BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 034182
         (102 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2RHE|A Chain A, Structure Of A Novel Bence-Jones Protein (Rhe) Fragment
          At 1.6 Angstroms Resolution
          Length = 114

 Score = 27.3 bits (59), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 19 TRNLTAVANQISEHTAKWMQDVSKKSPMELI--NEVPPIKVEGRIVACEGDSNPAL 72
          T + T  A  I  ++  W Q V  K+P  LI  N++ P  V  R  A +  ++ +L
Sbjct: 19 TISCTGSATDIGSNSVIWYQQVPGKAPKLLIYYNDLLPSGVSDRFSASKSGTSASL 74


>pdb|2IEX|A Chain A, Crystal Structure Of Dihydroxynapthoic Acid Synthetase
           (Gk2873) From Geobacillus Kaustophilus Hta426
 pdb|2IEX|B Chain B, Crystal Structure Of Dihydroxynapthoic Acid Synthetase
           (Gk2873) From Geobacillus Kaustophilus Hta426
 pdb|2IEX|C Chain C, Crystal Structure Of Dihydroxynapthoic Acid Synthetase
           (Gk2873) From Geobacillus Kaustophilus Hta426
          Length = 272

 Score = 26.2 bits (56), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 9/21 (42%), Positives = 14/21 (66%)

Query: 28  QISEHTAKWMQDVSKKSPMEL 48
           Q+ E T KW Q++ +KSP  +
Sbjct: 196 QLEEETVKWAQEILEKSPTAI 216


>pdb|2A7R|A Chain A, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 (Gmpr2)
 pdb|2A7R|B Chain B, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 (Gmpr2)
 pdb|2A7R|C Chain C, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 (Gmpr2)
 pdb|2A7R|D Chain D, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 (Gmpr2)
          Length = 366

 Score = 25.8 bits (55), Expect = 6.3,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 25  VANQISEHTAKWMQDVSKKSPMELI 49
           VAN  SEH  ++++DV K+ P   I
Sbjct: 148 VANGYSEHFVEFVKDVRKRFPQHTI 172


>pdb|2BZN|A Chain A, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|B Chain B, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|C Chain C, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|D Chain D, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|E Chain E, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|F Chain F, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|G Chain G, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2BZN|H Chain H, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp
 pdb|2C6Q|A Chain A, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|B Chain B, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|C Chain C, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|D Chain D, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|E Chain E, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|F Chain F, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|G Chain G, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
 pdb|2C6Q|H Chain H, Crystal Structure Of Human Guanosine Monophosphate
           Reductase 2 Gmpr2 In Complex With Imp And Nadph
          Length = 351

 Score = 25.8 bits (55), Expect = 6.3,   Method: Composition-based stats.
 Identities = 11/25 (44%), Positives = 16/25 (64%)

Query: 25  VANQISEHTAKWMQDVSKKSPMELI 49
           VAN  SEH  ++++DV K+ P   I
Sbjct: 140 VANGYSEHFVEFVKDVRKRFPQHTI 164


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.318    0.134    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,765,852
Number of Sequences: 62578
Number of extensions: 91065
Number of successful extensions: 251
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 246
Number of HSP's gapped (non-prelim): 7
length of query: 102
length of database: 14,973,337
effective HSP length: 67
effective length of query: 35
effective length of database: 10,780,611
effective search space: 377321385
effective search space used: 377321385
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)