Query         034182
Match_columns 102
No_of_seqs    140 out of 429
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 10:41:14 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034182.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034182hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3456 NADH:ubiquinone oxidor 100.0 3.1E-37 6.8E-42  219.3   6.1   99    2-102     1-120 (120)
  2 PF10276 zf-CHCC:  Zinc-finger   99.8 3.7E-20   8E-25  110.8   3.7   39   58-97      1-40  (40)
  3 COG4391 Uncharacterized protei  99.7 5.1E-18 1.1E-22  110.0   4.7   47   52-99     15-61  (62)
  4 PLN02294 cytochrome c oxidase   98.3 7.1E-07 1.5E-11   67.9   4.9   41   58-99    114-154 (174)
  5 cd00924 Cyt_c_Oxidase_Vb Cytoc  98.2 3.1E-06 6.8E-11   58.8   4.5   41   58-101    54-94  (97)
  6 PF01215 COX5B:  Cytochrome c o  98.1 2.8E-06   6E-11   62.3   3.8   40   58-99     86-125 (136)
  7 PTZ00043 cytochrome c oxidase   97.9 1.4E-05   3E-10   63.9   4.3   43   58-101   154-196 (268)
  8 KOG3352 Cytochrome c oxidase,   97.6 5.2E-05 1.1E-09   56.8   3.6   40   58-100   108-147 (153)
  9 PF09538 FYDLN_acid:  Protein o  96.6 0.00083 1.8E-08   47.4   1.1   21   78-99     19-39  (108)
 10 TIGR02300 FYDLN_acid conserved  94.7   0.013 2.9E-07   42.9   1.0   20   78-98     19-38  (129)
 11 PRK00398 rpoP DNA-directed RNA  93.4   0.063 1.4E-06   31.8   2.0   21   80-100    14-35  (46)
 12 COG4530 Uncharacterized protei  90.1    0.12 2.6E-06   37.7   0.7   21   77-98     18-38  (129)
 13 PF13465 zf-H2C2_2:  Zinc-finge  89.8    0.22 4.8E-06   26.3   1.4   15   84-98     12-26  (26)
 14 PF00096 zf-C2H2:  Zinc finger,  89.1    0.16 3.5E-06   25.3   0.6   12   88-99      2-13  (23)
 15 PF13913 zf-C2HC_2:  zinc-finge  87.8    0.21 4.6E-06   26.5   0.5   12   87-98      3-14  (25)
 16 smart00659 RPOLCX RNA polymera  87.3    0.44 9.6E-06   28.6   1.7   19   80-98     13-31  (44)
 17 COG1996 RPC10 DNA-directed RNA  85.8    0.52 1.1E-05   29.4   1.5   16   83-98     21-36  (49)
 18 PF13878 zf-C2H2_3:  zinc-finge  84.8    0.71 1.5E-05   27.1   1.7   21   78-98      3-25  (41)
 19 PF13894 zf-C2H2_4:  C2H2-type   84.7    0.48   1E-05   22.9   0.8   11   88-98      2-12  (24)
 20 PF02892 zf-BED:  BED zinc fing  84.0    0.72 1.6E-05   26.4   1.5   17   83-99     13-29  (45)
 21 PF08792 A2L_zn_ribbon:  A2L zi  80.7     1.7 3.6E-05   24.7   2.2   24   72-97      9-32  (33)
 22 TIGR02098 MJ0042_CXXC MJ0042 f  79.7     1.2 2.7E-05   24.9   1.4   12   86-97     25-36  (38)
 23 PF03604 DNA_RNApol_7kD:  DNA d  79.5     1.3 2.8E-05   25.1   1.4   18   81-98     12-29  (32)
 24 PF05605 zf-Di19:  Drought indu  78.4    0.86 1.9E-05   27.5   0.5   11   87-97      3-13  (54)
 25 smart00614 ZnF_BED BED zinc fi  75.5     2.2 4.8E-05   25.4   1.7   15   85-99     17-31  (50)
 26 PHA02768 hypothetical protein;  74.6    0.83 1.8E-05   29.0  -0.3   13   88-100     7-19  (55)
 27 PF13240 zinc_ribbon_2:  zinc-r  73.9     1.3 2.9E-05   23.1   0.4   13   84-96     11-23  (23)
 28 cd00498 Hsp33 Heat shock prote  71.9     1.8 3.8E-05   34.2   0.9   13   86-98    262-274 (275)
 29 PF02748 PyrI_C:  Aspartate car  70.7     2.9 6.3E-05   25.9   1.5   23   77-99     25-48  (52)
 30 COG1579 Zn-ribbon protein, pos  69.7     1.8   4E-05   34.4   0.5   16   84-99    219-234 (239)
 31 PF08271 TF_Zn_Ribbon:  TFIIB z  69.6       6 0.00013   22.9   2.6   22   74-96      8-29  (43)
 32 TIGR03365 Bsubt_queE 7-cyano-7  69.6       4 8.7E-05   31.3   2.4   33   63-97     12-44  (238)
 33 PF01430 HSP33:  Hsp33 protein;  69.5     1.9 4.2E-05   33.9   0.6   14   86-99    266-279 (280)
 34 PF14369 zf-RING_3:  zinc-finge  69.4     3.5 7.5E-05   23.5   1.5   14   85-98     20-33  (35)
 35 smart00154 ZnF_AN1 AN1-like Zi  68.4     3.3 7.2E-05   24.0   1.3   17   86-102    12-28  (39)
 36 PRK00114 hslO Hsp33-like chape  68.3     2.3   5E-05   34.0   0.8   14   86-99    268-281 (293)
 37 COG1281 Disulfide bond chapero  66.4     2.9 6.2E-05   34.2   1.0   15   86-100   266-280 (286)
 38 PF06957 COPI_C:  Coatomer (COP  66.1     3.1 6.7E-05   35.6   1.2   16   84-99    378-393 (422)
 39 PF13408 Zn_ribbon_recom:  Reco  65.6     3.3 7.2E-05   24.3   1.0   14   85-98      4-17  (58)
 40 TIGR02605 CxxC_CxxC_SSSS putat  65.3       5 0.00011   23.6   1.7   18   77-94     17-34  (52)
 41 PF13719 zinc_ribbon_5:  zinc-r  64.3     3.6 7.8E-05   23.4   0.9   13   87-99      3-15  (37)
 42 PF13248 zf-ribbon_3:  zinc-rib  64.2     2.7 5.8E-05   22.2   0.3   12   84-95     14-25  (26)
 43 PF08685 GON:  GON domain;  Int  63.7     9.9 0.00021   29.7   3.5   33   61-96     30-76  (201)
 44 PF14353 CpXC:  CpXC protein     63.5       4 8.6E-05   28.2   1.2   14   86-99     38-51  (128)
 45 PF15616 TerY-C:  TerY-C metal   62.3     5.7 0.00012   29.1   1.9   18   78-95     97-114 (131)
 46 PF12660 zf-TFIIIC:  Putative z  62.0     2.8 6.1E-05   28.7   0.2   39   59-98     29-67  (99)
 47 PF02591 DUF164:  Putative zinc  62.0     4.6 9.9E-05   24.5   1.1   39   53-95     16-55  (56)
 48 PF09237 GAGA:  GAGA factor;  I  61.2     5.1 0.00011   25.5   1.2   20   80-99     18-37  (54)
 49 PF14446 Prok-RING_1:  Prokaryo  61.1     5.6 0.00012   25.2   1.4   16   83-98     18-33  (54)
 50 smart00647 IBR In Between Ring  60.7     8.5 0.00019   22.7   2.2   36   58-98     15-52  (64)
 51 KOG2462 C2H2-type Zn-finger pr  59.3     4.4 9.6E-05   33.2   0.9   18   81-98    156-173 (279)
 52 KOG3623 Homeobox transcription  59.1     2.7 5.9E-05   39.1  -0.3   23   79-101   271-296 (1007)
 53 PF01485 IBR:  IBR domain;  Int  59.1     4.8  0.0001   23.8   0.8   34   58-97     15-51  (64)
 54 KOG1088 Uncharacterized conser  58.9     4.9 0.00011   29.4   1.0   15   84-98     96-110 (124)
 55 PF09723 Zn-ribbon_8:  Zinc rib  58.8     8.6 0.00019   22.3   1.9   18   77-94     17-34  (42)
 56 PF06676 DUF1178:  Protein of u  58.2     2.3   5E-05   31.6  -0.8   37   61-97      5-43  (148)
 57 smart00355 ZnF_C2H2 zinc finge  57.8     4.1   9E-05   19.4   0.3   12   88-99      2-13  (26)
 58 PF01428 zf-AN1:  AN1-like Zinc  56.3       6 0.00013   23.0   0.9   15   86-100    13-27  (43)
 59 PF05129 Elf1:  Transcription e  55.2     9.2  0.0002   25.5   1.8   37   59-99     20-59  (81)
 60 COG1645 Uncharacterized Zn-fin  55.0     6.4 0.00014   28.9   1.1   16   83-98     41-56  (131)
 61 PF14447 Prok-RING_4:  Prokaryo  53.2     7.4 0.00016   24.8   1.0   28   72-99     25-52  (55)
 62 smart00834 CxxC_CXXC_SSSS Puta  52.9      12 0.00026   20.7   1.8   13   84-96     24-36  (41)
 63 PF12171 zf-C2H2_jaz:  Zinc-fin  52.8     7.3 0.00016   20.2   0.8   12   88-99      3-14  (27)
 64 TIGR00240 ATCase_reg aspartate  51.2      13 0.00028   27.9   2.2   41   59-99    101-145 (150)
 65 PRK00893 aspartate carbamoyltr  51.0      13 0.00027   28.0   2.1   41   59-99    103-147 (152)
 66 PF04475 DUF555:  Protein of un  50.9     9.4  0.0002   27.1   1.3   20   77-97     39-58  (102)
 67 COG0602 NrdG Organic radical a  50.5      13 0.00029   28.3   2.2   31   65-97     14-44  (212)
 68 PF13717 zinc_ribbon_4:  zinc-r  49.8     8.9 0.00019   21.8   0.9   13   87-99      3-15  (36)
 69 PF06226 DUF1007:  Protein of u  48.7     9.7 0.00021   28.9   1.2   13   70-82     15-27  (212)
 70 smart00507 HNHc HNH nucleases.  48.5     6.3 0.00014   21.7   0.1   11   87-97     11-21  (52)
 71 PF03966 Trm112p:  Trm112p-like  48.5     9.8 0.00021   23.9   1.0   15   84-98     51-65  (68)
 72 PHA00616 hypothetical protein   48.3     4.9 0.00011   24.4  -0.4   12   88-99      3-14  (44)
 73 PRK00432 30S ribosomal protein  48.1      12 0.00026   22.8   1.4   13   85-97     36-48  (50)
 74 PRK03922 hypothetical protein;  48.0      11 0.00025   27.1   1.4   21   76-97     40-60  (113)
 75 PF14690 zf-ISL3:  zinc-finger   47.4     8.3 0.00018   22.0   0.5   11   86-96      2-12  (47)
 76 PRK01402 hslO Hsp33-like chape  46.7     9.1  0.0002   31.5   0.9   14   86-99    308-321 (328)
 77 PF12756 zf-C2H2_2:  C2H2 type   46.2      12 0.00026   23.4   1.2   14   85-98     49-62  (100)
 78 PF10571 UPF0547:  Uncharacteri  44.7      10 0.00022   20.4   0.6   13   85-97     13-25  (26)
 79 PF01783 Ribosomal_L32p:  Ribos  44.6      17 0.00037   22.4   1.7    7   87-93     40-46  (56)
 80 PF04423 Rad50_zn_hook:  Rad50   44.1     7.8 0.00017   23.3   0.1   14   86-99     20-33  (54)
 81 COG5189 SFP1 Putative transcri  43.3      11 0.00024   32.1   0.9   17   82-98    394-410 (423)
 82 TIGR01031 rpmF_bact ribosomal   43.2      16 0.00034   22.7   1.4    7   87-93     40-46  (55)
 83 TIGR02159 PA_CoA_Oxy4 phenylac  43.2      11 0.00023   27.7   0.7   13   86-98    105-117 (146)
 84 PF10013 DUF2256:  Uncharacteri  42.1      11 0.00024   22.9   0.5   12   86-97      8-19  (42)
 85 PRK03824 hypA hydrogenase nick  41.9      12 0.00025   26.9   0.7   21   75-95     96-116 (135)
 86 COG1655 Uncharacterized protei  41.9     9.9 0.00022   30.9   0.4   17   84-100    17-33  (267)
 87 smart00531 TFIIE Transcription  41.8      18 0.00039   25.9   1.6   45   54-100    92-137 (147)
 88 PF13912 zf-C2H2_6:  C2H2-type   41.4      13 0.00028   18.8   0.7   12   87-98      2-13  (27)
 89 COG2093 DNA-directed RNA polym  41.1      15 0.00033   24.1   1.1   12   84-95     16-27  (64)
 90 COG1781 PyrI Aspartate carbamo  41.0      20 0.00043   27.1   1.8   57   43-99     80-148 (153)
 91 cd00729 rubredoxin_SM Rubredox  41.0      17 0.00037   20.4   1.1   11   84-94     16-26  (34)
 92 PF00653 BIR:  Inhibitor of Apo  40.1      25 0.00054   21.9   1.9   17   81-97     31-47  (70)
 93 cd00022 BIR Baculoviral inhibi  39.1      23  0.0005   21.6   1.6   15   84-98     32-46  (69)
 94 COG1885 Uncharacterized protei  38.9      18  0.0004   26.1   1.3   23   74-97     38-60  (115)
 95 PTZ00218 40S ribosomal protein  38.8      20 0.00044   22.7   1.4   23   70-96      4-26  (54)
 96 COG4049 Uncharacterized protei  38.6      13 0.00028   24.3   0.4   15   84-98     15-29  (65)
 97 PF12760 Zn_Tnp_IS1595:  Transp  37.0      17 0.00036   21.3   0.7   10   86-95     18-27  (46)
 98 PRK14892 putative transcriptio  37.0      31 0.00068   24.0   2.2   35   59-98     19-54  (99)
 99 cd00085 HNHc HNH nucleases; HN  36.0      16 0.00034   20.4   0.5   10   87-96     12-21  (57)
100 TIGR00510 lipA lipoate synthas  35.4      30 0.00065   28.0   2.2   62   35-97     19-85  (302)
101 PRK11827 hypothetical protein;  34.4      35 0.00077   21.8   2.0   31   61-99      8-39  (60)
102 PF02489 Herpes_glycop_H:  Herp  34.2      18 0.00039   31.7   0.8   34   61-97    537-572 (657)
103 COG1656 Uncharacterized conser  33.7      17 0.00037   27.7   0.5   23   75-99    121-143 (165)
104 cd00350 rubredoxin_like Rubred  33.6      28  0.0006   19.1   1.3   12   84-95     15-26  (33)
105 smart00238 BIR Baculoviral inh  33.5      34 0.00074   21.0   1.8   14   85-98     35-48  (71)
106 PHA03296 envelope glycoprotein  33.4      23 0.00049   32.8   1.3   23   74-97    682-704 (814)
107 PF11793 FANCL_C:  FANCL C-term  32.9      23  0.0005   22.6   1.0   13   86-98     55-67  (70)
108 PF13824 zf-Mss51:  Zinc-finger  32.9      13 0.00027   23.7  -0.3   15   84-98     12-26  (55)
109 PRK12495 hypothetical protein;  32.4     7.6 0.00016   31.0  -1.6   55   35-98     16-70  (226)
110 PRK13376 pyrB bifunctional asp  31.9      98  0.0021   27.3   4.9   37   62-99    479-520 (525)
111 TIGR01206 lysW lysine biosynth  31.4      38 0.00083   21.1   1.7   12   86-97     22-33  (54)
112 PHA00732 hypothetical protein   30.9      21 0.00046   23.6   0.5   13   88-100    29-41  (79)
113 PF14803 Nudix_N_2:  Nudix N-te  30.7      48   0.001   18.8   1.9   27   71-97      5-33  (34)
114 COG1592 Rubrerythrin [Energy p  30.1      25 0.00054   26.6   0.9   17   78-95    142-158 (166)
115 smart00746 TRASH metallochaper  29.7      24 0.00052   17.1   0.5    9   89-97      1-9   (39)
116 PF05191 ADK_lid:  Adenylate ki  29.7      25 0.00055   20.1   0.7   12   87-98      2-13  (36)
117 KOG1280 Uncharacterized conser  29.4      24 0.00052   30.1   0.7   18   78-95     71-88  (381)
118 PHA00733 hypothetical protein   29.0      32 0.00069   24.4   1.2   16   82-97     69-84  (128)
119 PF09180 ProRS-C_1:  Prolyl-tRN  28.0      31 0.00067   21.9   0.9   12   84-95     46-57  (68)
120 COG4888 Uncharacterized Zn rib  27.0      39 0.00084   24.1   1.3   37   58-99     19-59  (104)
121 PF13821 DUF4187:  Domain of un  26.4      24 0.00051   22.0   0.2   15   85-99     26-40  (55)
122 KOG0292 Vesicle coat complex C  26.3      32 0.00069   33.0   1.0   21   78-98   1155-1176(1202)
123 PF10058 DUF2296:  Predicted in  25.9      31 0.00068   21.3   0.7    9   86-94     44-52  (54)
124 PF14569 zf-UDP:  Zinc-binding   25.9      23  0.0005   24.2   0.1   16   83-98     48-63  (80)
125 TIGR03829 YokU_near_AblA uncha  25.5      60  0.0013   22.4   2.0   36   63-99      4-48  (89)
126 PF13451 zf-trcl:  Probable zin  25.1      37  0.0008   21.0   0.8   15   84-98      2-16  (49)
127 smart00451 ZnF_U1 U1-like zinc  24.8      41  0.0009   17.7   0.9   13   86-98      3-15  (35)
128 PRK00420 hypothetical protein;  24.7      68  0.0015   22.8   2.2   16   83-98     37-52  (112)
129 PF08274 PhnA_Zn_Ribbon:  PhnA   23.9      30 0.00065   19.3   0.2   14   87-100     3-16  (30)
130 PRK03681 hypA hydrogenase nick  23.5 1.1E+02  0.0023   21.3   3.0   30   58-95     67-96  (114)
131 PF07503 zf-HYPF:  HypF finger;  23.2      46 0.00099   19.0   0.9   15   85-99     20-34  (35)
132 KOG3993 Transcription factor (  22.9      25 0.00054   30.9  -0.3   15   84-98    354-368 (500)
133 cd00150 PlantTI Plant trypsin   22.9      48   0.001   18.4   0.9   10   75-84      2-11  (27)
134 TIGR03831 YgiT_finger YgiT-typ  22.7      63  0.0014   17.8   1.5   13   87-99     33-45  (46)
135 PRK00564 hypA hydrogenase nick  22.7      40 0.00087   23.5   0.8   12   85-96     87-98  (117)
136 PF07282 OrfB_Zn_ribbon:  Putat  22.3      72  0.0016   19.5   1.8   25   71-97     33-57  (69)
137 PF03119 DNA_ligase_ZBD:  NAD-d  22.1      41 0.00088   18.2   0.6   12   88-99      1-12  (28)
138 COG5034 TNG2 Chromatin remodel  21.8      53  0.0011   26.9   1.4   31   59-94    232-269 (271)
139 COG2835 Uncharacterized conser  21.8      96  0.0021   20.0   2.3   31   61-99      8-39  (60)
140 PF10080 DUF2318:  Predicted me  21.4      48   0.001   23.1   1.0   20   78-99     46-65  (102)
141 TIGR02646 conserved hypothetic  21.2      45 0.00098   23.7   0.8   14   84-97     22-35  (144)
142 PF14921 APCDDC:  Adenomatosis   21.1      43 0.00094   26.8   0.7   17   86-102   218-234 (240)
143 smart00286 PTI Plant trypsin i  20.4      46   0.001   18.8   0.5   20   74-93      3-29  (29)
144 cd04487 RecJ_OBF2_like RecJ_OB  20.4 1.1E+02  0.0024   19.5   2.4   30   56-91      2-32  (73)
145 PF01927 Mut7-C:  Mut7-C RNAse   20.4      56  0.0012   23.3   1.1   38   59-98     92-136 (147)
146 cd03528 Rieske_RO_ferredoxin R  20.4      62  0.0013   20.6   1.2   16   84-99     55-70  (98)

