Query         034154
Match_columns 102
No_of_seqs    13 out of 15
Neff          2.1 
Searched_HMMs 46136
Date          Fri Mar 29 10:22:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034154.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034154hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF09865 DUF2092:  Predicted pe  53.7      12 0.00026   28.9   2.4   22   81-102   164-185 (214)
  2 smart00042 CUB Domain first fo  34.0      35 0.00075   20.7   1.8   15   79-93     14-28  (102)
  3 COG3900 Predicted periplasmic   32.9      39 0.00086   28.0   2.5   22   81-102   199-220 (262)
  4 PF11259 DUF3060:  Protein of u  32.3      35 0.00076   21.7   1.7   16   60-75      1-16  (61)
  5 PRK15452 putative protease; Pr  31.3      20 0.00044   30.3   0.6   30   53-87    161-201 (443)
  6 PF05284 DUF736:  Protein of un  29.4      51  0.0011   23.0   2.3   16   86-101    28-46  (107)
  7 PF00431 CUB:  CUB domain CUB d  29.3      34 0.00074   20.7   1.2   12   81-92     25-36  (110)
  8 cd00041 CUB CUB domain; extrac  25.9      66  0.0014   19.4   2.1   13   80-92     25-37  (113)
  9 PF04972 BON:  BON domain;  Int  24.6      65  0.0014   18.8   1.8   16   62-77     22-37  (64)
 10 PF02495 7kD_coat:  7kD viral c  24.6      25 0.00054   21.8   0.0   17   63-80     31-47  (59)
 11 PF03108 DBD_Tnp_Mut:  MuDR fam  23.0 1.3E+02  0.0029   18.1   3.0   32   65-100    36-67  (67)
 12 PRK15367 type III secretion sy  21.7      57  0.0012   28.1   1.6   17   64-80    162-178 (395)
 13 PF11127 DUF2892:  Protein of u  21.3      20 0.00043   22.0  -0.9    8   70-77     48-55  (66)
 14 COG5489 Uncharacterized conser  20.6      66  0.0014   23.6   1.5   16   86-101    31-49  (107)
 15 PRK10738 hypothetical protein;  20.6      36 0.00079   24.0   0.2   13   70-82    109-121 (134)
 16 PF14901 Jiv90:  Cleavage induc  20.4      57  0.0012   23.1   1.1   11   92-102    84-94  (94)
 17 PLN02856 fumarylacetoacetase    20.3 1.2E+02  0.0026   26.2   3.2   29   62-91    391-423 (424)
 18 PF13656 RNA_pol_L_2:  RNA poly  20.1      80  0.0017   20.6   1.7   11   64-74     24-34  (77)

No 1  
>PF09865 DUF2092:  Predicted periplasmic protein (DUF2092);  InterPro: IPR019207  This entry represents various hypothetical prokaryotic proteins of unknown function. 
Probab=53.68  E-value=12  Score=28.86  Aligned_cols=22  Identities=27%  Similarity=0.529  Sum_probs=19.4

Q ss_pred             cceeeEEeeCCCCCCCceeEeC
Q 034154           81 EPCRWEILPASDSDAPQFRVVF  102 (102)
Q Consensus        81 epCrWei~pa~~~~aPQfrvvF  102 (102)
                      =|||--|.-...+++|||++.|
T Consensus       164 LP~k~vIT~k~~~~~PQy~~~~  185 (214)
T PF09865_consen  164 LPRKYVITYKTDPGSPQYSAEF  185 (214)
T ss_pred             eeeEEEEEECCCCCCceEEEEE
Confidence            5899999888889999999876


No 2  
>smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein. This domain is found mostly among developmentally-regulated proteins. Spermadhesins contain only this domain.
Probab=33.95  E-value=35  Score=20.67  Aligned_cols=15  Identities=20%  Similarity=0.452  Sum_probs=10.5

Q ss_pred             CCcceeeEEeeCCCC
Q 034154           79 DLEPCRWEILPASDS   93 (102)
Q Consensus        79 dlepCrWei~pa~~~   93 (102)
                      .-.-|+|.|....+.
T Consensus        14 ~~~~C~w~i~~~~g~   28 (102)
T smart00042       14 NNLDCVWTIRAPPGY   28 (102)
T ss_pred             CCCcEEEEEECCCCe
Confidence            345699999877643


