3LWO_A 3HAY_A ....
Probab=22.30  E-value=37  Score=22.33  Aligned_cols=19  Identities=47%  Similarity=0.807  Sum_probs=12.1

Q ss_pred             ccccccccee----eeeecccee
Q 034135           62 SYLKMNLNEY----MVTLEKPLG   80 (103)
Q Consensus        62 s~fKMNLNEY----MVtleKPLG   80 (103)
                      +..+-.+.||    +|.||||-|
T Consensus        30 ~P~~R~i~~~i~~GvinlDKP~g   52 (59)
T PF08068_consen   30 SPLKRPIEEYIKYGVINLDKPSG   52 (59)
T ss_dssp             -GGGS-HHHHHHTEEEEEEE-SS
T ss_pred             CcccCCHHHHHhCCcEEeeCCCC
Confidence            5556666676    599999987


No 31 
>PF07995 GSDH:  Glucose / Sorbosone dehydrogenase;  InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases. The best characterised of these proteins is soluble glucose dehydrogenase (P13650 from SWISSPROT) from Acinetobacter calcoaceticus, which oxidises glucose to gluconolactone. The enzyme is a calcium-dependent homodimer which uses PQQ as a cofactor [].; GO: 0016901 oxidoreductase activity, acting on the CH-OH group of donors, quinone or similar compound as acceptor, 0048038 quinone binding, 0005975 carbohydrate metabolic process; PDB: 2ISM_A 2WG3_D 3HO5_A 3HO4_A 3HO3_A 2WFT_A 2WG4_B 2WFX_B 1CRU_A 1CQ1_B ....
Probab=22.22  E-value=61  Score=24.92  Aligned_cols=21  Identities=33%  Similarity=0.436  Sum_probs=17.1

Q ss_pred             EEEeeCCeEEeeeeccccccC
Q 034135           83 FALTVDGKIFVHALRKGVIHR  103 (103)
Q Consensus        83 FALtvdGKVfVHaLkKG~ihr  103 (103)
                      +|++.||.+||-....|.|.|
T Consensus       311 v~~~pDG~Lyv~~d~~G~iyR  331 (331)
T PF07995_consen  311 VAQGPDGALYVSDDSDGKIYR  331 (331)
T ss_dssp             EEEETTSEEEEEE-TTTTEEE
T ss_pred             EEEcCCCeEEEEECCCCeEeC
Confidence            577789999999989898865


No 32 
>PF00543 P-II:  Nitrogen regulatory protein P-II members of this family.;  InterPro: IPR002187 In Gram-negative bacteria, the activity and concentration of glutamine synthetase (GS) is regulated in response to nitrogen source availability. PII, a tetrameric protein encoded by the glnB gene, is a component of the adenylation cascade involved in the regulation of GS activity []. In nitrogen-limiting conditions, when the ratio of glutamine to 2-ketoglutarate decreases, P-II is uridylylated on a tyrosine residue to form P-II-UMP. P-II-UMP allows the deadenylation of GS, thus activating the enzyme. Conversely, in nitrogen excess, P-II-UMP is deuridylated and then promotes the adenylation of GS. P-II also indirectly controls the transcription of the GS gene (glnA) by preventing NR-II (ntrB) to phosphorylate NR-I (ntrC) which is the transcriptional activator of glnA. Once P-II is uridylylated, these events are reversed. P-II is a protein of about 110 amino acid residues extremely well conserved. The tyrosine which is uridylated is located in the central part of the protein. In cyanobacteria, P-II seems to be phosphorylated on a serine residue rather than being uridylated. In methanogenic archaebacteria, the nitrogenase iron protein gene (nifH) is followed by two open reading frames highly similar to the eubacterial P-II protein []. These proteins could be involved in the regulation of nitrogen fixation. In the red alga, Porphyra purpurea, there is a glnB homologue encoded in the chloroplast genome. Other proteins highly similar to glnB are:   Bacillus subtilis protein nrgB [].  Escherichia coli hypothetical protein ybaI []. ; GO: 0030234 enzyme regulator activity, 0006808 regulation of nitrogen utilization; PDB: 1V3S_B 1V3R_C 2XZW_A 2XUL_A 2V5H_J 2XG8_C 2JJ4_F 1QY7_C 4AFF_A 2XBP_A ....
Probab=21.98  E-value=44  Score=21.61  Aligned_cols=12  Identities=50%  Similarity=0.778  Sum_probs=8.2

Q ss_pred             eeCCeEEeeeec
Q 034135           86 TVDGKIFVHALR   97 (103)
Q Consensus        86 tvdGKVfVHaLk   97 (103)
                      .=||||||--+.
T Consensus        83 ~GdGkIfV~~V~   94 (102)
T PF00543_consen   83 PGDGKIFVSPVE   94 (102)
T ss_dssp             TTSEEEEEEEES
T ss_pred             CCCEEEEEEEhh
Confidence            348999986543