No 1  
>KOG3456 consensus NADH:ubiquinone oxidoreductase, NDUFS6/13 kDa subunit [Energy production and conversion]
Probab=100.00  E-value=3.1e-37  Score=219.32  Aligned_cols=99  Identities=56%  Similarity=0.974  Sum_probs=87.2

Q ss_pred             hhhHHHHHHHhcCCCCC-----cceeeeeecccc--cccceeee--------------ccCCCChhhhhccCCCEEecCe
Q 034182            2 ASSLLKILIKSSNLPST-----TRNLTAVANQIS--EHTAKWMQ--------------DVSKKSPMELINEVPPIKVEGR   60 (102)
Q Consensus         2 ~~~~l~~~~r~~~~~~~-----~r~~~~~~~~~~--~ht~~~~~--------------~~~~~~a~elI~e~p~i~V~~~   60 (102)
                      ||++|+++++...+|+.     +|+|++++ +..  +||+|.+|              +-|+++||+||.|+||++|++|
T Consensus         1 as~~l~~~lsr~~l~~rs~pl~~r~~~~r~-~~ekvThtGq~~D~~Dyr~~rf~~~kk~vn~n~~m~LI~e~Pp~e~d~R   79 (120)
T KOG3456|consen    1 ASNLLKALLSRQGLPSRSTPLTRRNFSVRT-QFEKVTHTGQVTDQSDYRGNRFVKWKKDVNENSAMELISEVPPIEVDGR   79 (120)
T ss_pred             CchHHHHHHhcCCCcccccccccccceeec-ccceeeecCcccchHHHhHHHHHhhhhhcCccchhhhhhcCChhhccce
Confidence            78999999888877665     99999987 322  46665554              4489999999999999999999


Q ss_pred             EEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccccCC
Q 034182           61 IVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHHH  102 (102)
Q Consensus        61 ~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~hh  102 (102)
                      +|+|||+++ |||||+||||||+++...|+|||+||+++|||
T Consensus        80 VV~CdGg~~-aLGHPkvyInLDk~~~~~CgYCGlrf~~dHhh  120 (120)
T KOG3456|consen   80 VVACDGGTP-ALGHPKVYINLDKPGPHICGYCGLRFVQDHHH  120 (120)
T ss_pred             EEEecCCCC-CCCCCeEEEEcCCCCCcccccchhhhhhhhcC
Confidence            999999985 89999999999999999999999999999998


No 2  
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=99.80  E-value=3.7e-20  Score=110.82  Aligned_cols=39  Identities=51%  Similarity=1.140  Sum_probs=34.2

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCC-CceecCCCCcccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRYV   97 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~-~~~~CpYCG~ry~   97 (102)
                      ++++|+|||+++ ++|||||||+|+++ +++.|||||++|+
T Consensus         1 ~~~~v~CdG~~~-~lgHPrVyl~l~~~~~~~~CpYCg~~yv   40 (40)
T PF10276_consen    1 DGRRVSCDGGGG-ALGHPRVYLNLDDEPGPVVCPYCGTRYV   40 (40)
T ss_dssp             -SSEEEEEESST-TSCCCCEEEE-TTTTCEEEETTTTEEEE
T ss_pred             CCcEEEeCCCCC-CCCCCeEEEecCCCCCeEECCCCCCEEC
Confidence            478999999988 59999999999996 6799999999996


No 3  
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=99.72  E-value=5.1e-18  Score=109.98  Aligned_cols=47  Identities=26%  Similarity=0.573  Sum_probs=42.9

Q ss_pred             CCCEEecCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccc
Q 034182           52 VPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        52 ~p~i~V~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      ...|.+++++++|+|.++| ++||||||+|.++++++|||||++|++.
T Consensus        15 ~~~I~~~~~~l~C~g~~~p-~~HPrV~L~mg~~gev~CPYC~t~y~l~   61 (62)
T COG4391          15 HETIEIGDLPLMCPGPEPP-NDHPRVFLDMGDEGEVVCPYCSTRYRLN   61 (62)
T ss_pred             ceEEEeCCeeEEcCCCCCC-CCCCEEEEEcCCCCcEecCccccEEEec
Confidence            3467789999999999985 9999999999999999999999999874


No 4  
>PLN02294 cytochrome c oxidase subunit Vb
Probab=98.34  E-value=7.1e-07  Score=67.91  Aligned_cols=41  Identities=22%  Similarity=0.481  Sum_probs=37.3

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      +.|+|.|.|+.+ ...|-.+|+.|.+..+.+||.||..|+++
T Consensus       114 d~RiVGCtg~~~-eDsh~v~Wf~L~kGkp~RCpeCG~~fkL~  154 (174)
T PLN02294        114 DKRIVGCPGGEG-EDEHDVVWFWLEKGKSFECPVCTQYFELE  154 (174)
T ss_pred             CceEEeeCCCCC-CCCceeEEEEecCCCceeCCCCCCEEEEE
Confidence            699999999654 57999999999999999999999999986


No 5  
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=98.16  E-value=3.1e-06  Score=58.80  Aligned_cols=41  Identities=24%  Similarity=0.543  Sum_probs=37.5

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccccC
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHH  101 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~h  101 (102)
                      +.|+|.|.|..+   .|-.+|+.|.+..+.+|+.||.-|+++++
T Consensus        54 ~~RiVGC~g~~~---~h~v~W~~l~~g~~~rC~eCG~~fkL~~v   94 (97)
T cd00924          54 DKRIVGCICEPD---SHDVIWMWLEKGKPKRCPECGHVFKLVDV   94 (97)
T ss_pred             CCeEEeeeCCCC---CceEEEEEEeCCCceeCCCCCcEEEEEEC
Confidence            699999999843   89999999999999999999999999865


No 6  
>PF01215 COX5B:  Cytochrome c oxidase subunit Vb This family consists of chains F and S ;  InterPro: IPR002124 Cytochrome c oxidase (1.9.3.1 from EC) is an oligomeric enzymatic complex which is a component of the respiratory chain complex and is involved in the transfer of electrons from cytochrome c to oxygen []. In eukaryotes this enzyme complex is located in the mitochondrial inner membrane; in aerobic prokaryotes it is found in the plasma membrane.  In eukaryotes, in addition to the three large subunits, I, II and III, that form the catalytic centre of the enzyme complex, there are a variable number of small polypeptidic subunits. One of these subunits, which is known as Vb in mammals, V in Dictyostelium discoideum (Slime mold) and IV in yeast, binds a zinc atom. The sequence of subunit Vb is well conserved and includes three conserved cysteines that coordinate the zinc ion [, ]. Two of these cysteines are clustered in the C-terminal section of the subunit.; GO: 0004129 cytochrome-c oxidase activity, 0005740 mitochondrial envelope; PDB: 2EIL_S 2ZXW_S 3ASN_S 1OCO_S 3AG4_S 3ABK_S 1OCZ_S 1OCC_F 3ASO_S 3ABL_S ....
Probab=98.12  E-value=2.8e-06  Score=62.34  Aligned_cols=40  Identities=28%  Similarity=0.633  Sum_probs=35.0

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      +.|+|.|.|..+  ..|-.+|+.|.+..+.+||.||.-|+++
T Consensus        86 ~~RiVGC~g~~~--~sH~v~W~~l~~g~~~RCpeCG~~fkL~  125 (136)
T PF01215_consen   86 DERIVGCTGEPD--DSHDVIWFWLHKGKPQRCPECGQVFKLK  125 (136)
T ss_dssp             SCEEEEESSSTT---SSS-EEEEEETTSEEEETTTEEEEEEE
T ss_pred             CceEEeeccCCC--CcceeEEEEEeCCCccCCCCCCeEEEEE
Confidence            799999999854  6999999999998899999999999985


No 7  
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=97.90  E-value=1.4e-05  Score=63.86  Aligned_cols=43  Identities=16%  Similarity=0.226  Sum_probs=38.1

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccccccC
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDHH  101 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~h  101 (102)
                      +.|+|.|.|+.+ ...|-.+|+.+.+..+.+||.||..|+++++
T Consensus       154 deRyVGCTGg~~-EDeH~VvWFwLrEGkpqRCpECGqVFKLVr~  196 (268)
T PTZ00043        154 TERVVGCTGGTG-EHEHVPLWFRCREGFLYRCGECDQIFMLVRV  196 (268)
T ss_pred             CceEEeccCCCc-cCCceeEEEEecCCCCccCCCCCcEEEEEEE
Confidence            689999999755 4689999999998889999999999998763


No 8  
>KOG3352 consensus Cytochrome c oxidase, subunit Vb/COX4 [Energy production and conversion]
Probab=97.64  E-value=5.2e-05  Score=56.81  Aligned_cols=40  Identities=28%  Similarity=0.528  Sum_probs=35.1

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCccccccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQDH  100 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~~~  100 (102)
                      +-|+|.| |.+  ...|+.+|+-|.|.+..+||.||.-|+++.
T Consensus       108 d~RiVGC-~c~--eD~~~V~Wmwl~Kge~~rc~eCG~~fkL~~  147 (153)
T KOG3352|consen  108 DKRIVGC-GCE--EDSHAVVWMWLEKGETQRCPECGHYFKLVP  147 (153)
T ss_pred             CceEEee-ccc--CCCcceEEEEEEcCCcccCCcccceEEeee
Confidence            6899999 443  479999999999999999999999999874


No 9  
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=96.61  E-value=0.00083  Score=47.35  Aligned_cols=21  Identities=29%  Similarity=0.819  Sum_probs=18.7

Q ss_pred             EEEcCCCCceecCCCCcccccc
Q 034182           78 FICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        78 yI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      |+.|++ .+++|||||+.|...
T Consensus        19 FYDLnk-~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   19 FYDLNK-DPIVCPKCGTEFPPE   39 (108)
T ss_pred             hccCCC-CCccCCCCCCccCcc
Confidence            999998 899999999999653


No 10 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=94.73  E-value=0.013  Score=42.93  Aligned_cols=20  Identities=30%  Similarity=0.597  Sum_probs=17.8

Q ss_pred             EEEcCCCCceecCCCCccccc
Q 034182           78 FICLDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        78 yI~Ld~~~~~~CpYCG~ry~~   98 (102)
                      |+.|++ .+++|||||..|..
T Consensus        19 FYDLnk-~p~vcP~cg~~~~~   38 (129)
T TIGR02300        19 FYDLNR-RPAVSPYTGEQFPP   38 (129)
T ss_pred             ccccCC-CCccCCCcCCccCc
Confidence            999997 79999999999854


No 11 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=93.45  E-value=0.063  Score=31.75  Aligned_cols=21  Identities=33%  Similarity=0.588  Sum_probs=15.1

Q ss_pred             EcCCCC-ceecCCCCccccccc
Q 034182           80 CLDLKE-PAICKYCGLRYVQDH  100 (102)
Q Consensus        80 ~Ld~~~-~~~CpYCG~ry~~~~  100 (102)
                      .++... ...|||||.++..++
T Consensus        14 ~~~~~~~~~~Cp~CG~~~~~~~   35 (46)
T PRK00398         14 ELDEYGTGVRCPYCGYRILFKE   35 (46)
T ss_pred             EECCCCCceECCCCCCeEEEcc
Confidence            344433 789999999987654


No 12 
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=90.05  E-value=0.12  Score=37.68  Aligned_cols=21  Identities=29%  Similarity=0.627  Sum_probs=17.2

Q ss_pred             eEEEcCCCCceecCCCCccccc
Q 034182           77 EFICLDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        77 VyI~Ld~~~~~~CpYCG~ry~~   98 (102)
                      -|++|++ .+++|||||..|-+
T Consensus        18 KFYDLNr-dPiVsPytG~s~P~   38 (129)
T COG4530          18 KFYDLNR-DPIVSPYTGKSYPR   38 (129)
T ss_pred             hhhccCC-CccccCcccccchH
Confidence            4888885 58999999999953


No 13 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=89.77  E-value=0.22  Score=26.33  Aligned_cols=15  Identities=33%  Similarity=0.999  Sum_probs=12.6

Q ss_pred             CCceecCCCCccccc
Q 034182           84 KEPAICKYCGLRYVQ   98 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~   98 (102)
                      +.+-.|++||..|..
T Consensus        12 ~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen   12 EKPYKCPYCGKSFSN   26 (26)
T ss_dssp             SSSEEESSSSEEESS
T ss_pred             CCCCCCCCCcCeeCc
Confidence            567899999999963


No 14 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=89.14  E-value=0.16  Score=25.29  Aligned_cols=12  Identities=25%  Similarity=0.797  Sum_probs=10.2

Q ss_pred             ecCCCCcccccc
Q 034182           88 ICKYCGLRYVQD   99 (102)
Q Consensus        88 ~CpYCG~ry~~~   99 (102)
                      .|++||..|...
T Consensus         2 ~C~~C~~~f~~~   13 (23)
T PF00096_consen    2 KCPICGKSFSSK   13 (23)
T ss_dssp             EETTTTEEESSH
T ss_pred             CCCCCCCccCCH
Confidence            699999999753


No 15 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=87.79  E-value=0.21  Score=26.52  Aligned_cols=12  Identities=25%  Similarity=0.805  Sum_probs=10.3

Q ss_pred             eecCCCCccccc
Q 034182           87 AICKYCGLRYVQ   98 (102)
Q Consensus        87 ~~CpYCG~ry~~   98 (102)
                      ..||+||++|..
T Consensus         3 ~~C~~CgR~F~~   14 (25)
T PF13913_consen    3 VPCPICGRKFNP   14 (25)
T ss_pred             CcCCCCCCEECH
Confidence            579999999964


No 16 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=87.32  E-value=0.44  Score=28.60  Aligned_cols=19  Identities=26%  Similarity=0.592  Sum_probs=14.0

Q ss_pred             EcCCCCceecCCCCccccc
Q 034182           80 CLDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        80 ~Ld~~~~~~CpYCG~ry~~   98 (102)
                      +++....+.|||||-+-..
T Consensus        13 ~~~~~~~irC~~CG~rIly   31 (44)
T smart00659       13 EIKSKDVVRCRECGYRILY   31 (44)
T ss_pred             ecCCCCceECCCCCceEEE
Confidence            4555678999999987543


No 17 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=85.79  E-value=0.52  Score=29.37  Aligned_cols=16  Identities=31%  Similarity=0.665  Sum_probs=12.0

Q ss_pred             CCCceecCCCCccccc
Q 034182           83 LKEPAICKYCGLRYVQ   98 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~   98 (102)
                      ......|||||-+-..
T Consensus        21 ~~~~irCp~Cg~rIl~   36 (49)
T COG1996          21 ETRGIRCPYCGSRILV   36 (49)
T ss_pred             ccCceeCCCCCcEEEE
Confidence            3458899999987543


No 18 
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=84.81  E-value=0.71  Score=27.14  Aligned_cols=21  Identities=29%  Similarity=0.653  Sum_probs=16.9

Q ss_pred             EEEcCCCC--ceecCCCCccccc
Q 034182           78 FICLDLKE--PAICKYCGLRYVQ   98 (102)
Q Consensus        78 yI~Ld~~~--~~~CpYCG~ry~~   98 (102)
                      .|+++...  ..+|+-||..|..
T Consensus         3 ~Ld~gq~~~~~~~C~~CgM~Y~~   25 (41)
T PF13878_consen    3 ILDLGQKSFGATTCPTCGMLYSP   25 (41)
T ss_pred             EEeCCCCccCCcCCCCCCCEECC
Confidence            57777654  7899999999974