No 3  
>COG3900 Predicted periplasmic protein [Function unknown]
Probab=32.94  E-value=39  Score=28.04  Aligned_cols=22  Identities=32%  Similarity=0.590  Sum_probs=17.2

Q ss_pred             cceeeEEeeCCCCCCCceeEeC
Q 034154           81 EPCRWEILPASDSDAPQFRVVF  102 (102)
Q Consensus        81 epCrWei~pa~~~~aPQfrvvF  102 (102)
                      -|||.-|---.-.++|||-|+|
T Consensus       199 vp~k~VITsk~v~g~PqYtv~f  220 (262)
T COG3900         199 VPLKYVITSKDVPGEPQYTVVF  220 (262)
T ss_pred             cceeEEEEecccCCCCcEEEEE
Confidence            4777777777777999999887


No 4  
>PF11259 DUF3060:  Protein of unknown function (DUF3060);  InterPro: IPR021417  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. 
Probab=32.30  E-value=35  Score=21.74  Aligned_cols=16  Identities=44%  Similarity=0.708  Sum_probs=11.9

Q ss_pred             cceecCCceEEEeeec
Q 034154           60 SVAASADKVTMAGYCP   75 (102)
Q Consensus        60 Saa~s~d~VTlaGyCp   75 (102)
                      |+..++..|||.|.|-
T Consensus         1 ~V~G~~N~vt~~G~c~   16 (61)
T PF11259_consen    1 SVSGSGNTVTVTGDCG   16 (61)
T ss_pred             CeeccCCEEEEEeEEe
Confidence            3556677899999883


No 5  
>PRK15452 putative protease; Provisional
Probab=31.32  E-value=20  Score=30.27  Aligned_cols=30  Identities=33%  Similarity=0.842  Sum_probs=22.5

Q ss_pred             ceEEEeccceecCCceEEEeeecCCCCC-----------cceeeEE
Q 034154           53 VTVFEFGSVAASADKVTMAGYCPVSDDL-----------EPCRWEI   87 (102)
Q Consensus        53 ~tVFEFGSaa~s~d~VTlaGyCpVsddl-----------epCrWei   87 (102)
                      .-||=.|..-     +...|+|++|.=+           .||||+-
T Consensus       161 lEvfVHGalc-----~m~Sg~Clls~~~~~rs~nrg~C~q~CR~~y  201 (443)
T PRK15452        161 LEVFVHGALC-----MAYSGRCLLSGYINKRDPNQGTCTNACRWEY  201 (443)
T ss_pred             EEEEEEccch-----heeeCcchHHHHhhcCCCCCCcccCcccccc
Confidence            4567777764     7789999998433           6899976


No 6  
>PF05284 DUF736:  Protein of unknown function (DUF736);  InterPro: IPR007948 This family consists of several uncharacterised bacterial proteins of unknown function.
Probab=29.43  E-value=51  Score=22.98  Aligned_cols=16  Identities=31%  Similarity=0.800  Sum_probs=12.4

Q ss_pred             EEeeCCC---CCCCceeEe
Q 034154           86 EILPASD---SDAPQFRVV  101 (102)
Q Consensus        86 ei~pa~~---~~aPQfrvv  101 (102)
                      .|+|...   +.||.|||.
T Consensus        28 ~lvP~~~~~~e~aPdyRV~   46 (107)
T PF05284_consen   28 RLVPNESKDSENAPDYRVY   46 (107)
T ss_pred             EEEeCCCCCCCCCCCEEEE
Confidence            5777665   699999985


No 7  
>PF00431 CUB:  CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork. ;  InterPro: IPR000859 The CUB domain (for complement C1r/C1s, Uegf, Bmp1) is a structural motif of approximately 110 residues found almost exclusively in extracellular and plasma membrane-associated proteins, many of which are developmentally regulated [, ]. These proteins are involved in a diverse range of functions, including complement activation, developmental patterning, tissue repair, axon guidance and angiogenesis, cell signalling, fertilisation, haemostasis, inflammation, neurotransmission, receptor-mediated endocytosis, and tumour suppression [, ]. Many CUB-containing proteins are peptidases belonging to MEROPS peptidase families M12A (astacin) and S1A (chymotrypsin). Proteins containing a CUB domain include:  Mammalian complement subcomponents C1s/C1r, which form the calcium-dependent complex C1, the first component of the classical pathway of the complement system.  Cricetidae sp. (Hamster) serine protease Casp, which degrades type I and IV collagen and fibronectin in the presence of calcium. Mammalian complement-activating component of Ra-reactive factor (RARF), a protease that cleaves the C4 component of complement. Vertebrate enteropeptidase (3.4.21.9 from EC), a type II membrane protein of the intestinal brush border, which activates trypsinogen. Vertebrate bone morphogenic protein 1 (BMP-1), a protein which induces cartilage and bone formation and expresses metalloendopeptidase activity. Sea urchin blastula proteins BP10 and SpAN.  Caenorhabditis elegans hypothetical proteins F42A10.8 and R151.5. Neuropilin (A5 antigen), a calcium-independent cell adhesion molecule that functions during the formation of certain neuronal circuits. Fibropellins I and III from Strongylocentrotus purpuratus (Purple sea urchin). Mammalian hyaluronate-binding protein TSG-6 (or PS4), a serum and growth factor induced protein. Mammalian spermadhesins.  Xenopus laevis embryonic protein UVS.2, which is expressed during dorsoanterior development.  Several of the above proteins consist of a catalytic domain together with several CUB domains interspersed by calcium-binding EGF domains. Some CUB domains appear to be involved in oligomerisation and/or recognition of substrates and binding partners. For example, in the complement proteases, the CUB domains mediate dimerisation and binding to collagen-like regions of target proteins (e.g. C1q for C1r/C1s). The structure of CUB domains consists of a beta-sandwich with a jelly-roll fold. Almost all CUB domains contain four conserved cysteines that probably form two disulphide bridges (C1-C2, C3-C4). The CUB1 domains of C1s and Map19 have calcium-binding sites [].; PDB: 1SFP_A 3KQ4_B 2WNO_A 2QQK_A 2QQL_A 2QQO_B 2QQM_A 3POJ_A 3POB_A 3POG_B ....
Probab=29.30  E-value=34  Score=20.66  Aligned_cols=12  Identities=25%  Similarity=0.797  Sum_probs=8.4

Q ss_pred             cceeeEEeeCCC
Q 034154           81 EPCRWEILPASD   92 (102)
Q Consensus        81 epCrWei~pa~~   92 (102)
                      .-|+|.|....+
T Consensus        25 ~~C~w~i~~~~~   36 (110)
T PF00431_consen   25 SDCTWTITAPPG   36 (110)
T ss_dssp             EEEEEEEE-STT
T ss_pred             CcEeEEEEeccc
Confidence            459999987654


No 8  
>cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast.
Probab=25.91  E-value=66  Score=19.37  Aligned_cols=13  Identities=23%  Similarity=0.493  Sum_probs=10.2

Q ss_pred             CcceeeEEeeCCC
Q 034154           80 LEPCRWEILPASD   92 (102)
Q Consensus        80 lepCrWei~pa~~   92 (102)
                      -.-|+|.|....+
T Consensus        25 ~~~C~w~i~~~~g   37 (113)
T cd00041          25 NLNCVWTIEAPPG   37 (113)
T ss_pred             CCcEEEEEEcCCC
Confidence            3569999988775


No 9  
>PF04972 BON:  BON domain;  InterPro: IPR007055 The BON domain is typically ~60 residues long and has an alpha/beta predicted fold. There is a conserved glycine residue and several hydrophobic regions. This pattern of conservation is more suggestive of a binding or structural function rather than a catalytic function. Most proteobacteria seem to possess one or two BON-containing proteins, typically of the OsmY-type proteins; outside of this group the distribution is more disparate.  The OsmY protein is an Escherichia coli 20 kDa outer membrane or periplasmic protein that is expressed in response to a variety of stress conditions, in particular, helping to provide protection against osmotic shock. One hypothesis is that OsmY prevents shrinkage of the cytoplasmic compartment by contacting the phospholipid interfaces surrounding the periplasmic space. The domain architecture of two BON domains alone suggests that these domains contact the surfaces of phospholipids, with each domain contacting a membrane [].; PDB: 2L26_A 2KGS_A 2KSM_A.
Probab=24.63  E-value=65  Score=18.82  Aligned_cols=16  Identities=25%  Similarity=0.418  Sum_probs=12.0

Q ss_pred             eecCCceEEEeeecCC
Q 034154           62 AASADKVTMAGYCPVS   77 (102)
Q Consensus        62 a~s~d~VTlaGyCpVs   77 (102)
                      ...++.|+|.|.+|=.
T Consensus        22 ~v~~g~v~L~G~v~s~   37 (64)
T PF04972_consen   22 SVENGVVTLSGEVPSQ   37 (64)
T ss_dssp             EEECTEEEEEEEESSC
T ss_pred             EEECCEEEEEeeCcHH
Confidence            3457789999998743


No 10 
>PF02495 7kD_coat:  7kD viral coat protein;  InterPro: IPR003411 This family consists of a 7 kDa coat protein from Carlavirus and Potexvirus [].
Probab=24.58  E-value=25  Score=21.83  Aligned_cols=17  Identities=24%  Similarity=0.720  Sum_probs=13.4

Q ss_pred             ecCCceEEEeeecCCCCC
Q 034154           63 ASADKVTMAGYCPVSDDL   80 (102)
Q Consensus        63 ~s~d~VTlaGyCpVsddl   80 (102)
                      -+|..|++.| |+.+.|+
T Consensus        31 ItGeSv~I~g-C~~~~e~   47 (59)
T PF02495_consen   31 ITGESVTISG-CEFTPEF   47 (59)
T ss_pred             EeCcEEEEEC-CCCCHHH
Confidence            3678899999 9888654


No 11 
>PF03108 DBD_Tnp_Mut:  MuDR family transposase;  InterPro: IPR004332 The plant MuDR transposase domain is present in plant proteins that are presumed to be the transposases for Mutator transposable elements [, ]. The function of these proteins is unknown. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=23.02  E-value=1.3e+02  Score=18.13  Aligned_cols=32  Identities=19%  Similarity=0.571  Sum_probs=21.8

Q ss_pred             CCceEEEeeecCCCCCcceeeEEeeCCCCCCCceeE
Q 034154           65 ADKVTMAGYCPVSDDLEPCRWEILPASDSDAPQFRV  100 (102)
Q Consensus        65 ~d~VTlaGyCpVsddlepCrWei~pa~~~~aPQfrv  100 (102)
                      +|+-.+.-.|- .   +-|.|+|.=+-..+.-.|.|
T Consensus        36 sd~~r~~~~C~-~---~~C~Wrv~as~~~~~~~~~I   67 (67)
T PF03108_consen   36 SDKKRYRAKCK-D---KGCPWRVRASKRKRSDTFQI   67 (67)
T ss_pred             cCCEEEEEEEc-C---CCCCEEEEEEEcCCCCEEEC
Confidence            45667888898 2   23999998766655555543


No 12 
>PRK15367 type III secretion system protein SsaD; Provisional
Probab=21.74  E-value=57  Score=28.11  Aligned_cols=17  Identities=24%  Similarity=0.778  Sum_probs=12.8

Q ss_pred             cCCceEEEeeecCCCCC
Q 034154           64 SADKVTMAGYCPVSDDL   80 (102)
Q Consensus        64 s~d~VTlaGyCpVsddl   80 (102)
                      +++.|+|.|||-=|..+
T Consensus       162 ~dg~l~LsGyC~~s~~~  178 (395)
T PRK15367        162 EDGSLQLSGYCSSSEQM  178 (395)
T ss_pred             CCCcEEEEEEECChHHH
Confidence            36689999999766443


No 13 
>PF11127 DUF2892:  Protein of unknown function (DUF2892);  InterPro: IPR021309  This family is conserved in bacteria. The function is not known. 
Probab=21.28  E-value=20  Score=22.00  Aligned_cols=8  Identities=38%  Similarity=1.406  Sum_probs=6.5

