Citrus Sinensis ID: 034150


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MNECAVFVNEACCPPLESCAFCLVLFSSTNNKFLKSLHVLILEGDGSKIQAALAEWTGQRTVPNVFIGGKHIGGCDTVVEKHQGGKLVPLLRDAGALALADK
cccEEEEEEcCECccccccHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHccccccEEEEccEEEccHHHHHHHHHccccHHHHHHccccccccc
*NECAVFVNEACCPPLESCAFCLVLFSSTNNKFLKSLHVLILEGDGSKIQAALAEWTGQRTVPNVFIGGKHIGGCDTVVEKHQGGKLVPLLRDAGALALAD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNECAVFVNEACCPPLESCAFCLVLFSSTNNKFLKSLHVLILEGDGSKIQAALAEWTGQRTVPNVFIGGKHIGGCDTVVEKHQGGKLVPLLRDAGALALADK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutaredoxin-C2 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins.probableQ9FNE2
Glutaredoxin-1 The disulfide bond functions as an electron carrier in the glutathione-dependent synthesis of deoxyribonucleotides by the enzyme ribonucleotide reductase. In addition, it is also involved in reducing some disulfides in a coupled system with glutathione reductase. Thioltransferase catalyzes cellular thiol-disulfide transhydrogenation reactions. It transfers reducing equivalents to cytosolic protein and nonprotein disulfides.probableO36032
Glutaredoxin-C6 Has a glutathione-disulfide oxidoreductase activity in the presence of NADPH and glutathione reductase. Reduces low molecular weight disulfides and proteins. Possesses thioltransferase, dehydroascorbate reductase and GSH-dependent peroxidase activities in vitro.probableP55142

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2E7P, chain A
Confidence level:very confident
Coverage over the Query: 5-96
View the alignment between query and template
View the model in PyMOL