No 19 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=84.75  E-value=0.48  Score=22.86  Aligned_cols=11  Identities=27%  Similarity=0.830  Sum_probs=7.8

Q ss_pred             ecCCCCccccc
Q 034182           88 ICKYCGLRYVQ   98 (102)
Q Consensus        88 ~CpYCG~ry~~   98 (102)
                      .|++||..|..
T Consensus         2 ~C~~C~~~~~~   12 (24)
T PF13894_consen    2 QCPICGKSFRS   12 (24)
T ss_dssp             E-SSTS-EESS
T ss_pred             CCcCCCCcCCc
Confidence            69999999975


No 20 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=84.02  E-value=0.72  Score=26.44  Aligned_cols=17  Identities=41%  Similarity=0.647  Sum_probs=10.6

Q ss_pred             CCCceecCCCCcccccc
Q 034182           83 LKEPAICKYCGLRYVQD   99 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~~   99 (102)
                      .+..+.|.||+..|...
T Consensus        13 ~~~~a~C~~C~~~~~~~   29 (45)
T PF02892_consen   13 DKKKAKCKYCGKVIKYS   29 (45)
T ss_dssp             CSS-EEETTTTEE----
T ss_pred             CcCeEEeCCCCeEEeeC
Confidence            46789999999998753


No 21 
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=80.72  E-value=1.7  Score=24.70  Aligned_cols=24  Identities=17%  Similarity=0.382  Sum_probs=18.4

Q ss_pred             CCCCceEEEcCCCCceecCCCCcccc
Q 034182           72 LGHPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        72 lGHPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      -+|+.||.  .+++.-.|+-||..|.
T Consensus         9 C~~~~i~~--~~~~~~~C~~Cg~~~~   32 (33)
T PF08792_consen    9 CGGNGIVN--KEDDYEVCIFCGSSFP   32 (33)
T ss_pred             CCCCeEEE--ecCCeEEcccCCcEee
Confidence            36777776  4456899999999885


No 22 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=79.73  E-value=1.2  Score=24.86  Aligned_cols=12  Identities=25%  Similarity=0.628  Sum_probs=10.6

Q ss_pred             ceecCCCCcccc
Q 034182           86 PAICKYCGLRYV   97 (102)
Q Consensus        86 ~~~CpYCG~ry~   97 (102)
                      .+.||+||..|.
T Consensus        25 ~v~C~~C~~~~~   36 (38)
T TIGR02098        25 KVRCGKCGHVWY   36 (38)
T ss_pred             EEECCCCCCEEE
Confidence            689999999885


No 23 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=79.46  E-value=1.3  Score=25.13  Aligned_cols=18  Identities=33%  Similarity=0.680  Sum_probs=12.7

Q ss_pred             cCCCCceecCCCCccccc
Q 034182           81 LDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        81 Ld~~~~~~CpYCG~ry~~   98 (102)
                      |....++.|+|||-|-..
T Consensus        12 ~~~~~~irC~~CG~RIly   29 (32)
T PF03604_consen   12 LKPGDPIRCPECGHRILY   29 (32)
T ss_dssp             BSTSSTSSBSSSS-SEEB
T ss_pred             cCCCCcEECCcCCCeEEE
Confidence            555568899999987544


No 24 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=78.39  E-value=0.86  Score=27.55  Aligned_cols=11  Identities=36%  Similarity=1.056  Sum_probs=8.6

Q ss_pred             eecCCCCcccc
Q 034182           87 AICKYCGLRYV   97 (102)
Q Consensus        87 ~~CpYCG~ry~   97 (102)
                      -.|||||.-|-
T Consensus         3 f~CP~C~~~~~   13 (54)
T PF05605_consen    3 FTCPYCGKGFS   13 (54)
T ss_pred             cCCCCCCCccC
Confidence            47999999654


No 25 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=75.52  E-value=2.2  Score=25.39  Aligned_cols=15  Identities=40%  Similarity=0.961  Sum_probs=12.3

Q ss_pred             CceecCCCCcccccc
Q 034182           85 EPAICKYCGLRYVQD   99 (102)
Q Consensus        85 ~~~~CpYCG~ry~~~   99 (102)
                      ..+.|.||+..|...
T Consensus        17 ~~a~C~~C~~~l~~~   31 (50)
T smart00614       17 QRAKCKYCGKKLSRS   31 (50)
T ss_pred             eEEEecCCCCEeeeC
Confidence            369999999999654


No 26 
>PHA02768 hypothetical protein; Provisional
Probab=74.60  E-value=0.83  Score=29.00  Aligned_cols=13  Identities=31%  Similarity=0.848  Sum_probs=10.9

Q ss_pred             ecCCCCccccccc
Q 034182           88 ICKYCGLRYVQDH  100 (102)
Q Consensus        88 ~CpYCG~ry~~~~  100 (102)
                      .|++||.+|....
T Consensus         7 ~C~~CGK~Fs~~~   19 (55)
T PHA02768          7 ECPICGEIYIKRK   19 (55)
T ss_pred             CcchhCCeeccHH
Confidence            7999999998643


No 27 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=73.86  E-value=1.3  Score=23.14  Aligned_cols=13  Identities=23%  Similarity=0.756  Sum_probs=9.6

Q ss_pred             CCceecCCCCccc
Q 034182           84 KEPAICKYCGLRY   96 (102)
Q Consensus        84 ~~~~~CpYCG~ry   96 (102)
                      ++...|++||..+
T Consensus        11 ~~~~fC~~CG~~l   23 (23)
T PF13240_consen   11 DDAKFCPNCGTPL   23 (23)
T ss_pred             CcCcchhhhCCcC
Confidence            4567799999764


No 28 
>cd00498 Hsp33 Heat shock protein 33 (Hsp33):  Cytosolic protein that acts as a molecular chaperone under oxidative conditions.  In normal (reducing) cytosolic conditions, four conserved Cys residues are coordinated by a Zn ion.  Under oxidative stress (such as heat shock), the Cys are reversibly oxidized to disulfide bonds, which causes the chaperone activity to be turned on.  Hsp33 is homodimeric in its functional form.
Probab=71.87  E-value=1.8  Score=34.24  Aligned_cols=13  Identities=31%  Similarity=0.974  Sum_probs=11.8

Q ss_pred             ceecCCCCccccc
Q 034182           86 PAICKYCGLRYVQ   98 (102)
Q Consensus        86 ~~~CpYCG~ry~~   98 (102)
                      +++|.|||++|..
T Consensus       262 ev~C~FC~~~Y~f  274 (275)
T cd00498         262 EVTCEFCGEKYHF  274 (275)
T ss_pred             EEEEeCCCCEEec
Confidence            7899999999975


No 29 
>PF02748 PyrI_C:  Aspartate carbamoyltransferase regulatory chain, metal binding domain;  InterPro: IPR020542 Aspartate carbamoyltransferase (aspartate transcarbamylase, ATCase) 2.1.3.2 from EC is an allosteric enzyme that plays a central role in the regulation of the pyrimidine pathway in bacteria. The holoenzyme is a dodecamer composed of six catalytic chains, each with an active site, and six regulatory chains lacking catalytic activity []. The catalytic subunits exist as a dimer of catalytic trimers, (c3)2, while the regulatory subunits exist as a trimer of regulatory dimers, (r2)3, therefore the complete holoenzyme can be represented as (c3)2(r2)3. The association of the catalytic subunits c3 with the regulatory subunits r2 is responsible for the establishment of positive co-operativity between catalytic sites for the binding of aspartate and it dictates the pattern of allosteric response toward nucleotide effectors. ATCase from Escherichia coli is the most extensively studied allosteric enzyme []. The crystal structure of the T-state, the T-state with CTP bound, the R-state with N-phosphonacetyl-L-aspartate (PALA) bound, and the R-state with phosphonoacetamide plus malonate bound have been used in interpreting kinetic and mutational studies. A high-resolution structure of E. coli ATCase in the presence of PALA (a bisubstrate analog) allows a detailed description of the binding at the active site of the enzyme and allows a detailed model of the tetrahedral intermediate to be constructed. The entire regulatory chain has been traced showing that the N-terminal regions of the regulatory chains R1 and R6 are located in close proximity to each other and to the regulatory site. This portion of the molecule may be involved in the observed asymmetry between the regulatory binding sites as well as in the heterotropic response of the enzyme []. The C-terminal domain of the regulatory chains have a rubredoxin-like zinc-bound fold.  ATCase from Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans) differs from the other investigated enterobacterial ATCases by its absence of homotropic co-operativity toward the substrate aspartate and its lack of response to ATP which is an allosteric effector (activator) of this family of enzymes. Nevertheless, the E. herbicola ATCase has the same quaternary structure, two trimers of catalytic chains with three dimers of regulatory chains, (c3)2(r2)3, as other enterobacterial ATCases and shows extensive primary structure conservation [].  This entry represents the C-terminal domain.; PDB: 2YWW_B 1SKU_D 1Q95_L 8ATC_B 3AT1_D 1RAI_D 4E2F_D 1NBE_B 6AT1_B 2FZC_D ....
Probab=70.67  E-value=2.9  Score=25.90  Aligned_cols=23  Identities=26%  Similarity=0.527  Sum_probs=14.4

Q ss_pred             eEEEcCC-CCceecCCCCcccccc
Q 034182           77 EFICLDL-KEPAICKYCGLRYVQD   99 (102)
Q Consensus        77 VyI~Ld~-~~~~~CpYCG~ry~~~   99 (102)
                      .|.-+++ +..-+|-||++.|..+
T Consensus        25 ~F~v~~~~~~~~rC~YCe~~~~~~   48 (52)
T PF02748_consen   25 RFYVIDKEPIKLRCHYCERIITED   48 (52)
T ss_dssp             EEEEEETTTCEEEETTT--EEEHH
T ss_pred             eEEEEeCCCCEEEeeCCCCEeccc
Confidence            3433655 4588999999998654


No 30 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=69.72  E-value=1.8  Score=34.39  Aligned_cols=16  Identities=38%  Similarity=0.764  Sum_probs=12.2

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      +..+.|||||+--+.+
T Consensus       219 d~iv~CP~CgRILy~~  234 (239)
T COG1579         219 DEIVFCPYCGRILYYD  234 (239)
T ss_pred             CCCccCCccchHHHhh
Confidence            4589999999865543


No 31 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=69.62  E-value=6  Score=22.87  Aligned_cols=22  Identities=18%  Similarity=0.321  Sum_probs=13.3

Q ss_pred             CCceEEEcCCCCceecCCCCccc
Q 034182           74 HPIEFICLDLKEPAICKYCGLRY   96 (102)
Q Consensus        74 HPrVyI~Ld~~~~~~CpYCG~ry   96 (102)
                      ...+..+ ...+..+|+.||..-
T Consensus         8 ~~~~~~D-~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen    8 SKEIVFD-PERGELVCPNCGLVL   29 (43)
T ss_dssp             SSEEEEE-TTTTEEEETTT-BBE
T ss_pred             CCceEEc-CCCCeEECCCCCCEe
Confidence            3333334 345788999999764


No 32 
>TIGR03365 Bsubt_queE 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE. This uncharacterized enzyme, designated QueE, participates in the biosynthesis, from GTP, of 7-cyano-7-deazaguanosine, also called preQ0 because in many species it is a precursor of queuosine. In most Archaea, it is instead the precursor of a different tRNA modified base, archaeosine.
Probab=69.59  E-value=4  Score=31.29  Aligned_cols=33  Identities=15%  Similarity=0.386  Sum_probs=25.6

Q ss_pred             eecCCCCCCCCCCceEEEcCCCCceecCCCCcccc
Q 034182           63 ACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        63 ~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      |-.|-| +..|-|-|||.+.. =.-.|+||.+.|.
T Consensus        12 SiQGEG-~~~G~~~~FvR~~g-CNlrC~~Cdt~~~   44 (238)
T TIGR03365        12 TIQGEG-MVIGQKTMFVRTGG-CDYRCSWCDSLFT   44 (238)
T ss_pred             ccccCc-cccCCeEEEEEeCC-cCCcCcCCCCccc
Confidence            445544 57899999999983 2689999998773


No 33 
>PF01430 HSP33:  Hsp33 protein;  InterPro: IPR000397 Hsp33 is a molecular chaperone, distinguished from all other known chaperones by its mode of functional regulation. Its activity is redox regulated. Hsp33 is a cytoplasmically localized protein with highly reactive cysteines that respond quickly to changes in the redox environment. Oxidizing conditions like H2O2 cause disulphide bonds to form in Hsp33, a process that leads to the activation of its chaperone function [].; GO: 0051082 unfolded protein binding, 0006457 protein folding, 0005737 cytoplasm; PDB: 1VZY_B 1VQ0_A 1I7F_A 3M7M_X 1XJH_A 1HW7_A.
Probab=69.46  E-value=1.9  Score=33.93  Aligned_cols=14  Identities=29%  Similarity=0.921  Sum_probs=9.3

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      +++|.|||++|...
T Consensus       266 ev~C~fC~~~Y~f~  279 (280)
T PF01430_consen  266 EVTCEFCGKKYRFT  279 (280)
T ss_dssp             EEE-TTT--EEEEE
T ss_pred             EEEeeCCCCEEEeC
Confidence            78999999999864


No 34 
>PF14369 zf-RING_3:  zinc-finger
Probab=69.45  E-value=3.5  Score=23.55  Aligned_cols=14  Identities=21%  Similarity=0.543  Sum_probs=10.9

Q ss_pred             CceecCCCCccccc
Q 034182           85 EPAICKYCGLRYVQ   98 (102)
Q Consensus        85 ~~~~CpYCG~ry~~   98 (102)
                      ....||+|+..|+-
T Consensus        20 ~~~~CP~C~~gFvE   33 (35)
T PF14369_consen   20 SDVACPRCHGGFVE   33 (35)
T ss_pred             CCcCCcCCCCcEeE
Confidence            34469999999974


No 35 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=68.40  E-value=3.3  Score=24.04  Aligned_cols=17  Identities=24%  Similarity=0.596  Sum_probs=14.3

Q ss_pred             ceecCCCCcccccccCC
Q 034182           86 PAICKYCGLRYVQDHHH  102 (102)
Q Consensus        86 ~~~CpYCG~ry~~~~hh  102 (102)
                      +..|.||+..|=.+|++
T Consensus        12 ~f~C~~C~~~FC~~HR~   28 (39)
T smart00154       12 GFKCRHCGNLFCGEHRL   28 (39)
T ss_pred             CeECCccCCccccccCC
Confidence            57899999999888763


No 36 
>PRK00114 hslO Hsp33-like chaperonin; Reviewed
Probab=68.30  E-value=2.3  Score=33.96  Aligned_cols=14  Identities=36%  Similarity=1.177  Sum_probs=12.4

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      +++|.|||++|...
T Consensus       268 ev~C~FC~~~Y~f~  281 (293)
T PRK00114        268 EMVCQFCGNKYLFD  281 (293)
T ss_pred             EEEEeCCCCEEEeC
Confidence            78999999999864


No 37 
>COG1281 Disulfide bond chaperones of the HSP33 family [Posttranslational modification, protein turnover, chaperones]
Probab=66.40  E-value=2.9  Score=34.21  Aligned_cols=15  Identities=33%  Similarity=1.074  Sum_probs=13.2

Q ss_pred             ceecCCCCccccccc
Q 034182           86 PAICKYCGLRYVQDH  100 (102)
Q Consensus        86 ~~~CpYCG~ry~~~~  100 (102)
                      ++.|.|||++|.++.
T Consensus       266 ev~C~FC~~~Y~f~~  280 (286)
T COG1281         266 EVTCEFCGTKYLFDE  280 (286)
T ss_pred             EEEeeccCCEEecCH
Confidence            789999999998763


No 38 
>PF06957 COPI_C:  Coatomer (COPI) alpha subunit C-terminus;  InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits.  This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.
Probab=66.06  E-value=3.1  Score=35.56  Aligned_cols=16  Identities=31%  Similarity=0.928  Sum_probs=9.5

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      ...+.|||||.+|.-+
T Consensus       378 ~~~v~CP~cgA~y~~~  393 (422)
T PF06957_consen  378 SPSVKCPYCGAKYHPE  393 (422)
T ss_dssp             S-EEE-TTT--EEEGG
T ss_pred             CCCeeCCCCCCccChh
Confidence            3478899999999754


No 39 
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=65.59  E-value=3.3  Score=24.28  Aligned_cols=14  Identities=21%  Similarity=0.513  Sum_probs=11.8

Q ss_pred             CceecCCCCccccc
Q 034182           85 EPAICKYCGLRYVQ   98 (102)
Q Consensus        85 ~~~~CpYCG~ry~~   98 (102)
                      +...|++||..+..
T Consensus         4 g~l~C~~CG~~m~~   17 (58)
T PF13408_consen    4 GLLRCGHCGSKMTR   17 (58)
T ss_pred             CcEEcccCCcEeEE
Confidence            56899999998865


No 40 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=65.33  E-value=5  Score=23.64  Aligned_cols=18  Identities=22%  Similarity=0.300  Sum_probs=12.6

Q ss_pred             eEEEcCCCCceecCCCCc
Q 034182           77 EFICLDLKEPAICKYCGL   94 (102)
Q Consensus        77 VyI~Ld~~~~~~CpYCG~   94 (102)
                      ++..++.+....||.||.
T Consensus        17 ~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605        17 VLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EEEecCCCCCCCCCCCCC
Confidence            344455456788999997


No 41 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=64.35  E-value=3.6  Score=23.45  Aligned_cols=13  Identities=23%  Similarity=0.588  Sum_probs=9.7

