Citrus Sinensis ID: 034135

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MSNPQLSSRRTTSFPSSSSFLEKNLFSINGVPKQLSFGRDRVKVRFSKKIVRVHALSSNSNSYLKMNLNEYMVTLEKPLGIRFALTVDGKIFVHALRKGVIHR
ccccccccccccccccccHHHHccccccccccccccccccCEEEEEEccEEEEEEEEcccccccEEcccEEEEEEEccEEEEEEEEEccEEEHHHHHHccccc
******************SFLEKNLFSINGVPKQLSFGRDRVKVRFSKKIVRVHALSSNSNSYLKMNLNEYMVTLEKPLGIRFALTVDGKIFVHALRKGVI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSNPQLSSRRTTSFPSSSSFLEKNLFSINGVPKQLSFGRDRVKVRFSKKIVRVHALSSNSNSYLKMNLNEYMVTLEKPLGIRFALTVDGKIFVHALRKGVIHR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphoglucan phosphatase LSF1, chloroplastic Starch granule-associated phosphoglucan phosphatase involved in the control of starch accumulation. Participates to the regulation of the initial steps of starch degradation at the granule surface. May release a different set of phosphate groups from those removed by DSP4.probableF4J117

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted