Query         034184
Match_columns 102
No_of_seqs    15 out of 17
Neff          1.9 
Searched_HMMs 46136
Date          Fri Mar 29 10:42:25 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/034184.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/034184hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd02988 Phd_like_VIAF Phosduci  23.6      24 0.00053   26.1  -0.2    9   52-60      1-9   (192)
  2 KOG3170 Conserved phosducin-li  16.5      45 0.00098   27.4  -0.1   14   48-61      4-17  (240)
  3 PF06880 DUF1262:  Protein of u  13.6      93   0.002   22.6   0.9   13   79-91     62-74  (104)
  4 PF13101 DUF3945:  Protein of u   9.6 2.3E+02   0.005   17.5   1.6   33   33-69     13-45  (59)
  5 PF02251 PA28_alpha:  Proteasom   9.5 1.2E+02  0.0027   19.6   0.4   20   63-87     45-64  (64)
  6 PF03089 RAG2:  Recombination a   8.8 2.3E+02  0.0051   24.3   1.8   21   35-55    239-259 (337)
  7 KOG2944 Glyoxalase [Carbohydra   8.6 1.1E+02  0.0025   23.9  -0.1   24    2-25    109-133 (170)
  8 PF08366 LLGL:  LLGL2;  InterPr   8.4 1.2E+02  0.0026   21.5  -0.0   44   18-64     43-87  (105)
  9 PF09961 DUF2195:  Uncharacteri   8.0 2.7E+02  0.0059   20.6   1.7   38   16-53     23-60  (121)
 10 PHA01745 hypothetical protein    7.7 1.1E+02  0.0025   25.8  -0.4   18   76-93     70-87  (306)

No 1  
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis. It was identified as an IAP binding protein through a screen of a human B-cell library using a prototype IAP. VIAF lacks a consensus IAP binding motif and while it does not function as an IAP antagonist, it still plays a regulatory role in the complete activation of caspases. VIAF itself is a substrate for IAP-mediated ubiquitination, suggesting that it may be a target of IAPs in the prevention of cell death. The similarity of VIAF to Phd points to a potential role distinct from apoptosis regulation. Phd functions as a cytosolic regulator of G protein by specifically binding to G protein betagamma (Gbg)-subunits. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-terminal helical domain.
Probab=23.59  E-value=24  Score=26.10  Aligned_cols=9  Identities=44%  Similarity=0.896  Sum_probs=6.7

Q ss_pred             CCCCcchhh
Q 034184           52 GEWSDIQAT   60 (102)
Q Consensus        52 ~EW~d~q~t   60 (102)
                      |||+|||..
T Consensus         1 tew~di~r~    9 (192)
T cd02988           1 TEWNDILRK    9 (192)
T ss_pred             CchhHHHHH
Confidence            688888753


No 2  
>KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms]
Probab=16.49  E-value=45  Score=27.38  Aligned_cols=14  Identities=36%  Similarity=0.643  Sum_probs=11.5

Q ss_pred             cCCCCCCCcchhhh
Q 034184           48 PIGDGEWSDIQATE   61 (102)
Q Consensus        48 pvgd~EW~d~q~tE   61 (102)
                      |..|+||+||+-.-
T Consensus         4 ~~~dtewnDIlRkk   17 (240)
T KOG3170|consen    4 ESEDTEWNDILRKK   17 (240)
T ss_pred             cccccchHHHHHhc
Confidence            67899999998654


No 3  
>PF06880 DUF1262:  Protein of unknown function (DUF1262);  InterPro: IPR010683 This family represents a conserved region within a number of proteins of unknown function that seem to be specific to Arabidopsis thaliana. Note that some family members contain more than one copy of this region.
Probab=13.62  E-value=93  Score=22.56  Aligned_cols=13  Identities=31%  Similarity=0.697  Sum_probs=10.8

Q ss_pred             ccccccCCCCCCC
Q 034184           79 LDIPVVSPPVNNH   91 (102)
Q Consensus        79 LDIpVvs~P~~~~   91 (102)
                      +=|||..||.+.+
T Consensus        62 ~FIPVl~QPLSSn   74 (104)
T PF06880_consen   62 VFIPVLNQPLSSN   74 (104)
T ss_pred             EEEEcCCCcCcCC
Confidence            5599999998765


No 4  
>PF13101 DUF3945:  Protein of unknown function (DUF3945)
Probab=9.59  E-value=2.3e+02  Score=17.53  Aligned_cols=33  Identities=21%  Similarity=0.408  Sum_probs=24.9

Q ss_pred             CCceeEeeccccccccCCCCCCCcchhhhhhhhhccc
Q 034184           33 GASVVHMTVDQVNLQPIGDGEWSDIQATEARIADVRE   69 (102)
Q Consensus        33 ~e~vV~m~~d~v~i~pvgd~EW~d~q~tEa~isDVRE   69 (102)
                      .+.++.|..+.+-|+    .+|.+.+-|+...++.++
T Consensus        13 Tn~l~~~~~~~i~ip----~~i~g~~Ls~~q~~~L~~   45 (59)
T PF13101_consen   13 TNELVYMPVDKIRIP----DKIKGVELSPEQKEDLRE   45 (59)
T ss_pred             cCceEEecccccccc----ceecCccCCHHHHHHHHC
Confidence            455688888888877    778888888777777664


No 5  
>PF02251 PA28_alpha:  Proteasome activator pa28 alpha subunit;  InterPro: IPR003185 PA28 activator complex (also known as 11S regulator of 20S proteasome) is a ring shaped hexameric structure of alternating alpha (PA28alpha) and beta (PA28beta) subunits. The catalytic properties of PA28alpha and PA28beta-activated proteosome are similar [, ]. This entry represents the alpha subunit. The activator complex binds to the 20S proteasome and stimulates peptidase activity in and ATP-independent manner.; GO: 0008537 proteasome activator complex; PDB: 1AVO_K.
Probab=9.54  E-value=1.2e+02  Score=19.58  Aligned_cols=20  Identities=30%  Similarity=0.793  Sum_probs=3.2

Q ss_pred             hhhhccccccCCCCCcccccccCCC
Q 034184           63 RIADVREVAPETEGSSLDIPVVSPP   87 (102)
Q Consensus        63 ~isDVREv~~E~e~sSLDIpVvs~P   87 (102)
                      .++|..+|-++     |||||=.||
T Consensus        45 n~~dls~i~~~-----lnIPiPdP~   64 (64)
T PF02251_consen   45 NLSDLSSIHAP-----LNIPIPDPP   64 (64)
T ss_dssp             --S-GGGS-----------------
T ss_pred             ccccHHhhcCc-----CCCCCCCCC
Confidence            45566666543     999985543


No 6  
>PF03089 RAG2:  Recombination activating protein 2;  InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination. V(D)J recombination is targeted to specific sites on the chromosome by recombination signal sequences (RSSs) that flank antigen receptor gene segments. The RSS consists of a conserved heptamer (consensus, 5'-CACAGTG-3') and nonamer (consensus, 5'-ACAAAAACC-3') separated by a spacer of either 12 or 23 bp. Efficient recombination occurs between a 12-RSS and a 23-RSS, a restriction known as the 12/23 rule. V(D)J recombination can be divided into two phases, DNA cleavage and DNA joining. DNA cleavage requires two lymphocyte-specific factors, the products of the recombination activating genes, RAG1 and RAG2, which together recognise the RSSs and create double strand breaks at the RSS-coding segment junctions []. RAG-mediated DNA cleavage occurs in a synaptic complex termed the paired complex, which is constituted from two distinct RSS-RAG complexes, a 12-SC and a 23-SC (where SC stands for signal complex). The DNA cleavage reaction involves two distinct enzymatic steps, initial nicking that creates a 3'-OH between a coding segment and its RSS, followed by hairpin formation in which the newly created 3'-OH attacks a phosphodiester bond on the opposite DNA strand. This generates a blunt, 5' phosphorylated signal end containing all of the RSS elements, and a covalently sealed hairpin coding end.  The second phase of V(D)J recombination, in which broken DNA fragments are processed and joined, is less well characterised. Signal ends are typically joined precisely to form a signal joint, whereas joining of the coding ends requires the hairpin structure to be opened and typically involves nucleotide addition and deletion before formation of the coding joint. The factors involved in these processes include ubiquitously expressed proteins involved in the repair of DNA double strand breaks by nonhomologous end joining, terminal deoxynucleotidyl transferase, and Artemis protein. In addition to their critical roles in RSS recognition and DNA cleavage, the RAG proteins may perform two distinct types of functions in the postcleavage phase of V(D)J. A structural function has been inferred from the finding that, after DNA cleavage in vitro, the DNA ends remain associated with the RAG proteins in a "four end" complex known as the cleaved signal complex. After release of the coding ends in vitro, and after coding joint formation in vivo, the RAG proteins remain in a stable signal end complex (SEC) containing the two signal ends. These postcleavage complexes may serve as essential scaffolds for the second phase of the reaction, with the RAG proteins acting to organise the DNA processing and joining events.  The second type of RAG protein-mediated postcleavage activity is the catalysis of phosphodiester bond hydrolysis and strand transfer reactions. The RAG proteins are capable of opening hairpin coding ends in vitro. The RAG proteins also show 3' flap endonuclease activity that may contribute to coding end processing/joining and can utilise the 3' OH group on the signal ends to attack hairpin coding ends (forming hybrid or open/shut joints) or virtually any DNA duplex (forming a transposition product).; GO: 0003677 DNA binding, 0006310 DNA recombination, 0005634 nucleus
Probab=8.75  E-value=2.3e+02  Score=24.35  Aligned_cols=21  Identities=19%  Similarity=0.474  Sum_probs=19.1