Q ss_pred             eecCCCCcccccc
Q 034182           87 AICKYCGLRYVQD   99 (102)
Q Consensus        87 ~~CpYCG~ry~~~   99 (102)
                      .+||-|+++|...
T Consensus         3 i~CP~C~~~f~v~   15 (37)
T PF13719_consen    3 ITCPNCQTRFRVP   15 (37)
T ss_pred             EECCCCCceEEcC
Confidence            5788888888754


No 42 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=64.15  E-value=2.7  Score=22.24  Aligned_cols=12  Identities=25%  Similarity=0.891  Sum_probs=9.0

Q ss_pred             CCceecCCCCcc
Q 034182           84 KEPAICKYCGLR   95 (102)
Q Consensus        84 ~~~~~CpYCG~r   95 (102)
                      ++...||+||.+
T Consensus        14 ~~~~fC~~CG~~   25 (26)
T PF13248_consen   14 PDAKFCPNCGAK   25 (26)
T ss_pred             cccccChhhCCC
Confidence            456789999875


No 43 
>PF08685 GON:  GON domain;  InterPro: IPR012314 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. The ADAMTSs (a disintegrin and metalloproteinase domain with thrombospondin type-1 modules) are a family of zinc dependent metalloproteinases that play important roles in a variety of normal and pathological conditions. These enzymes show a complex domain organisation including signal sequence, propeptide, metalloproteinase domain (see PDOC50215 from PROSITEDOC), disintegrin-like domain (see PDOC00351 from PROSITEDOC), central TS-1 motif (see PDOC50092 from PROSITEDOC), cysteine-rich region, and a variable number of TS-like repeats at the C-terminal region. The GON domain is an approximately 200-residue module, whose presence is the hallmark of a subfamily of structurally and evolutionarily related ADAMTSs, called GON- ADAMTSs. The GON domain is characterised by the presence of several conserved cysteine residues and is likely to be globular [], []. Some proteins known to contain a GON domain are listed below:  Mammalian ADAMTS-9 Mammalian ADAMTS-20  Caenorhabditis elegans gon-1, a protease required for gonadal morphogenesis   Proteins containing the GON domain belong to MEROPS peptidase subfamily M12B (adamalysin, clan MA).; GO: 0004222 metalloendopeptidase activity, 0008270 zinc ion binding
Probab=63.72  E-value=9.9  Score=29.71  Aligned_cols=33  Identities=33%  Similarity=0.655  Sum_probs=24.9

Q ss_pred             EEeecCCCCCCCCCCceEEEcCC---C-----------CceecCCCCccc
Q 034182           61 IVACEGDSNPALGHPIEFICLDL---K-----------EPAICKYCGLRY   96 (102)
Q Consensus        61 ~v~CdG~~~palGHPrVyI~Ld~---~-----------~~~~CpYCG~ry   96 (102)
                      .|.|-|.   +.+.|++||+|.+   +           .+-.|||=|.+.
T Consensus        30 ~IYCh~M---~s~~PkEYltL~~G~~eNyae~y~~Rl~~~~~Cp~ng~~~   76 (201)
T PF08685_consen   30 KIYCHGM---ASSTPKEYLTLPSGPQENYAEVYGKRLQNPSECPYNGSRR   76 (201)
T ss_pred             EEEcCCC---CCCCCceeEEcCCCCccchheecchhccCCCcCCCCCCCC
Confidence            5799887   4699999999993   1           245699877664


No 44 
>PF14353 CpXC:  CpXC protein
Probab=63.53  E-value=4  Score=28.23  Aligned_cols=14  Identities=21%  Similarity=0.705  Sum_probs=11.8

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      ..+||.||..|...
T Consensus        38 ~~~CP~Cg~~~~~~   51 (128)
T PF14353_consen   38 SFTCPSCGHKFRLE   51 (128)
T ss_pred             EEECCCCCCceecC
Confidence            57899999998754


No 45 
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=62.31  E-value=5.7  Score=29.05  Aligned_cols=18  Identities=28%  Similarity=0.879  Sum_probs=15.1

Q ss_pred             EEEcCCCCceecCCCCcc
Q 034182           78 FICLDLKEPAICKYCGLR   95 (102)
Q Consensus        78 yI~Ld~~~~~~CpYCG~r   95 (102)
                      .+.++.++.++||+||..
T Consensus        97 l~Ci~g~~~~~CPwCg~~  114 (131)
T PF15616_consen   97 LFCIDGEGEVTCPWCGNE  114 (131)
T ss_pred             EEEeCCCCCEECCCCCCe
Confidence            467788889999999975


No 46 
>PF12660 zf-TFIIIC:  Putative zinc-finger of transcription factor IIIC complex;  InterPro: IPR024764 This zinc-finger domain is at the very C terminus of a number of different TFIIIC subunit proteins. This domain might be involved in protein-DNA and/or protein-protein interactions [].; PDB: 2J04_C.
Probab=62.04  E-value=2.8  Score=28.69  Aligned_cols=39  Identities=18%  Similarity=0.341  Sum_probs=20.0

Q ss_pred             CeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCccccc
Q 034182           59 GRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        59 ~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~   98 (102)
                      ...+.|..|.- |.---.-|+.|...+..+|+.||.+|..
T Consensus        29 ~~~~~C~~GH~-w~RC~lT~l~i~~~~~r~C~~C~~~~l~   67 (99)
T PF12660_consen   29 LDEAQCENGHV-WPRCALTFLPIQTPGVRVCPVCGRRALD   67 (99)
T ss_dssp             SSEEE-TTS-E-EEB-SSS-SBS-SS-EEE-TTT--EEE-
T ss_pred             cCEeECCCCCE-EeeeeeeeeeeccCCeeEcCCCCCEEec
Confidence            44566876654 5555566788888888888888888754


No 47 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=62.00  E-value=4.6  Score=24.53  Aligned_cols=39  Identities=28%  Similarity=0.411  Sum_probs=26.6

Q ss_pred             CCEEecCeEEeecCCCCCCCCCCceEEEcCCC-CceecCCCCcc
Q 034182           53 PPIKVEGRIVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLR   95 (102)
Q Consensus        53 p~i~V~~~~v~CdG~~~palGHPrVyI~Ld~~-~~~~CpYCG~r   95 (102)
                      ++..|++.  .|.|=..  ---|.+|..|.+. +...||+||+-
T Consensus        16 ~va~v~~~--~C~gC~~--~l~~~~~~~i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   16 AVARVEGG--TCSGCHM--ELPPQELNEIRKGDEIVFCPNCGRI   55 (56)
T ss_pred             EEEEeeCC--ccCCCCE--EcCHHHHHHHHcCCCeEECcCCCcc
Confidence            34455554  7877754  3456777777665 68999999963


No 48 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=61.20  E-value=5.1  Score=25.54  Aligned_cols=20  Identities=30%  Similarity=0.531  Sum_probs=10.6

Q ss_pred             EcCCCCceecCCCCcccccc
Q 034182           80 CLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        80 ~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      .+..+.+++||.||..+.+.
T Consensus        18 ~~~S~~PatCP~C~a~~~~s   37 (54)
T PF09237_consen   18 KSQSEQPATCPICGAVIRQS   37 (54)
T ss_dssp             CCTTS--EE-TTT--EESSH
T ss_pred             hhccCCCCCCCcchhhccch
Confidence            34456799999999988653


No 49 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=61.08  E-value=5.6  Score=25.20  Aligned_cols=16  Identities=25%  Similarity=0.644  Sum_probs=12.8

Q ss_pred             CCCceecCCCCccccc
Q 034182           83 LKEPAICKYCGLRYVQ   98 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~   98 (102)
                      ++..++||-||+.|-.
T Consensus        18 ~dDiVvCp~CgapyHR   33 (54)
T PF14446_consen   18 GDDIVVCPECGAPYHR   33 (54)
T ss_pred             CCCEEECCCCCCcccH
Confidence            4568999999998853


No 50 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=60.65  E-value=8.5  Score=22.72  Aligned_cols=36  Identities=14%  Similarity=0.330  Sum_probs=21.6

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcC--CCCceecCCCCccccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLD--LKEPAICKYCGLRYVQ   98 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld--~~~~~~CpYCG~ry~~   98 (102)
                      +.....|++.+=     ..+.+..+  ....+.|+.||..|=.
T Consensus        15 ~~~~~~CP~~~C-----~~~~~~~~~~~~~~v~C~~C~~~fC~   52 (64)
T smart00647       15 NPDLKWCPAPDC-----SAAIIVTEEEGCNRVTCPKCGFSFCF   52 (64)
T ss_pred             CCCccCCCCCCC-----cceEEecCCCCCCeeECCCCCCeECC
Confidence            345678986532     11222221  4558999999999854


No 51 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=59.26  E-value=4.4  Score=33.17  Aligned_cols=18  Identities=56%  Similarity=1.019  Sum_probs=12.0

Q ss_pred             cCCCCceecCCCCccccc
Q 034182           81 LDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        81 Ld~~~~~~CpYCG~ry~~   98 (102)
                      |+....-.|+|||+.|+.
T Consensus       156 ~~s~ka~~C~~C~K~YvS  173 (279)
T KOG2462|consen  156 LDSKKAFSCKYCGKVYVS  173 (279)
T ss_pred             ccccccccCCCCCceeee
Confidence            333445678888888873


No 52 
>KOG3623 consensus Homeobox transcription factor SIP1 [Transcription]
Probab=59.14  E-value=2.7  Score=39.07  Aligned_cols=23  Identities=30%  Similarity=0.569  Sum_probs=17.2

Q ss_pred             EEcCCCC---ceecCCCCcccccccC
Q 034182           79 ICLDLKE---PAICKYCGLRYVQDHH  101 (102)
Q Consensus        79 I~Ld~~~---~~~CpYCG~ry~~~~h  101 (102)
                      +.|+..+   .-.|+.||+.|+++||
T Consensus       271 ~sltqsa~lRKFKCtECgKAFKfKHH  296 (1007)
T KOG3623|consen  271 ISLTQSALLRKFKCTECGKAFKFKHH  296 (1007)
T ss_pred             ccccchhhhccccccccchhhhhHHH
Confidence            4455432   4679999999999987


No 53 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=59.07  E-value=4.8  Score=23.78  Aligned_cols=34  Identities=21%  Similarity=0.370  Sum_probs=15.8

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCC-CCc--eecCCCCcccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDL-KEP--AICKYCGLRYV   97 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~-~~~--~~CpYCG~ry~   97 (102)
                      +.....|+.++=   +  . +|..++ ...  +.|++||..|=
T Consensus        15 ~~~~~~Cp~~~C---~--~-~~~~~~~~~~~~~~C~~C~~~fC   51 (64)
T PF01485_consen   15 DPNIRWCPNPDC---E--Y-IIEKDDGCNSPIVTCPSCGTEFC   51 (64)
T ss_dssp             ---CC--TTSST---------ECS-SSTTS--CCTTSCCSEEC
T ss_pred             CCCccCCCCCCC---c--c-cEEecCCCCCCeeECCCCCCcCc
Confidence            334458988631   1  1 233332 333  89999999884


No 54 
>KOG1088 consensus Uncharacterized conserved protein [Function unknown]
Probab=58.85  E-value=4.9  Score=29.45  Aligned_cols=15  Identities=13%  Similarity=0.297  Sum_probs=13.3

Q ss_pred             CCceecCCCCccccc
Q 034182           84 KEPAICKYCGLRYVQ   98 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~   98 (102)
                      +|.-.||.||+.|.-
T Consensus        96 EG~l~CpetG~vfpI  110 (124)
T KOG1088|consen   96 EGELVCPETGRVFPI  110 (124)
T ss_pred             cceEecCCCCcEeec
Confidence            689999999999963


No 55 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=58.76  E-value=8.6  Score=22.34  Aligned_cols=18  Identities=22%  Similarity=0.580  Sum_probs=14.1

Q ss_pred             eEEEcCCCCceecCCCCc
Q 034182           77 EFICLDLKEPAICKYCGL   94 (102)
Q Consensus        77 VyI~Ld~~~~~~CpYCG~   94 (102)
                      ++..+.++....||-||.
T Consensus        17 ~~~~~~~~~~~~CP~Cg~   34 (42)
T PF09723_consen   17 VLQSISEDDPVPCPECGS   34 (42)
T ss_pred             EEEEcCCCCCCcCCCCCC
Confidence            455666667899999998


No 56 
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=58.16  E-value=2.3  Score=31.64  Aligned_cols=37  Identities=19%  Similarity=0.272  Sum_probs=26.8

Q ss_pred             EEeecCCCCC--CCCCCceEEEcCCCCceecCCCCcccc
Q 034182           61 IVACEGDSNP--ALGHPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        61 ~v~CdG~~~p--alGHPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      -+.|+.+...  |+.----|=.....|-..||+||..=+
T Consensus         5 ~L~C~~gH~FEgWF~ss~~fd~Q~~~glv~CP~Cgs~~V   43 (148)
T PF06676_consen    5 DLRCENGHEFEGWFRSSAAFDRQQARGLVSCPVCGSTEV   43 (148)
T ss_pred             EEecCCCCccceecCCHHHHHHHHHcCCccCCCCCCCeE
Confidence            3678766442  777666676666778999999998644


No 57 
>smart00355 ZnF_C2H2 zinc finger.
Probab=57.79  E-value=4.1  Score=19.37  Aligned_cols=12  Identities=25%  Similarity=0.664  Sum_probs=9.7

Q ss_pred             ecCCCCcccccc
Q 034182           88 ICKYCGLRYVQD   99 (102)
Q Consensus        88 ~CpYCG~ry~~~   99 (102)
                      .|++|+..|...
T Consensus         2 ~C~~C~~~f~~~   13 (26)
T smart00355        2 RCPECGKVFKSK   13 (26)
T ss_pred             CCCCCcchhCCH
Confidence            599999998653


No 58 
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=56.35  E-value=6  Score=23.01  Aligned_cols=15  Identities=40%  Similarity=0.921  Sum_probs=10.2

Q ss_pred             ceecCCCCccccccc
Q 034182           86 PAICKYCGLRYVQDH  100 (102)
Q Consensus        86 ~~~CpYCG~ry~~~~  100 (102)
                      +..|++|+..|=.+|
T Consensus        13 ~~~C~~C~~~FC~~H   27 (43)
T PF01428_consen   13 PFKCKHCGKSFCLKH   27 (43)
T ss_dssp             HEE-TTTS-EE-TTT
T ss_pred             CeECCCCCcccCccc
Confidence            688999999997765


No 59 
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=55.22  E-value=9.2  Score=25.46  Aligned_cols=37  Identities=16%  Similarity=0.310  Sum_probs=19.9

Q ss_pred             CeEEeecCCCCCCCCCCceEEEcCCC---CceecCCCCcccccc
Q 034182           59 GRIVACEGDSNPALGHPIEFICLDLK---EPAICKYCGLRYVQD   99 (102)
Q Consensus        59 ~~~v~CdG~~~palGHPrVyI~Ld~~---~~~~CpYCG~ry~~~   99 (102)
                      ...+.|+==+    -.--|-+.||+.   +.+.|..||..|...
T Consensus        20 ~~~F~CPfC~----~~~sV~v~idkk~~~~~~~C~~Cg~~~~~~   59 (81)
T PF05129_consen   20 PKVFDCPFCN----HEKSVSVKIDKKEGIGILSCRVCGESFQTK   59 (81)
T ss_dssp             SS----TTT------SS-EEEEEETTTTEEEEEESSS--EEEEE
T ss_pred             CceEcCCcCC----CCCeEEEEEEccCCEEEEEecCCCCeEEEc
Confidence            5677786432    123478888874   378899999999753


No 60 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=54.98  E-value=6.4  Score=28.94  Aligned_cols=16  Identities=31%  Similarity=0.625  Sum_probs=14.0

Q ss_pred             CCCceecCCCCccccc
Q 034182           83 LKEPAICKYCGLRYVQ   98 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~   98 (102)
                      ++|.+.||-||.+++.
T Consensus        41 KdG~v~CPvC~~~~~~   56 (131)
T COG1645          41 KDGEVFCPVCGYREVV   56 (131)
T ss_pred             eCCeEECCCCCceEEE
Confidence            8899999999977764


No 61 
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=53.15  E-value=7.4  Score=24.78  Aligned_cols=28  Identities=29%  Similarity=0.498  Sum_probs=20.0

Q ss_pred             CCCCceEEEcCCCCceecCCCCcccccc
Q 034182           72 LGHPIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        72 lGHPrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      -||=.=.-..+.+...-||.||++|...
T Consensus        25 CgH~I~~~~f~~~rYngCPfC~~~~~~~   52 (55)
T PF14447_consen   25 CGHLICDNCFPGERYNGCPFCGTPFEFD   52 (55)
T ss_pred             ccceeeccccChhhccCCCCCCCcccCC
Confidence            4664444455566788999999999754


No 62 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=52.87  E-value=12  Score=20.66  Aligned_cols=13  Identities=31%  Similarity=0.514  Sum_probs=10.4

Q ss_pred             CCceecCCCCccc
Q 034182           84 KEPAICKYCGLRY   96 (102)
Q Consensus        84 ~~~~~CpYCG~ry   96 (102)
                      +....||.||...
T Consensus        24 ~~~~~CP~Cg~~~   36 (41)
T smart00834       24 DPLATCPECGGDV   36 (41)
T ss_pred             CCCCCCCCCCCcc
Confidence            5578999999854


No 63 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=52.79  E-value=7.3  Score=20.18  Aligned_cols=12  Identities=17%  Similarity=0.661  Sum_probs=10.0

Q ss_pred             ecCCCCcccccc
Q 034182           88 ICKYCGLRYVQD   99 (102)
Q Consensus        88 ~CpYCG~ry~~~   99 (102)
                      .|.+|++.|..+
T Consensus         3 ~C~~C~k~f~~~   14 (27)
T PF12171_consen    3 YCDACDKYFSSE   14 (27)
T ss_dssp             BBTTTTBBBSSH
T ss_pred             CcccCCCCcCCH
Confidence            599999999753


No 64 
>TIGR00240 ATCase_reg aspartate carbamoyltransferase, regulatory subunit. The presence of this regulatory subunit allows feedback inhibition by CTP on aspartate carbamoyltransferase, the first step in the synthesis of CTP from aspartate. In many species, this regulatory subunit is not present. In Thermotoga maritima, the catalytic and regulatory subunits are encoded by a fused gene and the regulatory region has enough sequence differences to score below the trusted cutoff.
Probab=51.17  E-value=13  Score=27.92  Aligned_cols=41  Identities=15%  Similarity=0.275  Sum_probs=25.9

Q ss_pred             CeEEeecCCCC--CCCCCCceEEEcCCCC--ceecCCCCcccccc
Q 034182           59 GRIVACEGDSN--PALGHPIEFICLDLKE--PAICKYCGLRYVQD   99 (102)
Q Consensus        59 ~~~v~CdG~~~--palGHPrVyI~Ld~~~--~~~CpYCG~ry~~~   99 (102)
                      ..++.|+.+.=  ..-.=+..|.-++++.  .-+|-||++.|..+
T Consensus       101 ~gi~kC~Np~CIT~~E~v~~~F~v~~~~~~~~lrC~YCe~~~~~~  145 (150)
T TIGR00240       101 EGVLKCPNPNCISNAEPVSSKFYVRSEEPDIALRCYYCEKEIEHN  145 (150)
T ss_pred             eeeEECCCCCCccCCCCCCcEEEEecCCCceEEEEECCCCEEecc
Confidence            44688987731  0112245566566653  68999999998643


No 65 
>PRK00893 aspartate carbamoyltransferase regulatory subunit; Reviewed
Probab=51.02  E-value=13  Score=27.96  Aligned_cols=41  Identities=20%  Similarity=0.394  Sum_probs=25.6

Q ss_pred             CeEEeecCCCCC---CCCCCceEEEcCCC-CceecCCCCcccccc
Q 034182           59 GRIVACEGDSNP---ALGHPIEFICLDLK-EPAICKYCGLRYVQD   99 (102)
Q Consensus        59 ~~~v~CdG~~~p---alGHPrVyI~Ld~~-~~~~CpYCG~ry~~~   99 (102)
                      ..++.|+.+.==   --.=+..|.-++++ ..-+|-||++.|..+
T Consensus       103 ~gi~kC~Np~CITn~~E~v~~~F~v~~~~~~~~rC~YCe~~~~~~  147 (152)
T PRK00893        103 EGVLKCPNPNCITNTNEPVESRFYVVDKEPIKLRCKYCEKEFSED  147 (152)
T ss_pred             cceEECCCCCCcCCCCcCcCcEEEEEeCCCCEEEeeCCCCEechh
Confidence            346889877420   01223345556654 478999999998754


No 66 
>PF04475 DUF555:  Protein of unknown function (DUF555);  InterPro: IPR007564 This is a family of uncharacterised, hypothetical archaeal proteins.
Probab=50.92  E-value=9.4  Score=27.14  Aligned_cols=20  Identities=20%  Similarity=0.607  Sum_probs=15.5

Q ss_pred             eEEEcCCCCceecCCCCcccc
Q 034182           77 EFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        77 VyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      -|.+++ -|...||+||.-|.
T Consensus        39 ~~VeIe-vG~~~cP~Cge~~~   58 (102)
T PF04475_consen   39 DYVEIE-VGDTICPKCGEELD   58 (102)
T ss_pred             CeEEEe-cCcccCCCCCCccC
Confidence            377777 57889999998764


No 67 
>COG0602 NrdG Organic radical activating enzymes [Posttranslational modification, protein turnover, chaperones]
Probab=50.45  E-value=13  Score=28.34  Aligned_cols=31  Identities=23%  Similarity=0.536  Sum_probs=23.8

Q ss_pred             cCCCCCCCCCCceEEEcCCCCceecCCCCcccc
Q 034182           65 EGDSNPALGHPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        65 dG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      .|.| ...|=|-||+.+.. =.-.|+||.+.+.
T Consensus        14 QGEG-~~~Gr~~vFVR~~G-C~l~C~~Cdt~~t   44 (212)
T COG0602          14 QGEG-KNIGRPSVFVRFAG-CNLRCPGCDTKYT   44 (212)
T ss_pred             ecCc-ccccceeEEEEcCC-CCCCCCCCCChhh
Confidence            3444 46799999999873 2789999998765


No 68 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=49.83  E-value=8.9  Score=21.79  Aligned_cols=13  Identities=31%  Similarity=0.738  Sum_probs=9.1

Q ss_pred             eecCCCCcccccc
Q 034182           87 AICKYCGLRYVQD   99 (102)
Q Consensus        87 ~~CpYCG~ry~~~   99 (102)
                      .+||-|+++|...
T Consensus         3 i~Cp~C~~~y~i~   15 (36)
T PF13717_consen    3 ITCPNCQAKYEID   15 (36)
T ss_pred             EECCCCCCEEeCC
Confidence            5677777777654


No 69 
>PF06226 DUF1007:  Protein of unknown function (DUF1007);  InterPro: IPR010412 This is a family of conserved bacterial proteins with unknown function.
Probab=48.70  E-value=9.7  Score=28.91  Aligned_cols=13  Identities=46%  Similarity=0.726  Sum_probs=11.4

Q ss_pred             CCCCCCceEEEcC
Q 034182           70 PALGHPIEFICLD   82 (102)
Q Consensus        70 palGHPrVyI~Ld   82 (102)
                      ++..||.|||++.
T Consensus        15 ~a~AHPHvfId~~   27 (212)
T PF06226_consen   15 PAFAHPHVFIDAR   27 (212)
T ss_pred             ccccCCcEEEEEE
Confidence            4789999999876


No 70 
>smart00507 HNHc HNH nucleases.
Probab=48.55  E-value=6.3  Score=21.65  Aligned_cols=11  Identities=36%  Similarity=1.041  Sum_probs=9.3

Q ss_pred             eecCCCCcccc
Q 034182           87 AICKYCGLRYV   97 (102)
Q Consensus        87 ~~CpYCG~ry~   97 (102)
                      ..|.|||..+.
T Consensus        11 ~~C~~C~~~~~   21 (52)
T smart00507       11 GVCAYCGKPAS   21 (52)
T ss_pred             CCCcCCcCCCC
Confidence            58999999874


No 71 
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=48.48  E-value=9.8  Score=23.92  Aligned_cols=15  Identities=33%  Similarity=0.696  Sum_probs=12.8

Q ss_pred             CCceecCCCCccccc
Q 034182           84 KEPAICKYCGLRYVQ   98 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~   98 (102)
                      +|.-+||-||+.|--
T Consensus        51 eg~L~Cp~c~r~YPI   65 (68)
T PF03966_consen   51 EGELICPECGREYPI   65 (68)
T ss_dssp             TTEEEETTTTEEEEE
T ss_pred             CCEEEcCCCCCEEeC
Confidence            578899999999953


No 72 
>PHA00616 hypothetical protein
Probab=48.28  E-value=4.9  Score=24.42  Aligned_cols=12  Identities=25%  Similarity=0.614  Sum_probs=10.3

Q ss_pred             ecCCCCcccccc
Q 034182           88 ICKYCGLRYVQD   99 (102)
Q Consensus        88 ~CpYCG~ry~~~   99 (102)
                      .|+-||..|.+.
T Consensus         3 qC~~CG~~F~~~   14 (44)
T PHA00616          3 QCLRCGGIFRKK   14 (44)
T ss_pred             ccchhhHHHhhH
Confidence            699999999863


No 73 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=48.08  E-value=12  Score=22.85  Aligned_cols=13  Identities=23%  Similarity=0.503  Sum_probs=7.4

Q ss_pred             CceecCCCCcccc
Q 034182           85 EPAICKYCGLRYV   97 (102)
Q Consensus        85 ~~~~CpYCG~ry~   97 (102)
                      +.-.|+-||..|-
T Consensus        36 ~r~~C~~Cgyt~~   48 (50)
T PRK00432         36 DRWHCGKCGYTEF   48 (50)
T ss_pred             CcEECCCcCCEEe
Confidence            4556666665553


No 74 
>PRK03922 hypothetical protein; Provisional
Probab=47.95  E-value=11  Score=27.15  Aligned_cols=21  Identities=19%  Similarity=0.642  Sum_probs=16.4

Q ss_pred             ceEEEcCCCCceecCCCCcccc
Q 034182           76 IEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        76 rVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      .-|..++ -|...||+||.-|.
T Consensus        40 l~yVeie-vG~~~cP~cge~~~   60 (113)
T PRK03922         40 LDYVEVE-VGLTICPKCGEPFD   60 (113)
T ss_pred             CCeEEEe-cCcccCCCCCCcCC
Confidence            4477777 47889999998764


No 75 
>PF14690 zf-ISL3:  zinc-finger of transposase IS204/IS1001/IS1096/IS1165
Probab=47.43  E-value=8.3  Score=22.02  Aligned_cols=11  Identities=36%  Similarity=0.830  Sum_probs=8.4

Q ss_pred             ceecCCCCccc
Q 034182           86 PAICKYCGLRY   96 (102)
Q Consensus        86 ~~~CpYCG~ry   96 (102)
                      +..||+||..=
T Consensus         2 ~~~Cp~Cg~~~   12 (47)
T PF14690_consen    2 PPRCPHCGSPS   12 (47)
T ss_pred             CccCCCcCCCc
Confidence            46899999653


No 76 
>PRK01402 hslO Hsp33-like chaperonin; Reviewed
Probab=46.73  E-value=9.1  Score=31.45  Aligned_cols=14  Identities=29%  Similarity=0.793  Sum_probs=12.5

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      +++|.|||++|...
T Consensus       308 ev~CeFC~~~Y~f~  321 (328)
T PRK01402        308 SVTCEFCSRVYRFD  321 (328)
T ss_pred             EEEeeCCCCEEEeC
Confidence            78999999999864


No 77 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=46.18  E-value=12  Score=23.37  Aligned_cols=14  Identities=29%  Similarity=0.736  Sum_probs=10.6

Q ss_pred             CceecCCCCccccc
Q 034182           85 EPAICKYCGLRYVQ   98 (102)
Q Consensus        85 ~~~~CpYCG~ry~~   98 (102)
                      ..-.|+||+..|..
T Consensus        49 ~~~~C~~C~~~f~s   62 (100)
T PF12756_consen   49 ESFRCPYCNKTFRS   62 (100)
T ss_dssp             SSEEBSSSS-EESS
T ss_pred             CCCCCCccCCCCcC
Confidence            36899999999963


No 78 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=44.71  E-value=10  Score=20.40  Aligned_cols=13  Identities=23%  Similarity=0.789  Sum_probs=10.3

Q ss_pred             CceecCCCCcccc
Q 034182           85 EPAICKYCGLRYV   97 (102)
Q Consensus        85 ~~~~CpYCG~ry~   97 (102)
                      ....||.||-.|.
T Consensus        13 ~~~~Cp~CG~~F~   25 (26)
T PF10571_consen   13 SAKFCPHCGYDFE   25 (26)
T ss_pred             hcCcCCCCCCCCc
Confidence            4568999998885


No 79 
>PF01783 Ribosomal_L32p:  Ribosomal L32p protein family;  InterPro: IPR002677 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L32p is part of the 50S ribosomal subunit. This family is found in both prokaryotes and eukaryotes. Ribosomal protein L32 of yeast binds to and regulates the splicing and the translation of the transcript of its own gene [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0015934 large ribosomal subunit; PDB: 3PYT_2 3F1F_5 3PYV_2 3D5B_5 3MRZ_2 3D5D_5 3F1H_5 1VSP_Y 3PYR_2 3MS1_2 ....
Probab=44.62  E-value=17  Score=22.40  Aligned_cols=7  Identities=43%  Similarity=1.407  Sum_probs=4.4

Q ss_pred             eecCCCC
Q 034182           87 AICKYCG   93 (102)
Q Consensus        87 ~~CpYCG   93 (102)
                      ..|+.||
T Consensus        40 ~vc~~cG   46 (56)
T PF01783_consen   40 RVCPSCG   46 (56)
T ss_dssp             SBCTTTB
T ss_pred             EeeCCCC
Confidence            5666666


No 80 
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=44.10  E-value=7.8  Score=23.33  Aligned_cols=14  Identities=21%  Similarity=0.624  Sum_probs=7.2

Q ss_pred             ceecCCCCcccccc
Q 034182           86 PAICKYCGLRYVQD   99 (102)
Q Consensus        86 ~~~CpYCG~ry~~~   99 (102)
                      ...||-||+-|--+
T Consensus        20 ~~~CPlC~r~l~~e   33 (54)
T PF04423_consen   20 KGCCPLCGRPLDEE   33 (54)
T ss_dssp             SEE-TTT--EE-HH
T ss_pred             CCcCCCCCCCCCHH
Confidence            34999999988543


No 81 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=43.25  E-value=11  Score=32.13  Aligned_cols=17  Identities=29%  Similarity=0.684  Sum_probs=14.2

Q ss_pred             CCCCceecCCCCccccc
Q 034182           82 DLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        82 d~~~~~~CpYCG~ry~~   98 (102)
                      -++++-+|+.||+||+.
T Consensus       394 ~~~KPYrCevC~KRYKN  410 (423)
T COG5189         394 AKDKPYRCEVCDKRYKN  410 (423)
T ss_pred             ccCCceeccccchhhcc
Confidence            35678999999999984


No 82 
>TIGR01031 rpmF_bact ribosomal protein L32. This protein describes bacterial ribosomal protein L32. The noise cutoff is set low enough to include the equivalent protein from mitochondria and chloroplasts. No related proteins from the Archaea nor from the eukaryotic cytosol are detected by this model. This model is a fragment model; the putative L32 of some species shows similarity only toward the N-terminus.
Probab=43.17  E-value=16  Score=22.75  Aligned_cols=7  Identities=43%  Similarity=1.407  Sum_probs=4.3

Q ss_pred             eecCCCC
Q 034182           87 AICKYCG   93 (102)
Q Consensus        87 ~~CpYCG   93 (102)
                      .+|+.||
T Consensus        40 ~vc~~cG   46 (55)
T TIGR01031        40 RVCPSCG   46 (55)
T ss_pred             eECCccC
Confidence            4566666


No 83 
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=43.15  E-value=11  Score=27.69  Aligned_cols=13  Identities=23%  Similarity=0.521  Sum_probs=10.9

Q ss_pred             ceecCCCCccccc
Q 034182           86 PAICKYCGLRYVQ   98 (102)
Q Consensus        86 ~~~CpYCG~ry~~   98 (102)
                      .+.|||||.....
T Consensus       105 ~~~cp~c~s~~t~  117 (146)
T TIGR02159       105 SVQCPRCGSADTT  117 (146)
T ss_pred             CCcCCCCCCCCcE
Confidence            5899999998754


No 84 
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=42.12  E-value=11  Score=22.86  Aligned_cols=12  Identities=33%  Similarity=0.941  Sum_probs=10.2

Q ss_pred             ceecCCCCcccc
Q 034182           86 PAICKYCGLRYV   97 (102)
Q Consensus        86 ~~~CpYCG~ry~   97 (102)
                      .-.|+.||+.|.
T Consensus         8 ~K~C~~C~rpf~   19 (42)
T PF10013_consen    8 SKICPVCGRPFT   19 (42)
T ss_pred             CCcCcccCCcch
Confidence            468999999985


No 85 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=41.95  E-value=12  Score=26.88  Aligned_cols=21  Identities=33%  Similarity=0.504  Sum_probs=13.8

Q ss_pred             CceEEEcCCCCceecCCCCcc
Q 034182           75 PIEFICLDLKEPAICKYCGLR   95 (102)
Q Consensus        75 PrVyI~Ld~~~~~~CpYCG~r   95 (102)
                      |.-|++--......||+||..
T Consensus        96 ~~~~~~~~~~~~~~CP~Cgs~  116 (135)
T PRK03824         96 AIHFIPEVVHAFLKCPKCGSR  116 (135)
T ss_pred             cccccccccccCcCCcCCCCC
Confidence            445555444455779999975


No 86 
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=41.86  E-value=9.9  Score=30.93  Aligned_cols=17  Identities=18%  Similarity=0.630  Sum_probs=13.9

Q ss_pred             CCceecCCCCccccccc
Q 034182           84 KEPAICKYCGLRYVQDH  100 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~~  100 (102)
                      +....||-|++.|+.+.
T Consensus        17 kk~ieCPvC~tkFkkee   33 (267)
T COG1655          17 KKTIECPVCNTKFKKEE   33 (267)
T ss_pred             hceeccCcccchhhhhh
Confidence            35689999999998754


No 87 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=41.80  E-value=18  Score=25.93  Aligned_cols=45  Identities=18%  Similarity=0.252  Sum_probs=25.0

Q ss_pred             CEEecCeEEeecCCCCCCCCCCceEEEc-CCCCceecCCCCccccccc
Q 034182           54 PIKVEGRIVACEGDSNPALGHPIEFICL-DLKEPAICKYCGLRYVQDH  100 (102)
Q Consensus        54 ~i~V~~~~v~CdG~~~palGHPrVyI~L-d~~~~~~CpYCG~ry~~~~  100 (102)
                      ..+.+....-|+.-+.-+.  -...+.+ +.++.-.||+||......+
T Consensus        92 ~~e~~~~~Y~Cp~C~~~y~--~~ea~~~~d~~~~f~Cp~Cg~~l~~~d  137 (147)
T smart00531       92 EDETNNAYYKCPNCQSKYT--FLEANQLLDMDGTFTCPRCGEELEEDD  137 (147)
T ss_pred             hcccCCcEEECcCCCCEee--HHHHHHhcCCCCcEECCCCCCEEEEcC
Confidence            3445566778975542111  0111222 3345689999999876543


No 88 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=41.40  E-value=13  Score=18.80  Aligned_cols=12  Identities=25%  Similarity=0.678  Sum_probs=10.1

Q ss_pred             eecCCCCccccc
Q 034182           87 AICKYCGLRYVQ   98 (102)
Q Consensus        87 ~~CpYCG~ry~~   98 (102)
                      -.|..|+..|..
T Consensus         2 ~~C~~C~~~F~~   13 (27)
T PF13912_consen    2 FECDECGKTFSS   13 (27)
T ss_dssp             EEETTTTEEESS
T ss_pred             CCCCccCCccCC
Confidence            479999999974


No 89 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=41.11  E-value=15  Score=24.09  Aligned_cols=12  Identities=33%  Similarity=0.933  Sum_probs=9.6

Q ss_pred             CCceecCCCCcc
Q 034182           84 KEPAICKYCGLR   95 (102)
Q Consensus        84 ~~~~~CpYCG~r   95 (102)
                      +....||+||..
T Consensus        16 ~d~e~CP~Cgs~   27 (64)
T COG2093          16 EDTEICPVCGST   27 (64)
T ss_pred             CCCccCCCCCCc
Confidence            456789999986


No 90 
>COG1781 PyrI Aspartate carbamoyltransferase, regulatory subunit [Nucleotide transport and metabolism]
Probab=41.01  E-value=20  Score=27.09  Aligned_cols=57  Identities=18%  Similarity=0.409  Sum_probs=31.6

Q ss_pred             CChhhhhccCCCEE---e-----cCeEEeecCCCCCCCCC-C--ceEEEcC-CCCceecCCCCcccccc
Q 034182           43 KSPMELINEVPPIK---V-----EGRIVACEGDSNPALGH-P--IEFICLD-LKEPAICKYCGLRYVQD   99 (102)
Q Consensus        43 ~~a~elI~e~p~i~---V-----~~~~v~CdG~~~palGH-P--rVyI~Ld-~~~~~~CpYCG~ry~~~   99 (102)
                      +..+..|....+++   +     -..++.|+.+.=--+.. |  --|.-++ ++..-.|.||++.|..+
T Consensus        80 ~ATvNiI~ny~VveK~~v~lP~~i~gvlkCpN~nCITn~e~pv~s~F~~~~~~~~~lrC~YCe~~~~~~  148 (153)
T COG1781          80 NATVNIIRNYEVVEKFKVKLPEEIEGVLRCPNPNCITNAEEPVESKFYVVSKEPLALRCKYCEKTFSED  148 (153)
T ss_pred             CCEEEEeeceEEEEeeccCCChhhccEEEcCCCCcccCCCccCCccEEEEecCCcEEEEEecCcEechh
Confidence            33455555554443   1     14578998874211111 1  1344444 44568999999998644


No 91 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=40.96  E-value=17  Score=20.41  Aligned_cols=11  Identities=36%  Similarity=1.023  Sum_probs=8.6

Q ss_pred             CCceecCCCCc
Q 034182           84 KEPAICKYCGL   94 (102)
Q Consensus        84 ~~~~~CpYCG~   94 (102)
                      +-+..||.||.
T Consensus        16 ~~p~~CP~Cg~   26 (34)
T cd00729          16 EAPEKCPICGA   26 (34)
T ss_pred             cCCCcCcCCCC
Confidence            34679999997


No 92 
>PF00653 BIR:  Inhibitor of Apoptosis domain;  InterPro: IPR001370 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively. In many cases they are synthesised as part of a larger precursor protein, either as a prepropeptide or as an N-terminal domain associated with an inactive peptidase or zymogen. This domain prevents access of the substrate to the active site. Removal of the N-terminal inhibitor domain either by interaction with a second peptidase or by autocatalytic cleavage activates the zymogen. Other inhibitors interact direct with proteinases using a simple noncovalent lock and key mechanism; while yet others use a conformational change-based trapping mechanism that depends on their structural and thermodynamic properties.   The baculovirus inhibitor of apoptosis protein repeat (BIR) is a domain of tandem repeats separated by a variable length linker that seems to confer cell death-preventing activity [, ]. The BIR domains characterise the Inhibitor of Apoptosis (IAP) family of proteins (MEROPS proteinase inhibitor family I32, clan IV) that suppress apoptosis by interacting with and inhibiting the enzymatic activity of both initiator and effector caspases (MEROPS peptidase family C14, IPR002398 from INTERPRO). Several distinct mammalian IAPs including XIAP, c-IAP1, c-IAP2, and ML-IAP, have been identified, and they all exhibit antiapoptotic activity in cell culture. The functional unit in each IAP protein is the baculoviral IAP repeat (BIR), which contains approximately 80 amino acids folded around a zinc atom. Most mammalian IAPs have more than one BIR domain, with the different BIR domains performing distinct functions. For example, in XIAP, the third BIR domain (BIR3) potently inhibits the catalytic activity of caspase-9, whereas the linker sequences immediately preceding the second BIR domain (BIR2) selectively targets caspase-3 or -7.  The first-recognised members of family MEROPS inhibitor family I32 were viral proteins that inhibited the apoptosis of infected cells: Cp-IAP from Cydia pomonella granulosis virus (CpGV) [] and Op-IAP from Orgyia pseudotsugata multicapsid polyhedrosis virus(OpMNPV) []. The discovery of homologous proteins in mammals followed soon after with the recognition that mutations in the gene for neuronal apoptosis inhibitory protein (NIAP) underlie spinal muscular atrophy []. The inhibitors in family I32 all possess one or more 80-residue domains known as BIR (baculovirus inhibitor repeat) domains and have accordingly been termed 'BIR-containing' or 'BIRC' proteins as well as IAP proteins.  The mechanism of inhibition of caspases by the IAP proteins is complex, and reactive site residues cannot yet be identified with any confidence. Despite the conservation of the BIR or IAP (inhibitor of apoptosis) domains throughout the family it seems clear that other parts of the molecules also make essential contributions to inhibitory activity.  Homologs of most components in the mammalian apoptotic pathway have been identified in fruit flies. The Drosophila Apaf-1, known as Dapaf-1, HAC-1 or Dark, shares significant sequence similarity with its mammalian counterpart, and is critically important for the activation of the Drosophila initiator caspase Dronc. Dronc, in turn, cleaves and activates the effector caspase DrICE. The Drosophila IAP, DIAP1, binds to and in-activates both DrICE and Dronc through its BIR1 and BIR2 domains. During apoptosis, the anti-death function of DIAP1 is countered by at least four pro-apoptotic proteins, Reaper, Hid, Grim, and sickle, through direct physical interactions. These four proteins represent the functional homologs of the mammalian protein Smac, and they all share a conserved IAP-binding motif at their N termini. The three proteins Reaper, Hid, and Grim are collectively referred to as the RHG proteins [, ].  Both XIAP and DIAP1 contain a RING domain at their C termini, and can act as an E3 ubiquitin ligase. Indeed, both XIAP and DIAP1 have been shown to promote self-ubiquitination and degradation as well as to negatively regulate the target caspases. Nonetheless, important differences exist between XIAP and DIAP1. The primary function of XIAP is thought to inhibit the catalytic activities of caspases; to what extent the ubiquitinating activity of XIAP contributes to its function remains unclear. For DIAP1, however, the ubiquitinating activity appears to be essential for its function.  Recently a Drosophila p53 protein has been identified that mediates apoptosis via a novel pathway involving the activation of the Reaper gene and subsequent inhibition of the inhibitors of apoptosis (IAPs). CIAP1, a major mammalian homologue of Drosophila IAPs, is irreversibly inhibited (cleaved) during p53-dependent apoptosis and this cleavage is mediated by a serine protease. Serine protease inhibitors that block CIAP1 cleavage inhibit p53-dependent apoptosis. Furthermore, activation of the p53 protein increases the transcription of the HTRA2 gene, which encodes a serine protease that interacts with CIAP1 and potentiates apoptosis. Therefore mammalian p53 protein activates apoptosis through a novel pathway functionally similar to that in Drosophila, which involves HTRA2 and subsequent inhibition of CIAP1 by cleavage [].; GO: 0005622 intracellular; PDB: 3HL5_B 3UW5_A 3CM7_A 1G3F_A 1G73_C 3G76_G 3CM2_C 2VSL_A 2OPZ_B 3CLX_A ....
Probab=40.07  E-value=25  Score=21.90  Aligned_cols=17  Identities=29%  Similarity=0.618  Sum_probs=12.9

Q ss_pred             cCCCCceecCCCCcccc
Q 034182           81 LDLKEPAICKYCGLRYV   97 (102)
Q Consensus        81 Ld~~~~~~CpYCG~ry~   97 (102)
                      .+.+..+.|-|||....
T Consensus        31 ~~~~d~v~C~~C~~~l~   47 (70)
T PF00653_consen   31 TGTGDRVRCFYCGLELD   47 (70)
T ss_dssp             ESSTTEEEETTTTEEEE
T ss_pred             cCCCCEEEEeccCCEEe
Confidence            33356899999999874


No 93 
>cd00022 BIR Baculoviral inhibition of apoptosis protein repeat domain; Found in inhibitors of apoptosis proteins (IAPs) and other proteins. In higher eukaryotes, BIR domains inhibit apoptosis by acting as direct inhibitors of the caspase family of protease enzymes. In yeast, BIR domains are involved in regulating cytokinesis. This novel fold is stabilized by zinc tetrahedrally coordinated by one histidine and three cysteine residues and resembles a classical zinc finger.
Probab=39.13  E-value=23  Score=21.65  Aligned_cols=15  Identities=27%  Similarity=0.753  Sum_probs=12.2

Q ss_pred             CCceecCCCCccccc
Q 034182           84 KEPAICKYCGLRYVQ   98 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~   98 (102)
                      +..+.|.||+..+..
T Consensus        32 ~d~v~C~~C~~~~~~   46 (69)
T cd00022          32 GDEVKCFFCGLELKN   46 (69)
T ss_pred             CCEEEeCCCCCCccC
Confidence            457999999998863


No 94 
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=38.87  E-value=18  Score=26.10  Aligned_cols=23  Identities=13%  Similarity=0.544  Sum_probs=17.7

Q ss_pred             CCceEEEcCCCCceecCCCCcccc
Q 034182           74 HPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        74 HPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      +..-|..++ -|...||-||.-|.
T Consensus        38 ~~LdyV~ie-~G~t~CP~Cg~~~e   60 (115)
T COG1885          38 PDLDYVEIE-VGSTSCPKCGEPFE   60 (115)
T ss_pred             CCCCeEEEe-cccccCCCCCCccc
Confidence            445588887 47889999998774


No 95 
>PTZ00218 40S ribosomal protein S29; Provisional
Probab=38.82  E-value=20  Score=22.72  Aligned_cols=23  Identities=26%  Similarity=0.405  Sum_probs=18.1

Q ss_pred             CCCCCCceEEEcCCCCceecCCCCccc
Q 034182           70 PALGHPIEFICLDLKEPAICKYCGLRY   96 (102)
Q Consensus        70 palGHPrVyI~Ld~~~~~~CpYCG~ry   96 (102)
                      -|..||+-|    ..|...|.-||..-
T Consensus         4 ~~~shpr~y----GkGsr~C~vCg~~~   26 (54)
T PTZ00218          4 LFNTHPRTY----GKGSRQCRVCSNRH   26 (54)
T ss_pred             cccCCCCcC----CCCCCeeecCCCcc
Confidence            388999965    35788999999864


No 96 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=38.58  E-value=13  Score=24.33  Aligned_cols=15  Identities=27%  Similarity=0.667  Sum_probs=11.8

Q ss_pred             CCceecCCCCccccc
Q 034182           84 KEPAICKYCGLRYVQ   98 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~   98 (102)
                      +..-.||-||..|..
T Consensus        15 E~~lrCPRC~~~FR~   29 (65)
T COG4049          15 EEFLRCPRCGMVFRR   29 (65)
T ss_pred             ceeeeCCchhHHHHH
Confidence            335689999999964


No 97 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=36.99  E-value=17  Score=21.28  Aligned_cols=10  Identities=30%  Similarity=0.790  Sum_probs=7.7

Q ss_pred             ceecCCCCcc
Q 034182           86 PAICKYCGLR   95 (102)
Q Consensus        86 ~~~CpYCG~r   95 (102)
                      ..+||+||..
T Consensus        18 g~~CP~Cg~~   27 (46)
T PF12760_consen   18 GFVCPHCGST   27 (46)
T ss_pred             CCCCCCCCCe
Confidence            3669999963


No 98 
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=36.97  E-value=31  Score=23.96  Aligned_cols=35  Identities=20%  Similarity=0.274  Sum_probs=26.4

Q ss_pred             CeEEeecCCCCCCCCCCceEEEcCCCC-ceecCCCCccccc
Q 034182           59 GRIVACEGDSNPALGHPIEFICLDLKE-PAICKYCGLRYVQ   98 (102)
Q Consensus        59 ~~~v~CdG~~~palGHPrVyI~Ld~~~-~~~CpYCG~ry~~   98 (102)
                      ...+.|+-=     |++.|=+++++.. ...|+-||..|..
T Consensus        19 pt~f~CP~C-----ge~~v~v~~~k~~~h~~C~~CG~y~~~   54 (99)
T PRK14892         19 PKIFECPRC-----GKVSISVKIKKNIAIITCGNCGLYTEF   54 (99)
T ss_pred             CcEeECCCC-----CCeEeeeecCCCcceEECCCCCCccCE
Confidence            467888754     4578888888743 7899999998864


No 99 
>cd00085 HNHc HNH nucleases; HNH endonuclease signature which is found in viral, prokaryotic, and eukaryotic proteins. The alignment includes members of the large group of homing endonucleases, yeast intron 1 protein, MutS, as well as bacterial colicins, pyocins, and anaredoxins.
Probab=36.04  E-value=16  Score=20.38  Aligned_cols=10  Identities=40%  Similarity=1.102  Sum_probs=8.1

Q ss_pred             eecCCCCccc
Q 034182           87 AICKYCGLRY   96 (102)
Q Consensus        87 ~~CpYCG~ry   96 (102)
                      ..|+|||..+
T Consensus        12 ~~C~~c~~~~   21 (57)
T cd00085          12 GLCPYCGKPG   21 (57)
T ss_pred             CcCccCCCcC
Confidence            5799999864


No 100
>TIGR00510 lipA lipoate synthase. The family shows strong sequence conservation.
Probab=35.42  E-value=30  Score=27.97  Aligned_cols=62  Identities=11%  Similarity=0.158  Sum_probs=38.3

Q ss_pred             eeeeccCCCCh----h-hhhccCCCEEecCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcccc
Q 034182           35 KWMQDVSKKSP----M-ELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        35 ~~~~~~~~~~a----~-elI~e~p~i~V~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      .|+....+...    + +++.+...-.| =....|+.-+.-|.++=+.||.|..-=...|.||+..+.
T Consensus        19 ~w~~~~~~~~~~~~~~~~~~~~~~l~tv-c~~a~cpn~~ec~~~~tatfm~i~~gC~~~C~FC~v~~~   85 (302)
T TIGR00510        19 EWLKIKLPLGTVIAQIKNTMKNKGLHTV-CEEASCPNLTECWNHGTATFMILGDICTRRCPFCDVAHG   85 (302)
T ss_pred             cceEecCCCCchHHHHHHHHHHCCCcee-ecCCCCCCcccccCCCEEEEEecCcCcCCCCCcCCccCC
Confidence            47776544221    1 24444322222 112456666545889999999999644899999997653


No 101
>PRK11827 hypothetical protein; Provisional
Probab=34.43  E-value=35  Score=21.83  Aligned_cols=31  Identities=29%  Similarity=0.474  Sum_probs=20.7

Q ss_pred             EEeecCCCCCCCCCCceEEEcCC-CCceecCCCCcccccc
Q 034182           61 IVACEGDSNPALGHPIEFICLDL-KEPAICKYCGLRYVQD   99 (102)
Q Consensus        61 ~v~CdG~~~palGHPrVyI~Ld~-~~~~~CpYCG~ry~~~   99 (102)
                      ++.|+.-.++ |    .|   ++ .+.-+|+-||+.|--.
T Consensus         8 ILaCP~ckg~-L----~~---~~~~~~Lic~~~~laYPI~   39 (60)
T PRK11827          8 IIACPVCNGK-L----WY---NQEKQELICKLDNLAFPLR   39 (60)
T ss_pred             heECCCCCCc-C----eE---cCCCCeEECCccCeecccc
Confidence            5788876553 2    22   33 3578899999999543


No 102
>PF02489 Herpes_glycop_H:  Herpesvirus glycoprotein H;  InterPro: IPR003493 Herpesviruses are enveloped by a lipid bilayer that contains at least a dozen glycoproteins. The virion surface glycoproteins mediate recognition of susceptible cells and promote fusion of the viral envelope with the cell membrane, leading to virus entry. No single glycoprotein associated with the virion membrane has been identified as the fusogen []. Glycoprotein L (gL) forms a non-covalently linked heterodimer with glycoprotein H (gH). This heterodimer is essential for virus-cell and cell-cell fusion since the association of gH and gL is necessary for correct localisation of gH to the virion or cell surface. gH anchoring the heterodimer to the plasma membrane through its transmembrane domain. gL lacks a transmembrane domain and is secreted from cells when expressed in the absence of gH []. This entry represents Herpesvirus glycoprotein H (gH), which is a virion associated envelope glycoprotein []. Heterodimer formation between gH and gL has been demonstrated in both virions and infected cells []. Heterodimer formation between gL and gH is important for the proper folding of gH and its insertion into the membrane because the anti-gH conformation-dependent monoclonal antibodies (mAbs) 53S and LP11 bind gH only when gL is present [, ].; PDB: 3PHF_S 3M1C_A 2LQY_A 2XQY_A.
Probab=34.22  E-value=18  Score=31.70  Aligned_cols=34  Identities=15%  Similarity=0.505  Sum_probs=14.2

Q ss_pred             EEeecCCCCC--CCCCCceEEEcCCCCceecCCCCcccc
Q 034182           61 IVACEGDSNP--ALGHPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        61 ~v~CdG~~~p--alGHPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      .-.|......  ..-=|++| |+.  ....|+|||..|.
T Consensus       537 ~~~C~~~~~~~~~~~i~~~~-Nit--~~~~C~~Cgsv~l  572 (657)
T PF02489_consen  537 NSTCSSSTGIIETRRIPVVY-NIT--PSKDCPFCGSVFL  572 (657)
T ss_dssp             TT-S-CCEE-SEEEE--EE---SS--S-SS-STTT-EEE
T ss_pred             CCCCcCCCCCCCccccCCCc-CCC--CCCCCCCCCcEEE
Confidence            4467765321  12224455 555  3458999998875


No 103
>COG1656 Uncharacterized conserved protein [Function unknown]
Probab=33.73  E-value=17  Score=27.66  Aligned_cols=23  Identities=22%  Similarity=0.342  Sum_probs=16.7

Q ss_pred             CceEEEcCCCCceecCCCCcccccc
Q 034182           75 PIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        75 PrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      |+||.+-+  ...+||-||+.|=.-
T Consensus       121 ~~~~~~~~--~f~~C~~CgkiYW~G  143 (165)
T COG1656         121 EKVYRNYE--EFYRCPKCGKIYWKG  143 (165)
T ss_pred             hhhhhccc--ceeECCCCcccccCc
Confidence            45776655  468899999999543


No 104
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=33.58  E-value=28  Score=19.14  Aligned_cols=12  Identities=33%  Similarity=0.946  Sum_probs=9.2

Q ss_pred             CCceecCCCCcc
Q 034182           84 KEPAICKYCGLR   95 (102)
Q Consensus        84 ~~~~~CpYCG~r   95 (102)
                      +.+..||-||..
T Consensus        15 ~~~~~CP~Cg~~   26 (33)
T cd00350          15 EAPWVCPVCGAP   26 (33)
T ss_pred             cCCCcCcCCCCc
Confidence            357799999973


No 105
>smart00238 BIR Baculoviral inhibition of apoptosis protein repeat. Domain found in inhibitor of apoptosis proteins (IAPs) and other proteins. Acts as a direct inhibitor of caspase enzymes.
Probab=33.49  E-value=34  Score=20.97  Aligned_cols=14  Identities=21%  Similarity=0.605  Sum_probs=11.2

Q ss_pred             CceecCCCCccccc
Q 034182           85 EPAICKYCGLRYVQ   98 (102)
Q Consensus        85 ~~~~CpYCG~ry~~   98 (102)
                      ..+.|.|||..+..
T Consensus        35 d~v~C~~C~~~l~~   48 (71)
T smart00238       35 DEVKCFFCGGELDN   48 (71)
T ss_pred             CEEEeCCCCCCcCC
Confidence            36999999998753


No 106
>PHA03296 envelope glycoprotein H; Provisional
Probab=33.41  E-value=23  Score=32.81  Aligned_cols=23  Identities=17%  Similarity=0.268  Sum_probs=16.9

Q ss_pred             CCceEEEcCCCCceecCCCCcccc
Q 034182           74 HPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        74 HPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      =|.+++|+.. ....|+|||..|.
T Consensus       682 Ip~v~LN~t~-~~k~C~yCGSVfL  704 (814)
T PHA03296        682 IEDGHLNLHG-AAIACILCGHAIL  704 (814)
T ss_pred             ccceeecCCC-CCCcCCcCCEEEE
Confidence            3566677764 4678999998875


No 107
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=32.91  E-value=23  Score=22.58  Aligned_cols=13  Identities=23%  Similarity=0.442  Sum_probs=8.1

Q ss_pred             ceecCCCCccccc
Q 034182           86 PAICKYCGLRYVQ   98 (102)
Q Consensus        86 ~~~CpYCG~ry~~   98 (102)
                      .+.||||.....-
T Consensus        55 ~G~CP~C~~~i~~   67 (70)
T PF11793_consen   55 FGECPYCSSPISW   67 (70)
T ss_dssp             EEE-TTT-SEEEG
T ss_pred             ccCCcCCCCeeeE
Confidence            4789999987653


No 108
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=32.87  E-value=13  Score=23.65  Aligned_cols=15  Identities=20%  Similarity=0.326  Sum_probs=11.3

Q ss_pred             CCceecCCCCccccc
Q 034182           84 KEPAICKYCGLRYVQ   98 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~   98 (102)
                      ...-.||+||..+.-
T Consensus        12 ~v~~~Cp~cGipthc   26 (55)
T PF13824_consen   12 HVNFECPDCGIPTHC   26 (55)
T ss_pred             ccCCcCCCCCCcCcc
Confidence            346789999988753


No 109
>PRK12495 hypothetical protein; Provisional
Probab=32.37  E-value=7.6  Score=30.99  Aligned_cols=55  Identities=20%  Similarity=0.355  Sum_probs=33.0

Q ss_pred             eeeeccCCCChhhhhccCCCEEecCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCccccc
Q 034182           35 KWMQDVSKKSPMELINEVPPIKVEGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        35 ~~~~~~~~~~a~elI~e~p~i~V~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~ry~~   98 (102)
                      |+.+++.+..+++.|++.=.....-.-..|.-=|.| +     |   ..+|...|+.|+..+..
T Consensus        16 Kye~d~~~R~~~~~ma~lL~~gatmsa~hC~~CG~P-I-----p---a~pG~~~Cp~CQ~~~~~   70 (226)
T PRK12495         16 KYEQDEQKREATERMSELLLQGATMTNAHCDECGDP-I-----F---RHDGQEFCPTCQQPVTE   70 (226)
T ss_pred             HHhhhHHHHHHHHHHHHHHHhhcccchhhcccccCc-c-----c---CCCCeeECCCCCCcccc
Confidence            444555566666666554333344555667555444 2     1   33789999999988753


No 110
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional
Probab=31.92  E-value=98  Score=27.29  Aligned_cols=37  Identities=24%  Similarity=0.540  Sum_probs=24.1

Q ss_pred             EeecCCCC---CCCC--CCceEEEcCCCCceecCCCCcccccc
Q 034182           62 VACEGDSN---PALG--HPIEFICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        62 v~CdG~~~---palG--HPrVyI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      +.|+.+.=   ...+  =+..|.-. ..+.-+|.||++.|..+
T Consensus       479 ~~C~Np~CIt~~~~~e~~~~~F~~~-~~~~~~C~YCe~~~~~~  520 (525)
T PRK13376        479 LRCKNENCITNPAHGENVSASFVRN-EKGRFVCEYCETPHTFE  520 (525)
T ss_pred             EEeCCCCCcCCCCCCCcCCceEEEc-cCCEEEeeCCCCEeccc
Confidence            89988742   1111  24456655 34589999999998654


No 111
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=31.37  E-value=38  Score=21.14  Aligned_cols=12  Identities=33%  Similarity=0.736  Sum_probs=10.3

Q ss_pred             ceecCCCCcccc
Q 034182           86 PAICKYCGLRYV   97 (102)
Q Consensus        86 ~~~CpYCG~ry~   97 (102)
                      .+.||-||..|.
T Consensus        22 iV~Cp~CGaele   33 (54)
T TIGR01206        22 LVICDECGAELE   33 (54)
T ss_pred             EEeCCCCCCEEE
Confidence            678999999885


No 112
>PHA00732 hypothetical protein
Probab=30.94  E-value=21  Score=23.55  Aligned_cols=13  Identities=23%  Similarity=0.559  Sum_probs=10.7

Q ss_pred             ecCCCCccccccc
Q 034182           88 ICKYCGLRYVQDH  100 (102)
Q Consensus        88 ~CpYCG~ry~~~~  100 (102)
                      .|+.||..|....
T Consensus        29 ~C~~CgKsF~~l~   41 (79)
T PHA00732         29 KCPVCNKSYRRLN   41 (79)
T ss_pred             ccCCCCCEeCChh
Confidence            7999999997543


No 113
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=30.72  E-value=48  Score=18.83  Aligned_cols=27  Identities=26%  Similarity=0.433  Sum_probs=14.2

Q ss_pred             CCCCCceEEEcCCC--CceecCCCCcccc
Q 034182           71 ALGHPIEFICLDLK--EPAICKYCGLRYV   97 (102)
Q Consensus        71 alGHPrVyI~Ld~~--~~~~CpYCG~ry~   97 (102)
                      .-|+|..+.-.+.+  ...+|+=||...+
T Consensus         5 ~CG~~l~~~ip~gd~r~R~vC~~Cg~IhY   33 (34)
T PF14803_consen    5 QCGGPLERRIPEGDDRERLVCPACGFIHY   33 (34)
T ss_dssp             TT--B-EEE--TT-SS-EEEETTTTEEE-
T ss_pred             cccChhhhhcCCCCCccceECCCCCCEEe
Confidence            35788888777444  4788999997653


No 114
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=30.10  E-value=25  Score=26.62  Aligned_cols=17  Identities=24%  Similarity=0.757  Sum_probs=13.5

Q ss_pred             EEEcCCCCceecCCCCcc
Q 034182           78 FICLDLKEPAICKYCGLR   95 (102)
Q Consensus        78 yI~Ld~~~~~~CpYCG~r   95 (102)
                      |+-.+ +.+..||-||..
T Consensus       142 y~~~g-e~P~~CPiCga~  158 (166)
T COG1592         142 YTHEG-EAPEVCPICGAP  158 (166)
T ss_pred             CcccC-CCCCcCCCCCCh
Confidence            56666 789999999954


No 115
>smart00746 TRASH metallochaperone-like domain.
Probab=29.69  E-value=24  Score=17.11  Aligned_cols=9  Identities=33%  Similarity=1.132  Sum_probs=7.2

Q ss_pred             cCCCCcccc
Q 034182           89 CKYCGLRYV   97 (102)
Q Consensus        89 CpYCG~ry~   97 (102)
                      |++||....
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            889988765


No 116
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=29.66  E-value=25  Score=20.09  Aligned_cols=12  Identities=42%  Similarity=0.822  Sum_probs=9.4

Q ss_pred             eecCCCCccccc
Q 034182           87 AICKYCGLRYVQ   98 (102)
Q Consensus        87 ~~CpYCG~ry~~   98 (102)
                      .+|+-||..|-.
T Consensus         2 r~C~~Cg~~Yh~   13 (36)
T PF05191_consen    2 RICPKCGRIYHI   13 (36)
T ss_dssp             EEETTTTEEEET
T ss_pred             cCcCCCCCcccc
Confidence            468999998854


No 117
>KOG1280 consensus Uncharacterized conserved protein containing ZZ-type Zn-finger [General function prediction only]
Probab=29.36  E-value=24  Score=30.14  Aligned_cols=18  Identities=28%  Similarity=0.521  Sum_probs=12.4

Q ss_pred             EEEcCCCCceecCCCCcc
Q 034182           78 FICLDLKEPAICKYCGLR   95 (102)
Q Consensus        78 yI~Ld~~~~~~CpYCG~r   95 (102)
                      ||....+.--+|||||..
T Consensus        71 ~i~~y~~qSftCPyC~~~   88 (381)
T KOG1280|consen   71 PISHYDPQSFTCPYCGIM   88 (381)
T ss_pred             cccccccccccCCccccc
Confidence            344444556789999975


No 118
>PHA00733 hypothetical protein
Probab=29.04  E-value=32  Score=24.40  Aligned_cols=16  Identities=19%  Similarity=0.632  Sum_probs=9.4

Q ss_pred             CCCCceecCCCCcccc
Q 034182           82 DLKEPAICKYCGLRYV   97 (102)
Q Consensus        82 d~~~~~~CpYCG~ry~   97 (102)
                      ..+.+..|++||..|.
T Consensus        69 ~~~kPy~C~~Cgk~Fs   84 (128)
T PHA00733         69 KAVSPYVCPLCLMPFS   84 (128)
T ss_pred             CCCCCccCCCCCCcCC
Confidence            3344566666666665


No 119
>PF09180 ProRS-C_1:  Prolyl-tRNA synthetase, C-terminal;  InterPro: IPR016061 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Prolyl tRNA synthetase (6.1.1.15 from EC) exists in two forms, which are loosely related. The first form is present in the majority of eubacteria species. The second one, present in some eubacteria, is essentially present in archaea and eukaryota. Prolyl-tRNA synthetase belongs to class IIa.  This domain is found at the C-terminal in archaeal and eukaryotic enzymes, as well as in certain bacterial ones.; GO: 0000166 nucleotide binding, 0004827 proline-tRNA ligase activity, 0005524 ATP binding, 0006433 prolyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1NJ6_A 1NJ2_A 1NJ5_A 1NJ1_A 1H4T_C 1H4S_A 1HC7_C 1H4Q_B 3IAL_B.
Probab=28.03  E-value=31  Score=21.91  Aligned_cols=12  Identities=33%  Similarity=0.645  Sum_probs=6.7

Q ss_pred             CCceecCCCCcc
Q 034182           84 KEPAICKYCGLR   95 (102)
Q Consensus        84 ~~~~~CpYCG~r   95 (102)
                      .....|.+||..
T Consensus        46 ~~~~~Ci~cgk~   57 (68)
T PF09180_consen   46 PEGGKCIVCGKP   57 (68)
T ss_dssp             BTT-B-TTT-SB
T ss_pred             CCCCeeecCCCh
Confidence            457899999964


No 120
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=27.01  E-value=39  Score=24.12  Aligned_cols=37  Identities=24%  Similarity=0.476  Sum_probs=25.1

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCC----CCceecCCCCcccccc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDL----KEPAICKYCGLRYVQD   99 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~----~~~~~CpYCG~ry~~~   99 (102)
                      =.+.+-|+-     -||-.|=+.+-+    -+.+.|+-||++|.-+
T Consensus        19 L~k~FtCp~-----Cghe~vs~ctvkk~~~~g~~~Cg~CGls~e~e   59 (104)
T COG4888          19 LPKTFTCPR-----CGHEKVSSCTVKKTVNIGTAVCGNCGLSFECE   59 (104)
T ss_pred             CCceEecCc-----cCCeeeeEEEEEecCceeEEEcccCcceEEEe
Confidence            466777864     467777644332    2478999999999743


No 121
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=26.37  E-value=24  Score=21.98  Aligned_cols=15  Identities=33%  Similarity=0.928  Sum_probs=11.4

Q ss_pred             CceecCCCCcccccc
Q 034182           85 EPAICKYCGLRYVQD   99 (102)
Q Consensus        85 ~~~~CpYCG~ry~~~   99 (102)
                      .-.-|=|||.+|...
T Consensus        26 ~~~YC~~Cg~~Y~d~   40 (55)
T PF13821_consen   26 EHNYCFWCGTKYDDE   40 (55)
T ss_pred             hCceeeeeCCccCCH
Confidence            345699999999753


No 122
>KOG0292 consensus Vesicle coat complex COPI, alpha subunit [Intracellular trafficking, secretion, and vesicular transport]
Probab=26.26  E-value=32  Score=33.04  Aligned_cols=21  Identities=24%  Similarity=0.659  Sum_probs=15.0

Q ss_pred             EEEcCCCC-ceecCCCCccccc
Q 034182           78 FICLDLKE-PAICKYCGLRYVQ   98 (102)
Q Consensus        78 yI~Ld~~~-~~~CpYCG~ry~~   98 (102)
                      |-+|=... ...|||||..|+.
T Consensus      1155 ~~Piy~g~p~~~cp~cga~y~~ 1176 (1202)
T KOG0292|consen 1155 YVPIYRGRPDVSCPYCGACFVP 1176 (1202)
T ss_pred             ceeeecCCCCcCCCcccceecc
Confidence            45554433 5789999999974


No 123
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=25.92  E-value=31  Score=21.35  Aligned_cols=9  Identities=44%  Similarity=1.139  Sum_probs=7.6

Q ss_pred             ceecCCCCc
Q 034182           86 PAICKYCGL   94 (102)
Q Consensus        86 ~~~CpYCG~   94 (102)
                      .-+|+|||.
T Consensus        44 ~y~C~~Cg~   52 (54)
T PF10058_consen   44 QYRCPYCGA   52 (54)
T ss_pred             EEEcCCCCC
Confidence            568999995


No 124
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=25.86  E-value=23  Score=24.17  Aligned_cols=16  Identities=25%  Similarity=0.644  Sum_probs=7.7

Q ss_pred             CCCceecCCCCccccc
Q 034182           83 LKEPAICKYCGLRYVQ   98 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~   98 (102)
                      +++...||-|+++|+.
T Consensus        48 keg~q~CpqCkt~ykr   63 (80)
T PF14569_consen   48 KEGNQVCPQCKTRYKR   63 (80)
T ss_dssp             HTS-SB-TTT--B---
T ss_pred             hcCcccccccCCCccc
Confidence            4788899999999974


No 125
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=25.46  E-value=60  Score=22.37  Aligned_cols=36  Identities=22%  Similarity=0.451  Sum_probs=23.8

Q ss_pred             eecCCCCCCCCCCceEEEcCC--------CC-ceecCCCCcccccc
Q 034182           63 ACEGDSNPALGHPIEFICLDL--------KE-PAICKYCGLRYVQD   99 (102)
Q Consensus        63 ~CdG~~~palGHPrVyI~Ld~--------~~-~~~CpYCG~ry~~~   99 (102)
                      .|.|++. ..|-=.+|.++.+        +- ...|+-||-.|..+
T Consensus         4 ~C~~~~~-~~~~tTv~~el~~G~~~IvIknVPa~~C~~CGe~y~~d   48 (89)
T TIGR03829         4 WCEEEKA-IARTTTVYWELPDGTKAIEIKETPSISCSHCGMEYQDD   48 (89)
T ss_pred             ccCCCce-ecceEEEEEEecCCceEEEEecCCcccccCCCcEeecH
Confidence            5766543 4566677777743        12 35799999999753