No 33 
>PF09696 Ctf8:  Ctf8;  InterPro: IPR018607  Ctf8 (chromosome transmissions fidelity 8) is a component of the Ctf18 RFC-like complex which is a DNA clamp loader involved in sister chromatid cohesion. 
Probab=21.84  E-value=47  Score=23.17  Aligned_cols=11  Identities=45%  Similarity=0.806  Sum_probs=9.3

Q ss_pred             eeeeeccceee
Q 034135           71 YMVTLEKPLGI   81 (103)
Q Consensus        71 YMVtleKPLGI   81 (103)
                      =++.|+|||+|
T Consensus        71 kv~kL~kPLaV   81 (122)
T PF09696_consen   71 KVVKLKKPLAV   81 (122)
T ss_pred             EEeccCCCEEE
Confidence            36899999997


No 34 
>KOG2509 consensus Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis]
Probab=21.79  E-value=35  Score=29.93  Aligned_cols=21  Identities=52%  Similarity=0.907  Sum_probs=18.1

Q ss_pred             cceeeEEEE--eeCC-eEEeeeec
Q 034135           77 KPLGIRFAL--TVDG-KIFVHALR   97 (103)
Q Consensus        77 KPLGIRFAL--tvdG-KVfVHaLk   97 (103)
                      |=|||||..  +-|| +-|||-|-
T Consensus       377 RRL~IRy~~~k~~~~~~~yvHtLN  400 (455)
T KOG2509|consen  377 RRLGIRYGQKKTNDGEKKYVHTLN  400 (455)
T ss_pred             hhhhhhcccccccCCccceeeecc
Confidence            679999999  8888 78999873


No 35 
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis]
Probab=21.26  E-value=67  Score=25.82  Aligned_cols=23  Identities=22%  Similarity=0.433  Sum_probs=18.7

Q ss_pred             eeccceeeEEEEeeCCeEEeeee
Q 034135           74 TLEKPLGIRFALTVDGKIFVHAL   96 (103)
Q Consensus        74 tleKPLGIRFALtvdGKVfVHaL   96 (103)
                      +|.+=++++.++..+|+|||.+=
T Consensus       170 ~l~~~~~~~I~VG~NG~IWV~~~  192 (239)
T COG1097         170 MLKEKTGCEIIVGQNGRIWVDGE  192 (239)
T ss_pred             HhhhhcCeEEEEecCCEEEecCC
Confidence            34555799999999999999753


No 36 
>PF03725 RNase_PH_C:  3' exoribonuclease family, domain 2 This Prosite family only includes Ribonuclease PH;  InterPro: IPR015847 The PH (phosphorolytic) domain is responsible for 3'-5' exoribonuclease activity, although in some proteins this domain has lost its catalytic function. An active PH domain uses inorganic phosphate as a nucleophile, adding it across the phosphodiester bond between the end two nucleotides in order to release ribonucleoside 5'-diphosphate (rNDP) from the 3' end of the RNA substrate. PH domains can be found in bacterial/organelle RNases and PNPases (polynucleotide phosphorylases) [], as well as in archaeal and eukaryotic RNA exosomes [, ], the later acting as nano-compartments for the degradation or processing of RNA (including mRNA, rRNA, snRNA and snoRNA). Bacterial/organelle PNPases share a common barrel structure with RNA exosomes, consisting of a hexameric ring of PH domains that act as a degradation chamber, and an S1-domain/KH-domain containing cap that binds the RNA substrate (and sometimes accessory proteins) in order to regulate and restrict entry into the degradation chamber []. Unstructured RNA substrates feed in through the pore made by the S1 domains, are degraded by the PH domain ring, and exit as nucleotides via the PH pore at the opposite end of the barrel [, ]. This entry represents the phosphorolytic (PH) domain 2, which has a core 3-layer alpha/beta/alpha structure. This domain is found in bacterial/organelle PNPases and in archaeal/eukaryotic exosomes []. More information about these proteins can be found at Protein of the Month: RNA Exosomes [].; GO: 0003723 RNA binding, 0006396 RNA processing; PDB: 1E3H_A 1E3P_A 2NN6_E 2WNR_A 3U1K_B 2BA0_H 2BA1_H 3M85_G 3M7N_H 3H1C_K ....
Probab=20.98  E-value=1.2e+02  Score=17.72  Aligned_cols=17  Identities=24%  Similarity=0.688  Sum_probs=12.3

Q ss_pred             ceeeEEEEeeCCeEEeee
Q 034135           78 PLGIRFALTVDGKIFVHA   95 (103)
Q Consensus        78 PLGIRFALtvdGKVfVHa   95 (103)
                      |.++++|+- ||+++|+-
T Consensus         3 ~~avt~~~i-~~~~v~Dp   19 (68)
T PF03725_consen    3 PVAVTVGII-DGELVVDP   19 (68)
T ss_dssp             EEEEEEEEE-TTEEEES-
T ss_pred             eEEEEEEEE-CCEEEECC
Confidence            778888886 77777753