Q ss_pred             ceeEeeccccccccCCCCCCC
Q 034184           35 SVVHMTVDQVNLQPIGDGEWS   55 (102)
Q Consensus        35 ~vV~m~~d~v~i~pvgd~EW~   55 (102)
                      +.|-|++++++|.|..-.+|.
T Consensus       239 ~~V~Ldd~~I~ie~~E~P~Wt  259 (337)
T PF03089_consen  239 NTVSLDDDGIHIEEREPPEWT  259 (337)
T ss_pred             eEEEEeCCceEeccCCCCCCC
Confidence            458899999999999999996


No 7  
>KOG2944 consensus Glyoxalase [Carbohydrate transport and metabolism]
Probab=8.59  E-value=1.1e+02  Score=23.91  Aligned_cols=24  Identities=17%  Similarity=0.389  Sum_probs=20.0

Q ss_pred             CCCCC-CCCCcCCCccccccccccc
Q 034184            2 DNSLP-QTKDVDLSDENVDKACLSV   25 (102)
Q Consensus         2 ~~s~p-~tKhvD~sd~nVDKAClS~   25 (102)
                      +|+.| .--|+=.+=+||++||-+.
T Consensus       109 gN~~prGfgHIci~V~di~sac~~l  133 (170)
T KOG2944|consen  109 GNKEPRGFGHICIEVDDINSACERL  133 (170)
T ss_pred             CCCCCCccceEEEEeCCHHHHHHHH
Confidence            57777 7789999999999999754


No 8  
>PF08366 LLGL:  LLGL2;  InterPro: IPR013577 This domain is found in lethal giant larvae homologue 2 (LLGL2) proteins and syntaxin-binding proteins like tomosyn []. It has been identified in eukaryotes and tends to be found together with WD repeats (IPR001680 from INTERPRO). 
Probab=8.41  E-value=1.2e+02  Score=21.48  Aligned_cols=44  Identities=20%  Similarity=0.428  Sum_probs=30.8

Q ss_pred             cccccccccccccCCCCceeEeeccccccccCCCCCCC-cchhhhhhh
Q 034184           18 VDKACLSVSRAVPEPGASVVHMTVDQVNLQPIGDGEWS-DIQATEARI   64 (102)
Q Consensus        18 VDKAClS~sr~vpv~~e~vV~m~~d~v~i~pvgd~EW~-d~q~tEa~i   64 (102)
                      =|+-|+++.+.   ....+.+|+-.=+|.-++-+..|. ++|...|.+
T Consensus        43 gdr~~vTV~~g---~~~~~ldf~s~VIDF~~i~~~~~~~e~~~P~alv   87 (105)
T PF08366_consen   43 GDRHCVTVMQG---KTHVVLDFTSRVIDFFTICESPWPNEFQDPYALV   87 (105)
T ss_pred             CCCceEEEEeC---CEEEEEEcCCceEEEEEEcCCCCccccCCCcEEE
Confidence            46789998872   122347788888899999999887 566655443


No 9  
>PF09961 DUF2195:  Uncharacterized protein conserved in bacteria (DUF2195);  InterPro: IPR018696 This family of various bacterial proteins has no known function.
Probab=8.03  E-value=2.7e+02  Score=20.62  Aligned_cols=38  Identities=21%  Similarity=0.342  Sum_probs=29.5

Q ss_pred             cccccccccccccccCCCCceeEeeccccccccCCCCC
Q 034184           16 ENVDKACLSVSRAVPEPGASVVHMTVDQVNLQPIGDGE   53 (102)
Q Consensus        16 ~nVDKAClS~sr~vpv~~e~vV~m~~d~v~i~pvgd~E   53 (102)
                      +|==-||+.+.-.-|-..++.|++.-+=---+|||+=.
T Consensus        23 ~N~LaaCv~~~~~~~~~~~n~v~l~~~~~l~~siG~CG   60 (121)
T PF09961_consen   23 DNALAACVDVKPGQPQTADNQVSLKATFSLRRSIGECG   60 (121)
T ss_pred             eCcHHHHhcCcccCccccCCeEEEEEEEEEecccCccc
Confidence            45556999999988988999988876655567898754


No 10 
>PHA01745 hypothetical protein
Probab=7.65  E-value=1.1e+02  Score=25.84  Aligned_cols=18  Identities=33%  Similarity=0.405  Sum_probs=13.7

Q ss_pred             CCcccccccCCCCCCCCC
Q 034184           76 GSSLDIPVVSPPVNNHHE   93 (102)
Q Consensus        76 ~sSLDIpVvs~P~~~~h~   93 (102)
                      =-|||||...-|+...++
T Consensus        70 y~SLDiP~~~dp~d~kNf   87 (306)
T PHA01745         70 FFSLDIPSIFEPLSRKNF   87 (306)
T ss_pred             eeecCCCCcCCChhhhhH
Confidence            569999998778775443


Done!