No 126
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=25.08  E-value=37  Score=21.00  Aligned_cols=15  Identities=33%  Similarity=0.780  Sum_probs=12.3

Q ss_pred             CCceecCCCCccccc
Q 034182           84 KEPAICKYCGLRYVQ   98 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~   98 (102)
                      +..-+|.-||..|+.
T Consensus         2 Dk~l~C~dCg~~Fvf   16 (49)
T PF13451_consen    2 DKTLTCKDCGAEFVF   16 (49)
T ss_pred             CeeEEcccCCCeEEE
Confidence            456789999999985


No 127
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=24.79  E-value=41  Score=17.66  Aligned_cols=13  Identities=23%  Similarity=0.759  Sum_probs=10.6

Q ss_pred             ceecCCCCccccc
Q 034182           86 PAICKYCGLRYVQ   98 (102)
Q Consensus        86 ~~~CpYCG~ry~~   98 (102)
                      .-.|.+|+..|..
T Consensus         3 ~~~C~~C~~~~~~   15 (35)
T smart00451        3 GFYCKLCNVTFTD   15 (35)
T ss_pred             CeEccccCCccCC
Confidence            4579999999873


No 128
>PRK00420 hypothetical protein; Validated
Probab=24.69  E-value=68  Score=22.84  Aligned_cols=16  Identities=19%  Similarity=0.432  Sum_probs=13.2

Q ss_pred             CCCceecCCCCccccc
Q 034182           83 LKEPAICKYCGLRYVQ   98 (102)
Q Consensus        83 ~~~~~~CpYCG~ry~~   98 (102)
                      ++|...||-||..+.-
T Consensus        37 k~g~~~Cp~Cg~~~~v   52 (112)
T PRK00420         37 KDGEVVCPVHGKVYIV   52 (112)
T ss_pred             CCCceECCCCCCeeee
Confidence            5789999999997753


No 129
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=23.86  E-value=30  Score=19.30  Aligned_cols=14  Identities=29%  Similarity=0.826  Sum_probs=3.9

Q ss_pred             eecCCCCccccccc
Q 034182           87 AICKYCGLRYVQDH  100 (102)
Q Consensus        87 ~~CpYCG~ry~~~~  100 (102)
                      -.||.||..|.+.+
T Consensus         3 p~Cp~C~se~~y~D   16 (30)
T PF08274_consen    3 PKCPLCGSEYTYED   16 (30)
T ss_dssp             ---TTT-----EE-
T ss_pred             CCCCCCCCcceecc
Confidence            36999998887643


No 130
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=23.45  E-value=1.1e+02  Score=21.29  Aligned_cols=30  Identities=17%  Similarity=0.266  Sum_probs=17.8

Q ss_pred             cCeEEeecCCCCCCCCCCceEEEcCCCCceecCCCCcc
Q 034182           58 EGRIVACEGDSNPALGHPIEFICLDLKEPAICKYCGLR   95 (102)
Q Consensus        58 ~~~~v~CdG~~~palGHPrVyI~Ld~~~~~~CpYCG~r   95 (102)
                      -.-.+.|.-=+.        +.++.......||.||..
T Consensus        67 ~p~~~~C~~Cg~--------~~~~~~~~~~~CP~Cgs~   96 (114)
T PRK03681         67 QEAECWCETCQQ--------YVTLLTQRVRRCPQCHGD   96 (114)
T ss_pred             eCcEEEcccCCC--------eeecCCccCCcCcCcCCC
Confidence            345667754332        455543334679999965


No 131
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=23.24  E-value=46  Score=19.03  Aligned_cols=15  Identities=33%  Similarity=0.603  Sum_probs=9.4

Q ss_pred             CceecCCCCcccccc
Q 034182           85 EPAICKYCGLRYVQD   99 (102)
Q Consensus        85 ~~~~CpYCG~ry~~~   99 (102)
                      ....|+.||=+|.+.
T Consensus        20 ~~isC~~CGPr~~i~   34 (35)
T PF07503_consen   20 QFISCTNCGPRYSII   34 (35)
T ss_dssp             TT--BTTCC-SCCCE
T ss_pred             cCccCCCCCCCEEEe
Confidence            467899999998753


No 132
>KOG3993 consensus Transcription factor (contains Zn finger) [Transcription]
Probab=22.93  E-value=25  Score=30.91  Aligned_cols=15  Identities=20%  Similarity=0.581  Sum_probs=12.6

Q ss_pred             CCceecCCCCccccc
Q 034182           84 KEPAICKYCGLRYVQ   98 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~   98 (102)
                      ++...|.|||+.|..
T Consensus       354 ~gi~~C~~C~KkFrR  368 (500)
T KOG3993|consen  354 SGIFSCHTCGKKFRR  368 (500)
T ss_pred             CceeecHHhhhhhHH
Confidence            457889999999974


No 133
>cd00150 PlantTI Plant trypsin inhibitors such as squash trypsin inhibitor. Plant proteinase inhibitors play important roles in natural plant defense. Proteinase inhibitors from squash seeds form an uniform family of small proteins cross-linked with three disulfide bridges.
Probab=22.85  E-value=48  Score=18.38  Aligned_cols=10  Identities=10%  Similarity=0.046  Sum_probs=7.4

Q ss_pred             CceEEEcCCC
Q 034182           75 PIEFICLDLK   84 (102)
Q Consensus        75 PrVyI~Ld~~   84 (102)
                      ||+++.-..+
T Consensus         2 PrIlm~Ck~D   11 (27)
T cd00150           2 PRILMECKRD   11 (27)
T ss_pred             cchheecccc
Confidence            7888877764


No 134
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=22.75  E-value=63  Score=17.83  Aligned_cols=13  Identities=31%  Similarity=0.948  Sum_probs=10.2

Q ss_pred             eecCCCCcccccc
Q 034182           87 AICKYCGLRYVQD   99 (102)
Q Consensus        87 ~~CpYCG~ry~~~   99 (102)
                      ..|+.||..|...
T Consensus        33 ~~C~~CGE~~~~~   45 (46)
T TIGR03831        33 LVCPQCGEEYLDA   45 (46)
T ss_pred             cccccCCCEeeCC
Confidence            4699999988653


No 135
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=22.67  E-value=40  Score=23.53  Aligned_cols=12  Identities=17%  Similarity=0.642  Sum_probs=8.6

Q ss_pred             CceecCCCCccc
Q 034182           85 EPAICKYCGLRY   96 (102)
Q Consensus        85 ~~~~CpYCG~ry   96 (102)
                      ....||+||..-
T Consensus        87 ~~~~CP~Cgs~~   98 (117)
T PRK00564         87 DYGVCEKCHSKN   98 (117)
T ss_pred             cCCcCcCCCCCc
Confidence            345699999754


No 136
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=22.26  E-value=72  Score=19.48  Aligned_cols=25  Identities=20%  Similarity=0.289  Sum_probs=14.9

Q ss_pred             CCCCCceEEEcCCCCceecCCCCcccc
Q 034182           71 ALGHPIEFICLDLKEPAICKYCGLRYV   97 (102)
Q Consensus        71 alGHPrVyI~Ld~~~~~~CpYCG~ry~   97 (102)
                      .-||...-  -.......||-||..+-
T Consensus        33 ~CG~~~~~--~~~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   33 RCGHRNKK--RRSGRVFTCPNCGFEMD   57 (69)
T ss_pred             Cccccccc--ccccceEEcCCCCCEEC
Confidence            34665555  11234778888887753


No 137
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=22.12  E-value=41  Score=18.17  Aligned_cols=12  Identities=33%  Similarity=0.985  Sum_probs=6.1

Q ss_pred             ecCCCCcccccc
Q 034182           88 ICKYCGLRYVQD   99 (102)
Q Consensus        88 ~CpYCG~ry~~~   99 (102)
                      .||.||..-+++
T Consensus         1 ~CP~C~s~l~~~   12 (28)
T PF03119_consen    1 TCPVCGSKLVRE   12 (28)
T ss_dssp             B-TTT--BEEE-
T ss_pred             CcCCCCCEeEcC
Confidence            499999887643


No 138
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics]
Probab=21.82  E-value=53  Score=26.95  Aligned_cols=31  Identities=29%  Similarity=0.566  Sum_probs=21.9

Q ss_pred             CeEEeecCCCCCCCCCCceEEEcC-------CCCceecCCCCc
Q 034182           59 GRIVACEGDSNPALGHPIEFICLD-------LKEPAICKYCGL   94 (102)
Q Consensus        59 ~~~v~CdG~~~palGHPrVyI~Ld-------~~~~~~CpYCG~   94 (102)
                      +..|+|||.+     -++.|+-++       .+|...||.|-.
T Consensus       232 GqMVaCDn~n-----CkrEWFH~~CVGLk~pPKG~WYC~eCk~  269 (271)
T COG5034         232 GQMVACDNAN-----CKREWFHLECVGLKEPPKGKWYCPECKK  269 (271)
T ss_pred             ccceecCCCC-----CchhheeccccccCCCCCCcEeCHHhHh
Confidence            7789999874     445555544       467899999953


No 139
>COG2835 Uncharacterized conserved protein [Function unknown]
Probab=21.82  E-value=96  Score=20.05  Aligned_cols=31  Identities=32%  Similarity=0.618  Sum_probs=22.1

Q ss_pred             EEeecCCCCCCCCCCceEEEcCCC-CceecCCCCcccccc
Q 034182           61 IVACEGDSNPALGHPIEFICLDLK-EPAICKYCGLRYVQD   99 (102)
Q Consensus        61 ~v~CdG~~~palGHPrVyI~Ld~~-~~~~CpYCG~ry~~~   99 (102)
                      +++|+--.++        |.++++ +.-.|+-|++.|--.
T Consensus         8 iLaCP~~kg~--------L~~~~~~~~L~c~~~~~aYpI~   39 (60)
T COG2835           8 ILACPVCKGP--------LVYDEEKQELICPRCKLAYPIR   39 (60)
T ss_pred             eeeccCcCCc--------ceEeccCCEEEecccCceeecc
Confidence            6788776653        455554 478999999999643


No 140
>PF10080 DUF2318:  Predicted membrane protein (DUF2318);  InterPro: IPR018758 This domain of unknown function is found in hypothetical bacterial membrane proteins with no known function. 
Probab=21.45  E-value=48  Score=23.08  Aligned_cols=20  Identities=25%  Similarity=0.738  Sum_probs=15.4

Q ss_pred             EEEcCCCCceecCCCCcccccc
Q 034182           78 FICLDLKEPAICKYCGLRYVQD   99 (102)
Q Consensus        78 yI~Ld~~~~~~CpYCG~ry~~~   99 (102)
                      |.  .+.+..+|..||.+|.+.
T Consensus        46 Y~--q~g~~lvC~~C~~~~~~~   65 (102)
T PF10080_consen   46 YY--QEGDQLVCKNCGVRFNLP   65 (102)
T ss_pred             eE--EECCEEEEecCCCEEehh
Confidence            66  234689999999999754


No 141
>TIGR02646 conserved hypothetical protein TIGR02646. Members of this uncharacterized protein family are found exclusively in bacteria. Neighboring genes in various genomes are also uncharacterized or may annotated as similar to restriction system proteins.
Probab=21.20  E-value=45  Score=23.69  Aligned_cols=14  Identities=21%  Similarity=0.631  Sum_probs=10.4

Q ss_pred             CCceecCCCCcccc
Q 034182           84 KEPAICKYCGLRYV   97 (102)
Q Consensus        84 ~~~~~CpYCG~ry~   97 (102)
                      .....|.||+..+.
T Consensus        22 ~~~~~C~YC~~~~~   35 (144)
T TIGR02646        22 LQGGLCAYCEREIE   35 (144)
T ss_pred             HhCCCcCccCCCcC
Confidence            34578999999554


No 142
>PF14921 APCDDC:  Adenomatosis polyposis coli down-regulated 1
Probab=21.08  E-value=43  Score=26.78  Aligned_cols=17  Identities=41%  Similarity=0.925  Sum_probs=15.3

Q ss_pred             ceecCCCCcccccccCC
Q 034182           86 PAICKYCGLRYVQDHHH  102 (102)
Q Consensus        86 ~~~CpYCG~ry~~~~hh  102 (102)
                      ...||-||..|..++||
T Consensus       218 ~~~C~~C~~i~rs~e~~  234 (240)
T PF14921_consen  218 AHPCPACGIIYRSDEHH  234 (240)
T ss_pred             CCCCCccceeeecccCC
Confidence            56799999999999887


No 143
>smart00286 PTI Plant trypsin inhibitors.
Probab=20.41  E-value=46  Score=18.75  Aligned_cols=20  Identities=35%  Similarity=0.675  Sum_probs=12.6

Q ss_pred             CCceEEEcCCCC--ce--ec---CCCC
Q 034182           74 HPIEFICLDLKE--PA--IC---KYCG   93 (102)
Q Consensus        74 HPrVyI~Ld~~~--~~--~C---pYCG   93 (102)
                      -||+++.-..+.  .+  +|   +|||
T Consensus         3 CPrIlm~Ck~DsDCl~~CiC~~~G~CG   29 (29)
T smart00286        3 CPRILMECKRDSDCMAECICLANGYCG   29 (29)
T ss_pred             CchhhhccccccCcccCCEEccccccC
Confidence            588888777653  23  33   6776


No 144
>cd04487 RecJ_OBF2_like RecJ_OBF2_like: A subfamily of OB folds corresponding to the second OB fold (OBF2) of archaeal-specific proteins with similarity to eubacterial RecJ. RecJ is an ssDNA-specific exonuclease. Although the overall sequence similarity of these proteins to eubacterial RecJ proteins is marginal, they appear to carry motifs, which have been shown to be essential for nuclease function in Escherichia coli RecJ. In addition to this OB fold, most proteins in this subfamily contain: i) an N-terminal OB fold belonging to a different domain family (the ribosomal S1-like RNA-binding family); and ii) a domain, C-terminal to OBF2, characteristic of DHH family proteins. DHH family proteins include E. coli RecJ, and are predicted to have a phosphoesterase function.
Probab=20.41  E-value=1.1e+02  Score=19.49  Aligned_cols=30  Identities=17%  Similarity=0.248  Sum_probs=17.7

Q ss_pred             EecCeEEeecCCCCCCCCCCceEEEcCCCC-ceecCC
Q 034182           56 KVEGRIVACEGDSNPALGHPIEFICLDLKE-PAICKY   91 (102)
Q Consensus        56 ~V~~~~v~CdG~~~palGHPrVyI~Ld~~~-~~~CpY   91 (102)
                      .|.+.+..+.-    .-||  +|+.|.+++ ...|-.
T Consensus         2 ~v~GeVs~~~~----~~GH--vyfsLkD~~a~i~cv~   32 (73)
T cd04487           2 HIEGEVVQIKQ----TSGP--TIFTLRDETGTVWAAA   32 (73)
T ss_pred             EEEEEEecccc----CCCC--EEEEEEcCCEEEEEEE
Confidence            34455555543    1477  999996554 566743


No 145
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=20.40  E-value=56  Score=23.29  Aligned_cols=38  Identities=29%  Similarity=0.455  Sum_probs=23.2

Q ss_pred             CeEEeecCCCCC-------CCCCCceEEEcCCCCceecCCCCccccc
Q 034182           59 GRIVACEGDSNP-------ALGHPIEFICLDLKEPAICKYCGLRYVQ   98 (102)
Q Consensus        59 ~~~v~CdG~~~p-------alGHPrVyI~Ld~~~~~~CpYCG~ry~~   98 (102)
                      .|=..|.|.--+       ..-.|.||-..+  ....||=||+.|=.
T Consensus        92 sRC~~CN~~L~~v~~~~v~~~vp~~v~~~~~--~f~~C~~C~kiyW~  136 (147)
T PF01927_consen   92 SRCPKCNGPLRPVSKEEVKDRVPPYVYETYD--EFWRCPGCGKIYWE  136 (147)
T ss_pred             CccCCCCcEeeechhhccccccCccccccCC--eEEECCCCCCEecc
Confidence            455566664211       234556665554  37899999999943


No 146
>cd03528 Rieske_RO_ferredoxin Rieske non-heme iron oxygenase (RO) family, Rieske ferredoxin component; composed of the Rieske ferredoxin component of some three-component RO systems including biphenyl dioxygenase (BPDO) and carbazole 1,9a-dioxygenase (CARDO). The RO family comprise a large class of aromatic ring-hydroxylating dioxygenases found predominantly in microorganisms. These enzymes enable microorganisms to tolerate and even exclusively utilize aromatic compounds for growth. ROs consist of two or three components: reductase, oxygenase, and ferredoxin (in some cases) components. The ferredoxin component contains either a plant-type or Rieske-type [2Fe-2S] cluster. The Rieske ferredoxin component in this family carries an electron from the RO reductase component to the terminal RO oxygenase component. BPDO degrades biphenyls and polychlorinated biphenyls. BPDO ferredoxin (BphF) has structural features consistent with a minimal and perhaps archetypical Rieske protein in that the in
Probab=20.39  E-value=62  Score=20.63  Aligned_cols=16  Identities=19%  Similarity=0.202  Sum_probs=13.3

Q ss_pred             CCceecCCCCcccccc
Q 034182           84 KEPAICKYCGLRYVQD   99 (102)
Q Consensus        84 ~~~~~CpYCG~ry~~~   99 (102)
                      ++..+|||-|.+|-++
T Consensus        55 ~~~i~Cp~Hg~~fd~~   70 (98)
T cd03528          55 GGVIECPLHGGRFDLR   70 (98)
T ss_pred             CCEEEeCCcCCEEECC
Confidence            4689999999999763


Done!