BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034138
(103 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4DRB|C Chain C, The Crystal Structure Of Fancm Bound Mhf Complex
pdb|4DRB|F Chain F, The Crystal Structure Of Fancm Bound Mhf Complex
pdb|4DRB|I Chain I, The Crystal Structure Of Fancm Bound Mhf Complex
Length = 141
Score = 25.4 bits (54), Expect = 9.1, Method: Compositional matrix adjust.
Identities = 14/53 (26%), Positives = 23/53 (43%), Gaps = 11/53 (20%)
Query: 24 IPYRDQCAHLLIPLNKCRQAEFYLPWKCENERHSYEKCEYELVMERMLQMQKI 76
+ + D+C H + + E RH +C YEL +E LQM+ +
Sbjct: 90 VDHSDRCRHFIGLMQMI-----------EGMRHEEGECSYELEVESYLQMEDV 131
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.130 0.384
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,700,648
Number of Sequences: 62578
Number of extensions: 85627
Number of successful extensions: 159
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 156
Number of HSP's gapped (non-prelim): 3
length of query: 103
length of database: 14,973,337
effective HSP length: 68
effective length of query: 35
effective length of database: 10,718,033
effective search space: 375131155
effective search space used: 375131155
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)