Q ss_pred             EEeeecCC
Q 034154           70 MAGYCPVS   77 (102)
Q Consensus        70 laGyCpVs   77 (102)
                      ++||||+.
T Consensus        48 ~~g~Cp~~   55 (66)
T PF11127_consen   48 ITGFCPLY   55 (66)
T ss_pred             HHCcCHhH
Confidence            57999986


No 14 
>COG5489 Uncharacterized conserved protein [Function unknown]
Probab=20.59  E-value=66  Score=23.60  Aligned_cols=16  Identities=44%  Similarity=0.902  Sum_probs=11.6

Q ss_pred             EEeeC---CCCCCCceeEe
Q 034154           86 EILPA---SDSDAPQFRVV  101 (102)
Q Consensus        86 ei~pa---~~~~aPQfrvv  101 (102)
                      +|+|.   ++++||.|||.
T Consensus        31 ~lvPn~~~s~~~aPdfRV~   49 (107)
T COG5489          31 RLVPNESKSGDNAPDFRVT   49 (107)
T ss_pred             EEcccCCCCCCCCCcEEEE
Confidence            46664   34689999995


No 15 
>PRK10738 hypothetical protein; Provisional
Probab=20.57  E-value=36  Score=23.96  Aligned_cols=13  Identities=38%  Similarity=0.575  Sum_probs=10.1

Q ss_pred             EEeeecCCCCCcc
Q 034154           70 MAGYCPVSDDLEP   82 (102)
Q Consensus        70 laGyCpVsddlep   82 (102)
                      +.-||||++-|++
T Consensus       109 ~~kyC~V~~~l~~  121 (134)
T PRK10738        109 AEKYCSVALMLEK  121 (134)
T ss_pred             HccCCcHHHHhCC
Confidence            4569999987774


No 16 
>PF14901 Jiv90:  Cleavage inducing molecular chaperone
Probab=20.42  E-value=57  Score=23.14  Aligned_cols=11  Identities=18%  Similarity=0.392  Sum_probs=9.5

Q ss_pred             CCCCCceeEeC
Q 034154           92 DSDAPQFRVVF  102 (102)
Q Consensus        92 ~~~aPQfrvvF  102 (102)
                      +.|.+||||+|
T Consensus        84 ntH~vqyri~~   94 (94)
T PF14901_consen   84 NTHRVQYRINT   94 (94)
T ss_pred             CcccceeeecC
Confidence            37999999986


No 17 
>PLN02856 fumarylacetoacetase
Probab=20.25  E-value=1.2e+02  Score=26.20  Aligned_cols=29  Identities=31%  Similarity=0.700  Sum_probs=23.0

Q ss_pred             eecCCceEEEeeecCCCC----CcceeeEEeeCC
Q 034154           62 AASADKVTMAGYCPVSDD----LEPCRWEILPAS   91 (102)
Q Consensus        62 a~s~d~VTlaGyCpVsdd----lepCrWei~pa~   91 (102)
                      =+-||.|+|.|+|.= |.    +-.|+=+|+||.
T Consensus       391 L~dGD~V~l~g~~~~-~g~~igfG~~~g~v~pa~  423 (424)
T PLN02856        391 LEDGDEVVLSGWCKG-DGYRVGFGTCSGKVLPAL  423 (424)
T ss_pred             CCCCCEEEEEEEECC-CCccEeeeeeeeEEecCC
Confidence            467899999999965 33    457999999983


No 18 
>PF13656 RNA_pol_L_2:  RNA polymerase Rpb3/Rpb11 dimerisation domain; PDB: 2Y0S_L 1I3Q_K 4A3D_K 2JA8_K 3GTP_K 1R9T_K 3PO2_K 4A3J_K 3HOX_K 2JA7_K ....
Probab=20.09  E-value=80  Score=20.59  Aligned_cols=11  Identities=36%  Similarity=0.579  Sum_probs=9.4

Q ss_pred             cCCceEEEeee
Q 034154           64 SADKVTMAGYC   74 (102)
Q Consensus        64 s~d~VTlaGyC   74 (102)
                      .+.+|+.|||+
T Consensus        24 ~~p~V~fagY~   34 (77)
T PF13656_consen   24 KDPDVEFAGYR   34 (77)
T ss_dssp             TSTTEEEEEEE
T ss_pred             hCCCeEEEEec
Confidence            46789999998


Done!