BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 034183
(102 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1JYM|A Chain A, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
pdb|1JYM|B Chain B, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
pdb|1JYM|C Chain C, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
pdb|1JYM|D Chain D, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
pdb|1JYM|E Chain E, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
pdb|1JYM|F Chain F, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
pdb|1JYM|G Chain G, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
pdb|1JYM|H Chain H, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
pdb|1JYM|I Chain I, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
pdb|1JYM|J Chain J, Crystals Of Peptide Deformylase From Plasmodium Falciparum
With Ten Subunits Per Asymmetric Unit Reveal Critical
Characteristics Of The Active Site For Drug Design
Length = 183
Score = 28.1 bits (61), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 16/57 (28%), Positives = 25/57 (43%), Gaps = 13/57 (22%)
Query: 51 GSIVATRAEENSRFYGNPSI-------------CASAILLGSLPRPPAAAILYHALS 94
++ R EEN R + NPSI C S + G + RP +I Y+ ++
Sbjct: 60 NALYEKRKEENERIFINPSIVEQSLVKLKLIEGCLSFGIEGKVERPSIVSISYYDIN 116
>pdb|3IYP|F Chain F, The Interaction Of Decay-Accelerating Factor With
Echovirus 7
Length = 381
Score = 25.8 bits (55), Expect = 5.7, Method: Composition-based stats.
Identities = 17/53 (32%), Positives = 23/53 (43%), Gaps = 4/53 (7%)
Query: 30 GYAACYTYSCSKG-AFVGCSLEGSIVATRAEENSRFYGNPSICASAILLGSLP 81
GY TY+C+KG +G E SI T + + G P C L +P
Sbjct: 244 GYRQSVTYACNKGFTMIG---EHSIYCTVNNDEGEWSGPPPECRGKSLTSKVP 293
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.135 0.407
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,585,824
Number of Sequences: 62578
Number of extensions: 85061
Number of successful extensions: 229
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 228
Number of HSP's gapped (non-prelim): 4
length of query: 102
length of database: 14,973,337
effective HSP length: 67
effective length of query: 35
effective length of database: 10,780,611
effective search space: 377321385
effective search space used: 377321385
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 45 (21.9 bits)