No 37 
>TIGR01621 RluA-like pseudouridine synthase Rlu family protein, TIGR01621. This model represents a clade of sequences within the pseudouridine synthase superfamily (pfam00849). The superfamily includes E. coli proteins: RluA, RluB, RluC, RluD, and RsuA. The sequences modeled here are most closely related to RluA. Neisseria, among those species hitting this model, does not appear to have an RluA homolog. It is presumed that these sequences function as pseudouridine synthases, although perhaps with different specificity.
Probab=20.43  E-value=45  Score=24.42  Aligned_cols=14  Identities=21%  Similarity=0.332  Sum_probs=12.1

Q ss_pred             ceeeeeeccceeeE
Q 034135           69 NEYMVTLEKPLGIR   82 (103)
Q Consensus        69 NEYMVtleKPLGIR   82 (103)
                      +|+.+.++||-|+-
T Consensus         8 d~~~lvvnKP~Gl~   21 (217)
T TIGR01621         8 HPDFLLINKHPGIS   21 (217)
T ss_pred             CCCEEEEECCCCCe
Confidence            67889999999983


No 38 
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements. May be responsible for specific protein-protein interactions, as most PDZ domains bind C-terminal polypeptides, and binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated. In this subfamily of PDZ domains an N-terminal beta-strand forms the peptide-binding groove base, a circular permutation with respect to PDZ domains found in proteases.
Probab=20.42  E-value=1.5e+02  Score=16.96  Aligned_cols=25  Identities=32%  Similarity=0.412  Sum_probs=15.6

Q ss_pred             ccceeeEEEEeeC--CeEEeeeecccc
Q 034135           76 EKPLGIRFALTVD--GKIFVHALRKGV  100 (103)
Q Consensus        76 eKPLGIRFALtvd--GKVfVHaLkKG~  100 (103)
                      .+|+|+++.-..+  +-++|..+..|+
T Consensus        11 ~~~~G~~~~~~~~~~~~~~V~~v~~~s   37 (82)
T cd00992          11 GGGLGFSLRGGKDSGGGIFVSRVEPGG   37 (82)
T ss_pred             CCCcCEEEeCcccCCCCeEEEEECCCC
Confidence            3568877654432  347888777664


No 39 
>cd02557 PseudoU_synth_ScRIB2 PseudoU_synth_ScRIB2_like: Pseudouridine synthase, Saccharomyces cerevisiae RIB2_like. This group is comprised of eukaryotic and bacterial proteins similar to Saccharomyces cerevisiae RIB2, S. cerevisiae Pus6p and human hRPUDSD2. S. cerevisiae RIB2 displays two distinct catalytic activities. The N-terminal domain of RIB2 is RNA:psi-synthase which makes psi32 on cytoplasmic tRNAs. Psi32 is highly phylogenetically conserved.   The C-terminal domain of RIB2 has a DRAP deaminase activity which catalyses the formation of 5-amino-6-ribitylamino-2,4(1H,3H)-pyrimidinedione 5'-phosphate from 2,5-diamino-6-ribitylamino-4(3H)-pyrimidinone 5'-phosphate during riboflavin biosynthesis. S. cerevisiae Pus6p makes the psi31 of cytoplasmic and mitochondrial tRNAs.
Probab=20.28  E-value=46  Score=24.16  Aligned_cols=13  Identities=31%  Similarity=0.782  Sum_probs=11.2

Q ss_pred             ceeeeeeccceee
Q 034135           69 NEYMVTLEKPLGI   81 (103)
Q Consensus        69 NEYMVtleKPLGI   81 (103)
                      +|.++.+|||-|+
T Consensus        22 d~~~ivvnKP~Gl   34 (213)
T cd02557          22 DDDLLVVDKPSGI   34 (213)
T ss_pred             CCCEEEEECCCCC
Confidence            6778889999997


No 40 
>TIGR00005 rluA_subfam pseudouridine synthase, RluA family. modifies uracil-65 in transfer RNAs to pseudouridine.
Probab=20.27  E-value=45  Score=24.86  Aligned_cols=15  Identities=27%  Similarity=0.634  Sum_probs=12.5

Q ss_pred             ceeeeeeccceeeEE
Q 034135           69 NEYMVTLEKPLGIRF   83 (103)
Q Consensus        69 NEYMVtleKPLGIRF   83 (103)
                      +++++.+|||-|+=-
T Consensus        78 d~~~lvvnKP~g~~~   92 (299)
T TIGR00005        78 DEDIIVINKPSGLVV   92 (299)
T ss_pred             CCCEEEEECCCCCeE
Confidence            478899999999844


Done!